RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780469|ref|YP_003064882.1| zinc-binding protein [Candidatus Liberibacter asiaticus str. psy62] (63 letters) >d1lv3a_ g.39.1.9 (A:) Hypothetical zinc finger protein YacG {Escherichia coli [TaxId: 562]} Length = 65 Score = 53.4 bits (128), Expect = 6e-09 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 4/50 (8%) Query: 13 CPECRK----GSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEE 58 CP C K G + F PFCS +C+ IDL W E I + D ++ Sbjct: 9 CPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGDLSESDD 58 >d1h0ha2 c.81.1.1 (A:1-812) Tungsten containing formate dehydrogenase, large subunit {Desulfovibrio gigas [TaxId: 879]} Length = 812 Score = 23.7 bits (50), Expect = 4.6 Identities = 5/16 (31%), Positives = 9/16 (56%) Query: 1 MQTSDFRSLKSICPEC 16 ++T D + S+C C Sbjct: 5 LKTVDAKQTTSVCCYC 20 >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Length = 268 Score = 23.0 bits (48), Expect = 6.6 Identities = 6/27 (22%), Positives = 11/27 (40%) Query: 13 CPECRKGSMVEFYPFCSTQCRSIDLSR 39 CP C + E + Q D+++ Sbjct: 4 CPLCHQPLSREKNSYICPQRHQFDMAK 30 >d3enba1 c.55.3.14 (A:1771-1989) Pre-mRNA-splicing factor 8, Prp8 {Human (Homo sapiens) [TaxId: 9606]} Length = 219 Score = 22.8 bits (49), Expect = 7.6 Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 31 QCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDIL 63 Q R L++W E V A + EE+ K I+ Sbjct: 60 QKRLGQLAKWKTAEEVAALIRSLPVEEQPKQII 92 >d3e9oa1 c.55.3.14 (A:1835-2087) Pre-mRNA-splicing factor 8, Prp8 {Saccharomyces cerevisiae [TaxId: 4932]} Length = 253 Score = 22.8 bits (49), Expect = 8.4 Identities = 12/33 (36%), Positives = 16/33 (48%) Query: 31 QCRSIDLSRWLHGEYVIAAVEDEKSEEEVKDIL 63 Q R L++W E V A V EE+ K I+ Sbjct: 68 QKRLSQLAKWKTAEEVSALVRSLPKEEQPKQII 100 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.320 0.133 0.409 Gapped Lambda K H 0.267 0.0653 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 237,581 Number of extensions: 8010 Number of successful extensions: 42 Number of sequences better than 10.0: 1 Number of HSP's gapped: 42 Number of HSP's successfully gapped: 9 Length of query: 63 Length of database: 2,407,596 Length adjustment: 32 Effective length of query: 31 Effective length of database: 1,968,236 Effective search space: 61015316 Effective search space used: 61015316 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.0 bits)