RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780469|ref|YP_003064882.1| zinc-binding protein [Candidatus Liberibacter asiaticus str. psy62] (63 letters) >1lv3_A Hypothetical protein YACG; zinc finger, rubredoxin knuckle, C4 tetrahedral Zn+2, antiparallel beta strand and alpha helix, NESG project; NMR {Escherichia coli} SCOP: g.39.1.9 Length = 68 Score = 53.4 bits (128), Expect = 1e-08 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K G + F PFCS +C+ IDL W E I + D ++ Sbjct: 12 CPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGDLSESDD 61 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 32.2 bits (73), Expect = 0.026 Identities = 4/51 (7%), Positives = 15/51 (29%), Gaps = 18/51 (35%) Query: 6 FRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHG-------EYVIAA 49 L + + + + +++ WL +Y+++ Sbjct: 195 LSEL-IRTTLDAE----KVFT------QGLNILEWLENPSNTPDKDYLLSI 234 >3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 Score = 31.0 bits (70), Expect = 0.058 Identities = 11/46 (23%), Positives = 18/46 (39%), Gaps = 14/46 (30%) Query: 8 SLKSICPECRKGS--MVEFYP----FCSTQC------RSIDL-SRW 40 ++ CPEC+ +VE + C C + +D S W Sbjct: 19 NIVLTCPECKVYPPKIVERFSEGDVVC-ALCGLVLSDKLVDTRSEW 63 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.320 0.133 0.409 Gapped Lambda K H 0.267 0.0463 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 544,588 Number of extensions: 18394 Number of successful extensions: 112 Number of sequences better than 10.0: 1 Number of HSP's gapped: 112 Number of HSP's successfully gapped: 8 Length of query: 63 Length of database: 5,693,230 Length adjustment: 34 Effective length of query: 29 Effective length of database: 4,868,934 Effective search space: 141199086 Effective search space used: 141199086 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.7 bits)