Query gi|254780471|ref|YP_003064884.1| cytochrome o ubiquinol oxidase subunit IV [Candidatus Liberibacter asiaticus str. psy62] Match_columns 119 No_of_seqs 101 out of 264 Neff 4.7 Searched_HMMs 39220 Date Sun May 29 18:44:20 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780471.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PRK10582 cytochrome o ubiquino 100.0 0 0 277.8 13.3 108 1-111 1-108 (109) 2 TIGR02847 CyoD cytochrome o ub 100.0 0 0 272.8 12.1 96 14-110 1-99 (99) 3 COG3125 CyoD Heme/copper-type 100.0 8.7E-43 0 255.4 13.2 111 1-112 1-111 (111) 4 pfam03626 COX4_pro Prokaryotic 100.0 1.6E-31 4.1E-36 193.1 7.7 83 20-103 1-83 (83) 5 TIGR02901 QoxD cytochrome aa3 99.9 1.5E-23 3.8E-28 149.1 11.9 92 13-105 2-94 (95) 6 TIGR02908 CoxD_Bacillus cytoch 99.8 5.9E-20 1.5E-24 129.2 10.3 80 15-97 23-102 (110) 7 TIGR02229 caa3_sub_IV caa(3)-t 91.4 0.92 2.4E-05 23.2 9.3 79 14-93 3-86 (96) 8 pfam03862 SpoVA SpoVA protein. 77.3 4.5 0.00011 19.3 4.3 38 54-91 12-49 (119) 9 PRK09174 F0F1 ATP synthase sub 76.0 4 0.0001 19.6 3.8 45 3-47 28-78 (204) 10 pfam12297 EVC2_like Ellis van 70.0 5.6 0.00014 18.8 3.3 26 13-38 62-88 (429) 11 TIGR01107 Na_K_ATPase_bet Na+/ 65.3 9.2 0.00023 17.6 3.7 28 75-103 33-63 (317) 12 PRK13275 mtrF tetrahydromethan 64.3 8.2 0.00021 17.9 3.3 26 13-38 38-63 (65) 13 KOG4740 consensus 61.6 6.5 0.00017 18.5 2.4 49 52-107 454-511 (564) 14 COG5605 Predicted small integr 54.5 15 0.00038 16.5 10.2 86 1-94 1-88 (115) 15 pfam03189 Otopetrin Protein of 53.8 15 0.00039 16.4 9.1 78 22-107 294-380 (414) 16 KOG4788 consensus 53.4 16 0.0004 16.4 9.3 84 25-109 43-131 (172) 17 pfam09472 MtrF Tetrahydrometha 52.4 15 0.00038 16.5 2.9 27 12-38 37-63 (64) 18 pfam05297 Herpes_LMP1 Herpesvi 42.6 23 0.0006 15.4 10.7 66 1-69 1-71 (382) 19 PRK03557 zinc transporter ZitB 41.7 24 0.00062 15.3 13.3 36 1-36 1-37 (312) 20 pfam05799 COX5C Cytochrome c o 34.8 22 0.00056 15.5 1.5 30 78-108 12-41 (62) 21 COG4325 Predicted membrane pro 32.5 34 0.00088 14.5 10.7 81 20-106 92-185 (464) 22 PRK13454 F0F1 ATP synthase sub 31.7 20 0.00051 15.8 0.9 28 19-46 28-55 (181) 23 TIGR02978 phageshock_pspC phag 31.6 36 0.00091 14.4 2.9 19 22-40 33-51 (128) 24 PRK07668 hypothetical protein; 29.7 39 0.00098 14.2 8.5 81 19-102 111-194 (248) 25 pfam09726 Macoilin Transmembra 28.2 41 0.001 14.0 2.4 42 23-67 72-113 (680) 26 pfam11982 DUF3483 Domain of un 27.5 42 0.0011 14.0 8.0 60 22-82 72-131 (224) 27 pfam06667 PspB Phage shock pro 26.2 45 0.0011 13.8 3.6 22 83-104 4-25 (75) 28 pfam11286 DUF3087 Protein of u 25.0 47 0.0012 13.7 5.6 39 52-94 27-66 (165) 29 TIGR01476 chlor_syn_BchG bacte 24.7 48 0.0012 13.7 4.8 48 46-93 242-289 (295) 30 COG4218 MtrF Tetrahydromethano 23.2 51 0.0013 13.5 3.1 22 16-37 50-71 (73) 31 TIGR02210 rodA_shape rod shape 20.2 59 0.0015 13.2 6.3 33 21-53 129-161 (416) No 1 >PRK10582 cytochrome o ubiquinol oxidase subunit IV; Provisional Probab=100.00 E-value=0 Score=277.76 Aligned_cols=108 Identities=46% Similarity=0.814 Sum_probs=101.7 Q ss_pred CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHH Q ss_conf 98788889877788852568999999999999999999806578846999999999999999999999704778765025 Q gi|254780471|r 1 MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80 (119) Q Consensus 1 m~~~~~h~~~~~~hgs~k~yliGFiLsiiLT~iaF~lV~~~~~~~~~~~~~~I~~~Av~Qi~VqL~~FLHl~~~~~~~~n 80 (119) |+||+ ++++++|||.