RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780470|ref|YP_003064883.1| translation initiation factor IF-1 [Candidatus Liberibacter asiaticus str. psy62] (110 letters) >3i4o_A Translation initiation factor IF-1; cytoplasm, protein biosynthesis; 1.47A {Mycobacterium tuberculosis} Length = 79 Score = 85.1 bits (211), Expect = 3e-18 Identities = 34/111 (30%), Positives = 51/111 (45%), Gaps = 39/111 (35%) Query: 1 MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59 M K++ +E G V E LPNA FR++L Sbjct: 7 MAKKDGAIEVEGRVVEPLPNAMFRIEL--------------------------------- 33 Query: 60 DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110 + V+A+ +G+MR+H IRI D+V V ++PYD++R RI YR+K Sbjct: 34 -----ENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK 79 >1hr0_W Translation initiation factor; ribosomal subunit, ribosome, IF1; 3.20A {Escherichia coli} SCOP: b.40.4.5 PDB: 1zo1_W Length = 71 Score = 79.7 bits (197), Expect = 2e-16 Identities = 35/106 (33%), Positives = 47/106 (44%), Gaps = 38/106 (35%) Query: 3 KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPI 62 +++T+ G+V+E LPNA FRVKL Sbjct: 3 EKDTIRTEGVVTEALPNATFRVKL------------------------------------ 26 Query: 63 SYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYR 108 ++AY +G+MR H IRI GD+V V + PYD TR RI YR Sbjct: 27 --DSGPEILAYISGKMRMHYIRILPGDRVVVEITPYDPTRGRIVYR 70 >1ah9_A IF1, initiation factor 1; ribosome binding, protein-RNA interaction, OB fold; NMR {Escherichia coli} SCOP: b.40.4.5 Length = 71 Score = 79.0 bits (195), Expect = 2e-16 Identities = 34/108 (31%), Positives = 48/108 (44%), Gaps = 38/108 (35%) Query: 3 KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPI 62 KE+ +E G V E LPN FRV+L Sbjct: 2 KEDNIEMQGTVLETLPNTMFRVELE----------------------------------- 26 Query: 63 SYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110 + VV A+ +G+MRK+ IRI GDKV V + PYD+++ RI +R + Sbjct: 27 ---NGHVVTAHISGKMRKNYIRILTGDKVTVELTPYDLSKGRIVFRSR 71 >1jt8_A EIF-1A, probable translation initiation factor 1A; beta barrel, translation factor; NMR {Methanocaldococcus jannaschii} SCOP: b.40.4.5 Length = 102 Score = 55.8 bits (135), Expect = 2e-09 Identities = 19/110 (17%), Positives = 35/110 (31%), Gaps = 40/110 (36%) Query: 1 MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60 +P++E E GI+ ++L + RV+ + Sbjct: 14 IPRKEENEILGIIEQMLGASRVRVRCL--------------------------------- 40 Query: 61 PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDM-TRARITYRF 109 D + GR++ RI + GD V V + I +R+ Sbjct: 41 -----DGKTRLGRIPGRLKN-RIWVREGDVVIVKPWEVQGDQKCDIIWRY 84 >2oqk_A Putative translation initiation factor EIF-1A; malaria, eukaryotic initiation factor (EIF), SGC, structural genomics; 1.80A {Cryptosporidium parvum iowa II} Length = 117 Score = 48.6 bits (116), Expect = 3e-07 Identities = 14/110 (12%), Positives = 32/110 (29%), Gaps = 39/110 (35%) Query: 1 MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60 + +E + G V +L N Sbjct: 26 LVFKEEGQEYGQVQRMLGNGRLDAYCFDGQ------------------------------ 55 Query: 61 PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110 + + G+MRK ++ ++ GD V V++ + ++ I ++ Sbjct: 56 --------KRLCHIRGKMRK-KVWVNPGDIVLVSLRDFQDSKGDIILKYT 96 >1d7q_A Translation initiation factor 1A; OB-fold, beta-barrel, RNA-binding protein; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 143 Score = 48.0 bits (114), Expect = 6e-07 Identities = 13/109 (11%), Positives = 31/109 (28%), Gaps = 39/109 (35%) Query: 1 MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60 + +E + V ++L N Sbjct: 25 LVFKEDGQEYAQVIKMLGNGRLEAMCF--------------------------------- 51 Query: 61 PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109 D + + G++RK ++ I+ D + V + Y +A + ++ Sbjct: 52 -----DGVKRLCHIRGKLRK-KVWINTSDIILVGLRDYQDNKADVILKY 94 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 31.8 bits (72), Expect = 0.039 Identities = 11/55 (20%), Positives = 21/55 (38%), Gaps = 20/55 (36%) Query: 66 DNAVVIAYTAG----------RMRKHRIRISLG-DKVKVAMNPYDMTRARITYRF 109 N VV +G +RK + G D+ ++ P+ + + + RF Sbjct: 375 KNLVV----SGPPQSLYGLNLTLRK--AKAPSGLDQSRI---PFSERKLKFSNRF 420 >2ivn_A O-sialoglycoprotein