>cd04451 S1_IF1 S1_IF1: Translation Initiation Factor IF1, S1-like RNA-binding domain. IF1 contains an S1-like RNA-binding domain, which is found in a wide variety of RNA-associated proteins. Translation initiation includes a number of interrelated steps preceding the formation of the first peptide bond. In Escherichia coli, the initiation mechanism requires, in addition to mRNA, fMet-tRNA, and ribosomal subunits, the presence of three additional proteins (initiation factors IF1, IF2, and IF3) and at least one GTP molecule. The three initiation factors influence both the kinetics and the stability of ternary complex formation. IF1 is the smallest of the three factors. IF1 enhances the rate of 70S ribosome subunit association and dissociation and the interaction of 30S ribosomal subunit with IF2 and IF3. It stimulates 30S complex formation. In addition, by binding to the A-site of the 30S ribosomal subunit, IF1 may contribute to the fidelity of the selection of the initiation site of th

Probab=99.97 E-value=1.8e-30 Score=198.34 Aligned_cols=64 Identities=52% Similarity=0.871 Sum_probs=61.7 Q ss_pred EEEEEEEEECCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCEEEEEEEEE Q ss_conf 99978999815898179998166776533323354433344555544455555445556882899991251120164770 Q gi|254780470|r 7 LEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPISYLDNAVVIAYTAGRMRKHRIRIS 86 (110) Q Consensus 7 ie~~G~V~E~LPna~FrV~L~~~d~~~~~~~~l~~~~~~~f~~~g~~~g~~g~~~~s~~~~~~VlA~isGKmRk~~IRIl 86 (110) T Consensus 1 ie~~G~V~e~lpn~~F~V~Le--------------------------------------ng~~v~a~~sGKmr~~~Iril 42 (64) T cd04451 1 IEMEGVVTEALPNAMFRVELE--------------------------------------NGHEVLAHISGKMRMNYIRIL 42 (64) T ss_pred CEEEEEEEEECCCCEEEEEEC--------------------------------------CCCEEEEEECCHHEEEEEEEC T ss_conf 978899999879988999978--------------------------------------998999997233041269845 Q ss_pred CCCEEEEEECCCCCCCCEEEEE Q ss_conf 2996999974675784359884 Q gi|254780470|r 87 LGDKVKVAMNPYDMTRARITYR 108 (110) Q Consensus 87 ~GDkV~Ve~SPYDLtkGRItyR 108 (110) T Consensus 43 ~GD~V~VE~SpYDltkGRI~~R 64 (64) T cd04451 43 PGDRVKVELSPYDLTKGRIVYR 64 (64) T ss_pred CCCEEEEEECCCCCCCEEEEEC T ss_conf 8998999988667885789859

HHsearch alignment for GI: 254780470 and conserved domain: cd04451