|||++||+||++||++|||+||++.+ |++.++.+|.+||++|++|||+||||||+++||||| T Consensus 1 ~sh~~--~~~~~~Hgs~ksY~iGFvLsviLT~ipF~lVm~~~~-~~~~~~~~i~~~AvvQi~VhLvyFLHl~~~~~~~wn 77 (109) T PRK10582 1 MSHST--DHGGASHGSVKTYMTGFILSIILTVIPFWMVMTGAA-SPAVILGTILAMAVVQILVHLVCFLHMNTKSDEGWN 77 (109) T ss_pred CCCCC--CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCC-CCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHH T ss_conf 98877--889988875999999999999999999999980767-821599999999999999999996105788765424 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC Q ss_conf 9999999999999999999999851130489 Q gi|254780471|r 81 IMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111 (119) Q Consensus 81 ~~a~~Ft~~ii~iiv~GSiWIM~~l~~nMMp 111 (119) +++++||+++++|+++||+|||+|||+|||- T Consensus 78 ~~a~~Ft~~ii~I~v~GSiWIM~~ln~nMM~ 108 (109) T PRK10582 78 MTAFVFTVLIIAILVVGSIWIMWNLNYNMMM 108 (109) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHCCHHHHCC T ss_conf 8999999999999998699999620865117 No 2 >TIGR02847 CyoD cytochrome o ubiquinol oxidase subunit IV; InterPro: IPR014210 This entry represents subunit 4 (CyoD) of cytochrome o terminal oxidase complex, which is a component of the aerobic respiratory chain that reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilise cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant.. Probab=100.00 E-value=0 Score=272.77 Aligned_cols=96 Identities=48% Similarity=0.948 Sum_probs=93.8 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHHHCCC-CCC-HHHHHHHHHHHHHHHHHHHHHHHHHCCC-CCCCHHHHHHHHHHHHH Q ss_conf 88525689999999999999999998065-788-4699999999999999999999970477-87650259999999999 Q gi|254780471|r 14 YGTKKQCLVGFILSLILTIIPFGIVMKGF-FLD-KNIMCLTIVLCAIAQIIVHLVFFLHMST-KVEDGWSIMAMIFTIIM 90 (119) Q Consensus 14 hgs~k~yliGFiLsiiLT~iaF~lV~~~~-~~~-~~~~~~~I~~~Av~Qi~VqL~~FLHl~~-~~~~~~n~~a~~Ft~~i 90 (119) |||.|||++||+||++||++||++||+|. + | ++.++.+|..||++|++|||+||||||+ ++|||||+.+++||+++ T Consensus 1 ~g~~ksYliGFvlsv~LT~~pF~~Vm~~~~~-sW~~~~~~~i~~~A~~Qi~VhlvfFLHl~~~~~~~rwNl~~l~Ft~li 79 (99) T TIGR02847 1 HGSLKSYLIGFVLSVILTVIPFGLVMSGTVL-SWKGLTLVIIIVLAVVQILVHLVFFLHLNTKSSEQRWNLISLLFTILI 79 (99) T ss_pred CCCCCHHHHHHHHHHHHHHHHHHHHHHCCCC-CHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHH T ss_conf 9988617999999999999888999807547-628899999999999999988877302889895146899999999999 Q ss_pred HHHHHHHHHHHHHHHHHCCC Q ss_conf 99999999999985113048 Q gi|254780471|r 91 VAICFVGSMWVMYHLNNNMM 110 (119) Q Consensus 91 i~iiv~GSiWIM~~l~~nMM 110 (119) ++|+|+||+|||+|+|+||| T Consensus 80 i~i~v~GS~WIM~~ln~NMM 99 (99) T TIGR02847 80 IFIVVGGSIWIMHNLNHNMM 99 (99) T ss_pred HHHHHHHHHHHHHHHCCCCC T ss_conf 99999999999985102369 No 3 >COG3125 CyoD Heme/copper-type cytochrome/quinol oxidase, subunit 4 [Energy production and conversion] Probab=100.00 E-value=8.7e-43 Score=255.37 Aligned_cols=111 Identities=47% Similarity=0.780 Sum_probs=103.2 Q ss_pred CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHH Q ss_conf 98788889877788852568999999999999999999806578846999999999999999999999704778765025 Q gi|254780471|r 1 MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80 (119) Q Consensus 1 m~~~~~h~~~~~~hgs~k~yliGFiLsiiLT~iaF~lV~~~~~~~~~~~~~~I~~~Av~Qi~VqL~~FLHl~~~~~~~~n 80 (119) |++.