endopeptidase; UP1 keops complex, Fe/Zn dependent nucleotide phosphatase, metalloprotease, hypothetical protein, zinc; HET: ANP; 1.65A {Pyrococcus abyssi} PDB: 2ivo_A 2ivp_A* Length = 330 Score = 26.4 bits (57), Expect = 1.7 Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 4/57 (7%) Query: 34 SADCKLDSKVKSNFSESGSESGNDGVDPISYL-DNAVVIAYTAGRMRKHRIRISLGD 89 +A+ +L ++ + G + V P DN +IAYT RM K I L + Sbjct: 255 AANNRLREMLRIMTEDRGIKFF---VPPYDLCRDNGAMIAYTGLRMYKAGISFRLEE 308 >3eno_A Putative O-sialoglycoprotein endopeptidase; hydrolase, metal-binding, metalloprotease, protease, zinc, keops complex, ATPase, metal ION binding; 3.02A {Thermoplasma acidophilum} Length = 334 Score = 25.2 bits (54), Expect = 3.4 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 66 DNAVVIAYTAGRMRKHRIRISLGD 89 DN ++IA A M K +R+S+ + Sbjct: 290 DNGIMIAQAALLMYKSGVRMSVEE 313 >3k8u_A Putative ABC transporter, ATP-binding protein COMA; cysteine protease, quorum-sensing, hydrolase; 1.90A {Streptococcus mutans} Length = 156 Score = 25.0 bits (54), Expect = 3.7 Identities = 7/24 (29%), Positives = 12/24 (50%), Gaps = 1/24 (4%) Query: 1 MPKEETLE-FSGIVSELLPNANFR 23 M KE ++G+ L P N++ Sbjct: 122 MSKERFQSEWTGLAIFLAPQPNYK 145 >2z1d_A Hydrogenase expression/formation protein HYPD; [NIFE] hydrogenase maturation, [4Fe-4S] cluster, thiol redox; HET: CSW; 2.07A {Thermococcus kodakarensis KOD1} Length = 372 Score = 25.0 bits (55), Expect = 4.7 Identities = 7/35 (20%), Positives = 14/35 (40%) Query: 59 VDPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKV 93 + P+ + +I A + I + GD K+ Sbjct: 70 ITPVEDIVAMQLIMRKAREEGEEIILTTFGDMYKI 104 >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ ATPase, DNA polymerase; HET: ATG ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Score = 24.8 bits (53), Expect = 4.9 Identities = 5/10 (50%), Positives = 7/10 (70%) Query: 38 KLDSKVKSNF 47 K+ + VKS F Sbjct: 492 KIPATVKSGF 501 >2id0_A Exoribonuclease 2; RNAse, exonuclease, hydrolyase, mRNA decay, RNR family, hydrolase; 2.35A {Escherichia coli K12} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 PDB: 2ix0_A* 2ix1_A Length = 644 Score = 24.5 bits (52), Expect = 6.0 Identities = 8/45 (17%), Positives = 13/45 (28%), Gaps = 4/45 (8%) Query: 53 ESGNDGVDPISYL----DNAVVIAYTAGRMRKHRIRISLGDKVKV 93 ++G P +L D V K + D + V Sbjct: 582 DNGAIAFIPAPFLHAVRDELVCSQENGTVQIKGETVYKVTDVIDV 626 >1giy_D 50S ribosomal protein L2; ribosome assembly, protein synthesis, LIFE; 5.50A {Thermus thermophilus} SCOP: i.1.1.1 PDB: 1ml5_d* 1yl3_D 2b66_D 2b9n_D 2b9p_D Length = 178 Score = 24.4 bits (53), Expect = 6.5 Identities = 10/27 (37%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Query: 75 AGRMR-KHRIRISLGDKVK-VAMNPYD 99 AG K + R + V+ VAMN D Sbjct: 148 AGNKHHKMKARGTKWPNVRGVAMNAVD 174 >2kh2_B SCFV; single chain FV, IL-1B, antibody, cytokine, inflammatory response, mitogen, pyrogen, secreted, cytokine/immune system complex; NMR {Mus musculus} Length = 254 Score = 24.5 bits (53), Expect = 6.6 Identities = 12/30 (40%), Positives = 12/30 (40%), Gaps = 2/30 (6%) Query: 36 DCKLDSKVKSNFSESGSESGNDGVDPISYL 65 L V S F SGS SG IS L Sbjct: 51 AKTLADGVPSRF--SGSGSGTQFTLTISSL 78 >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Length = 307 Score = 24.0 bits (51), Expect = 8.7 Identities = 10/51 (19%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Query: 59 VDPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109 V S + V+ G RK++I +GD V + + Sbjct: 25 VLDESEDSDKVIQCRGRGIFRKNKITPLVGDYVVY--QAENDKEGYLMEIK 73 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.315 0.132 0.365 Gapped Lambda K H 0.267 0.0549 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 897,076 Number of extensions: 35756 Number of successful extensions: 126 Number of sequences better than 10.0: 1 Number of HSP's gapped: 123 Number of HSP's successfully gapped: 29 Length of query: 110 Length of database: 5,693,230 Length adjustment: 74 Effective length of query: 36 Effective length of database: 3,899,174 Effective search space: 140370264 Effective search space used: 140370264 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 50 (23.4 bits)