+..++++.+|||+|+|++||+||++||++|||+|+++.+ |++.++++|++||++|++|||+||||||+|+|+||| T Consensus 1 Mss~~~~~~~~a~H~s~k~y~iGFvLsIiLT~ipF~~vm~~~~-~~~~~~~~i~~lA~iQi~vqLvyFlHM~~~~eg~w~ 79 (111) T COG3125 1 MSSALHTNHGGASHGSLKSYLIGFVLSIILTLIPFWVVMTGAL-SSTVTLIIILGLAVIQILVHLVYFLHMNTKSEGRWN 79 (111) T ss_pred CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCC-CHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEE T ss_conf 9976668876454335899999999999999999999983464-434699999999999999999987304688666641 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH Q ss_conf 99999999999999999999998511304895 Q gi|254780471|r 81 IMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112 (119) Q Consensus 81 ~~a~~Ft~~ii~iiv~GSiWIM~~l~~nMMp~ 112 (119) +.+++|++++++|+++||+|||+|+|.||||+ T Consensus 80 ~~~~iFt~~i~vivvvGS~Wvm~~~n~~mm~~ 111 (111) T COG3125 80 MGALIFTIFIIVIVVVGSIWVMHNLNHNMMPL 111 (111) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC T ss_conf 19999999999999999999998163035899 No 4 >pfam03626 COX4_pro Prokaryotic Cytochrome C oxidase subunit IV. Cytochrome c oxidase (COX) is a multi-subunit enzyme complex that catalyses the final step of electron transfer through the respiratory chain on the mitochondrial inner membrane. This family is composed of cytochrome c oxidase subunit 4 from prokaryotes. Probab=99.97 E-value=1.6e-31 Score=193.14 Aligned_cols=83 Identities=47% Similarity=0.912 Sum_probs=80.0 Q ss_pred HHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 89999999999999999998065788469999999999999999999997047787650259999999999999999999 Q gi|254780471|r 20 CLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSM 99 (119) Q Consensus 20 yliGFiLsiiLT~iaF~lV~~~~~~~~~~~~~~I~~~Av~Qi~VqL~~FLHl~~~~~~~~n~~a~~Ft~~ii~iiv~GSi 99 (119) |++||++|++||++||++|+++.+ |++.++++|.+||++|++|||+||||||+|+|+|||+.+++|++++++++++||+ T Consensus 1 y~iGFilsiiLT~i~F~~V~~~~~-~~~~~~~~i~~~A~vQi~vqL~~FLHm~~~~~~~wn~~~~~f~~~i~~i~v~Gsl 79 (83) T pfam03626 1 YLIGFVLSVILTLIPFWLVMAGVL-SKSTTLAIILVLAVVQIVVQLVYFLHMNTSSEGRWNLLALIFTILIAVIVVAGSL 79 (83) T ss_pred CCHHHHHHHHHHHHHHHHHHHCCC-CHHHHHHHHHHHHHHHHHHHHHHHEECCCCCCCCHHHHHHHHHHHHHHHHHHHEE T ss_conf 944999999999999999996658-8508999999999999999999851247887763179999999999999877222 Q ss_pred HHHH Q ss_conf 9998 Q gi|254780471|r 100 WVMY 103 (119) Q Consensus 100 WIM~ 103 (119) |||+ T Consensus 80 WIm~ 83 (83) T pfam03626 80 WIMH 83 (83) T ss_pred EEEC T ss_conf 5659 No 5 >TIGR02901 QoxD cytochrome aa3 quinol oxidase, subunit IV; InterPro: IPR014250 This entry represents subunit IV of the aa3-type quinone oxidase (QoxD), one of several bacterial terminal oxidases . This complex couples oxidation of reduced quinones to the reduction of molecular oxygen to water, and the pumping of protons to form a proton gradient utilised for ATP production. aa3-type oxidases contain two heme a cofactors as well as copper atoms in the active site.; GO: 0016682 oxidoreductase activity acting on diphenols and related substances as donors oxygen as acceptor, 0042773 ATP synthesis coupled electron transport, 0016021 integral to membrane. Probab=99.91 E-value=1.5e-23 Score=149.07 Aligned_cols=92 Identities=25% Similarity=0.423 Sum_probs=83.7 Q ss_pred CCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHH-HHHHHHHHH Q ss_conf 8885256899999999999999999980657884699999999999999999999970477876502599-999999999 Q gi|254780471|r 13 SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIM-AMIFTIIMV 91 (119) Q Consensus 13 ~hgs~k~yliGFiLsiiLT~iaF~lV~~~~~~~~~~~~~~I~~~Av~Qi~VqL~~FLHl~~~~~~~~n~~-a~~Ft~~ii 91 (119) ..|-+.||+.||++|++||++|.|.+.+..+| ......+|.+||++|+.+||+.|||+||++|+|.++. +..|+.++. T Consensus 2 ~~~FP~kHv~GFilSL~LT~~AL~Va~~s~l~-~~~~~tIi~~~A~IQA~LQL~~FMH~~E~~~gk~q~~~n~~Y~~FiA 80 (95) T TIGR02901 2 RELFPWKHVVGFILSLILTLLALWVALYSDLS-LKVGLTIIIVFAIIQASLQLIVFMHVNESEDGKVQIYLNIVYAFFIA 80 (95) T ss_pred CCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCC-HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHH T ss_conf 88871899999999999999999999996594-35656888889999999999988046757574057899999999999 Q ss_pred HHHHHHHHHHHHHH Q ss_conf 99999999999851 Q gi|254780471|r 92 AICFVGSMWVMYHL 105 (119) Q Consensus 92 ~iiv~GSiWIM~~l 105 (119) ..+|.||+|+|.-. T Consensus 81 ~vtV~Gs~w~m~~g 94 (95) T TIGR02901 81 LVTVFGSLWVMVWG 94 (95) T ss_pred HHHHHHHHHHHHHC T ss_conf 99999999998863 No 6 >TIGR02908 CoxD_Bacillus cytochrome c oxidase, subunit IV; InterPro: IPR014257 This entry represents a small clade of cytochrome oxidase subunit IV sequences found in the Bacillaceae.. Probab=99.82 E-value=5.9e-20 Score=129.21 Aligned_cols=80 Identities=30% Similarity=0.388 Sum_probs=70.0 Q ss_pred CCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHH Q ss_conf 85256899999999999999999980657884699999999999999999999970477876502599999999999999 Q gi|254780471|r 15 GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAIC 94 (119) Q Consensus 15 gs~k~yliGFiLsiiLT~iaF~lV~~~~~~~~~~~~~~I~~~Av~Qi~VqL~~FLHl~~~~~~~~n~~a~~Ft~~ii~ii 94 (119) .-+|++++.|+|++.||+|||..|+++.. ++..++|.|+++|++|+..||||||||++|+++-+..+ +|+++.+..+ T Consensus 23 eEMk~Q~~~F~LMI~lTliAF~aV~~~e~-~~wFviPfillLAavQvaFQlyYFMHM~~KGHE~Pa~f--iYgGvfV~~l 99 (110) T TIGR02908 23 EEMKKQVVAFALMILLTLIAFLAVALDEV-DKWFVIPFILLLAAVQVAFQLYYFMHMKDKGHEVPALF--IYGGVFVALL 99 (110) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHH--HHHHHHHHHH T ss_conf 99899999999999999999999877324-54106989999999999999888872068997500799--9999999999 Q ss_pred HHH Q ss_conf 999 Q gi|254780471|r 95 FVG 97 (119) Q Consensus 95 v~G 97 (119) ++- T Consensus 100 ~vl 102 (110) T TIGR02908 100 VVL 102 (110) T ss_pred HHH T ss_conf 998 No 7 >TIGR02229 caa3_sub_IV caa(3)-type oxidase, subunit IV; InterPro: IPR011743 This entry represents a small set of proteins with weak similarity to the sequences in Pfam family IPR005171 from INTERPRO, which describes the cytochrome C oxidase subunit IV .. Probab=91.43 E-value=0.92 Score=23.15 Aligned_cols=79 Identities=13% Similarity=0.205 Sum_probs=43.4 Q ss_pred CCC-HHHHHHHHHHHH---HHHHHHHHHHHCC-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHH Q ss_conf 885-256899999999---9999999999806-57884699999999999999999999970477876502599999999 Q gi|254780471|r 14 YGT-KKQCLVGFILSL---ILTIIPFGIVMKG-FFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTI 88 (119) Q Consensus 14 hgs-~k~yliGFiLsi---iLT~iaF~lV~~~-~~~~~~~~~~~I~~~Av~Qi~VqL~~FLHl~~~~~~~~n~~a~~Ft~ 88 (119) |-| .++|..=+.-=+ ++|+++-+.-..= -.|+ ....++=+.-|+.....=-.||||++.+++=.-=..+.-|.. T Consensus 3 Hi~~~~~~~~v~~~L~vL~~lTv~A~~~~~~LihiPG-~La~~val~IA~~KA~Lv~lyFMHl~~~~~l~rl~~a~af~~ 81 (96) T TIGR02229 3 HISDLATYLKVWLALLVLTALTVAASFFELELIHIPG-ALAVVVALAIAVVKAVLVVLYFMHLKRESKLLRLVVAVAFAI 81 (96) T ss_pred CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-HHHHHHHHHHHHHHHHHHHHHHEECCHHHHHHHHHHHHHHHH T ss_conf 8777347999999999999999999998433302587-689999999999999884453100110035899999999999 Q ss_pred HHHHH Q ss_conf 99999 Q gi|254780471|r 89 IMVAI 93 (119) Q Consensus 89 ~ii~i 93 (119) +.+.+ T Consensus 82 Lailf 86 (96) T TIGR02229 82 LAILF 86 (96) T ss_pred HHHHH T ss_conf 99999 No 8 >pfam03862 SpoVA SpoVA protein. Members of this family are all transcribed from the spoVA operon. These proteins are poorly characterized, but are thought to be involved in dipicolinic acid transport into the developing forespore during sporulation. Probab=77.28 E-value=4.5 Score=19.35 Aligned_cols=38 Identities=18% Similarity=0.582 Sum_probs=29.5 Q ss_pred HHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHH Q ss_conf 99999999999999970477876502599999999999 Q gi|254780471|r 54 VLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMV 91 (119) Q Consensus 54 ~~~Av~Qi~VqL~~FLHl~~~~~~~~n~~a~~Ft~~ii 91 (119) ++|++-|++.+++-..+++++..+.|-+..+++...++ T Consensus 12 ~IC~igQ~l~d~~~~~~~~~~~a~~~~~v~lV~~gaiL 49 (119) T pfam03862 12 LICVIGQILMDFTIYFGLSEKLTPARTLVTLVFLGALL 49 (119) T ss_pred HHHHHHHHHHHHHHHCCCCHHHCHHHHHHHHHHHHHHH T ss_conf 99999999999998729876553136889999999998 No 9 >PRK09174 F0F1 ATP synthase subunit B'; Validated Probab=76.02 E-value=4 Score=19.63 Aligned_cols=45 Identities=13% Similarity=0.060 Sum_probs=30.0 Q ss_pred CCCCCCCCCCCC--CCHH----HHHHHHHHHHHHHHHHHHHHHCCCCCCHH Q ss_conf 788889877788--8525----68999999999999999999806578846 Q gi|254780471|r 3 YDNIHNMNMHSY--GTKK----QCLVGFILSLILTIIPFGIVMKGFFLDKN 47 (119) Q Consensus 3 ~~~~h~~~~~~h--gs~k----~yliGFiLsiiLT~iaF~lV~~~~~~~~~ 47 (119) |++++-.++..| |.+. ++.-+=++=+++|+..|+++++..+.|+- T Consensus 28 h~~~~~~~~~~~~~gg~Pqld~~t~~sQifWL~I~F~~lY~~~sk~~lPrI 78 (204) T PRK09174 28 HTETGVAHEAEHGSGVFPPFDSTHYASQLLWLAITFGLFYLFLSRVILPRI 78 (204) T ss_pred CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 567788765556789999998345089999999999999999999976037 No 10 >pfam12297 EVC2_like Ellis van Creveld protein 2 like protein. This family of proteins is found in eukaryotes. Proteins in this family are typically between 571 and 1310 amino acids in length. There are two conserved sequence motifs: LPA and ELH. EVC2 is implicated in Ellis van Creveld chondrodysplastic dwarfism in humans. Mutations in this protein can give rise to this congenital condition. LIMBIN is a protein which shares around 80% sequence homology with EVC2 and it is implicated in a similar condition in bovine chondrodysplastic dwarfism. Probab=70.00 E-value=5.6 Score=18.84 Aligned_cols=26 Identities=27% Similarity=0.598 Sum_probs=19.9 Q ss_pred CCC-CHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 888-52568999999999999999999 Q gi|254780471|r 13 SYG-TKKQCLVGFILSLILTIIPFGIV 38 (119) Q Consensus 13 ~hg-s~k~yliGFiLsiiLT~iaF~lV 38 (119) .|| ..-..+++|..|++||.+.|++. T Consensus 62 nhg~h~agf~vaf~vsiVlt~~~~f~l 88 (429) T pfam12297 62 NHGLHAAGFVVAFLVSIVLTLLAFFLL 88 (429) T ss_pred CCCHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 520688899999999999999999999 No 11 >TIGR01107 Na_K_ATPase_bet Na+/K+ ATPase, beta subunit; InterPro: IPR000402 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (F-, V- and A-ATPases contain rotary motors) and in the type of ions they transport , . F-ATPases (F1F0-ATPases) in mitochondria, chloroplasts and bacterial plasma membranes are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases) are primarily found in eukaryotic vacuoles, catalysing ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases) are found in Archaea and function like F-ATPases. P-ATPases (E1E2-ATPases) are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP. P-ATPases (sometime known as E1-E2 ATPases) (3.6.3.- from EC) are found in bacteria and in a number of eukaryotic plasma membranes and organelles . P-ATPases function to transport a variety of different compounds, including ions and phospholipids, across a membrane using ATP hydrolysis for energy. There are many different classes of P-ATPases, each of which transports a specific type of ion: H^+, Na^+, K^+, Mg^2+, Ca^2+, Ag^+ and Ag^2+, Zn^2+, Co^2+, Pb^2+, Ni^2+, Cd^2+, Cu^+ and Cu^2+. P-ATPases can be composed of one or two polypeptides, and can usually assume two main conformations called E1 and E2. This entry represents the beta subunit found in the P-type cation exchange ATPases located in the plasma membranes of animal cells. These P-ATPases include both H^+/K^+-ATPases (3.6.3.10 from EC) and Na^+/K^+-ATPases (3.6.3.9 from EC), which belong to the IIC subfamily of ATPases , . These ATPases catalyse the hydrolysis of ATP coupled with the exchange of cations, pumping one cation out of the cell (H^+ or Na^+) in exchange for K^+. These ATPases contain an alpha subunit (IPR005775 from INTERPRO) that is the catalytic component, and a glycosylated beta subunit that regulates the number of sodium pumps transported to the plasma membrane through the assembly of alpha/beta heterodimers. The beta subunit has three highly conserved disulphide bonds within the extracellular domain that stabilize the alpha subunit, the alpha/beta interaction, and the catalytic activity of the alpha subunit . Different beta isoforms exist, permitting greater regulatory control. An example of a H^+/K^+-ATPase is the gastric pump responsible for acid secretion in the stomach, transporting protons from the cytoplasm of parietal cells to create a large pH gradient in exchange for the internalization of potassium ions, using ATP hydrolysis to drive the pump . More information about this protein can be found at Protein of the Month: ATP Synthases . ; GO: 0005391 sodium:potassium-exchanging ATPase activity, 0006813 potassium ion transport, 0006814 sodium ion transport, 0016020 membrane. Probab=65.33 E-value=9.2 Score=17.63 Aligned_cols=28 Identities=21% Similarity=0.516 Sum_probs=17.2 Q ss_pred CCCHHHHHHH---HHHHHHHHHHHHHHHHHHH Q ss_conf 7650259999---9999999999999999998 Q gi|254780471|r 75 VEDGWSIMAM---IFTIIMVAICFVGSMWVMY 103 (119) Q Consensus 75 ~~~~~n~~a~---~Ft~~ii~iiv~GSiWIM~ 103 (119) +..+|-.+.+ +|=++++. +..||+|||- T Consensus 33 Tg~SW~~ILLFYl~FYG~LAg-lF~~Ti~VmL 63 (317) T TIGR01107 33 TGGSWFKILLFYLVFYGCLAG-LFIGTIQVML 63 (317) T ss_pred CHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHH T ss_conf 123355578888999999999-9999999986 No 12 >PRK13275 mtrF tetrahydromethanopterin S-methyltransferase subunit F; Provisional Probab=64.30 E-value=8.2 Score=17.92 Aligned_cols=26 Identities=19% Similarity=0.402 Sum_probs=21.6 Q ss_pred CCCCHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 88852568999999999999999999 Q gi|254780471|r 13 SYGTKKQCLVGFILSLILTIIPFGIV 38 (119) Q Consensus 13 ~hgs~k~yliGFiLsiiLT~iaF~lV 38 (119) ..-+.+...+||+++++|-.+|.++. T Consensus 38 ~~~~~~Gfa~G~~~Av~lv~ip~ll~ 63 (65) T PRK13275 38 IATGIIGFAIGFLLAVLLVVVPPLLI 63 (65) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHC T ss_conf 64307999999999999999999981 No 13 >KOG4740 consensus Probab=61.56 E-value=6.5 Score=18.46 Aligned_cols=49 Identities=18% Similarity=0.348 Sum_probs=20.4 Q ss_pred HHHHHHHHHHHHHHHHHH---------HCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999997---------04778765025999999999999999999999985113 Q gi|254780471|r 52 TIVLCAIAQIIVHLVFFL---------HMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNN 107 (119) Q Consensus 52 ~I~~~Av~Qi~VqL~~FL---------Hl~~~~~~~~n~~a~~Ft~~ii~iiv~GSiWIM~~l~~ 107 (119) +-..+.++|+.+|.-|-| --+.+.+++-|+.+|++..= -++|+++-... T Consensus 454 ~~~~~RiiqV~~Qs~fil~aSRlr~~~~~~~r~kPGKqiiTFLlv~N-------ialF~~~tFE~ 511 (564) T KOG4740 454 TNFVMRIIQVIVQSMFILDASRLRRLSQENARKKPGKQIITFLLVCN-------IALFIYHTFEG 511 (564) T ss_pred EEHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHH-------HHHHHHHHCCC T ss_conf 20468999999999988749876550643311373378999999999-------99988876056 No 14 >COG5605 Predicted small integral membrane protein [Function unknown] Probab=54.55 E-value=15 Score=16.46 Aligned_cols=86 Identities=20% Similarity=0.349 Sum_probs=49.2 Q ss_pred CCCCC-CCCCCCC-CCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCH Q ss_conf 98788-8898777-888525689999999999999999998065788469999999999999999999997047787650 Q gi|254780471|r 1 MKYDN-IHNMNMH-SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDG 78 (119) Q Consensus 1 m~~~~-~h~~~~~-~hgs~k~yliGFiLsiiLT~iaF~lV~~~~~~~~~~~~~~I~~~Av~Qi~VqL~~FLHl~~~~~~~ 78 (119) |+|.. .|..+++ .....|-|+.-..+-.+|...++..-..+ ..+ -.....|+++-+.....-.-.|||| . T Consensus 1 ~~h~~~~~a~~a~hqqhpiklyl~vwgllfvlstlsylvdyfg-lqg-ylrwslilifmilkaglivavfmhm------a 72 (115) T COG5605 1 MEHTDPSHAPGAHHQQHPIKLYLKVWGLLFVLSTLSYLVDYFG-LQG-YLRWSLILIFMILKAGLIVAVFMHM------A 72 (115) T ss_pred CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-HHH-HHHHHHHHHHHHHHCCHHHHHHHHH------H T ss_conf 9999867799732344663549999999999999999999981-566-9999999999999714899999999------9 Q ss_pred HHHHHHHHHHHHHHHH Q ss_conf 2599999999999999 Q gi|254780471|r 79 WSIMAMIFTIIMVAIC 94 (119) Q Consensus 79 ~n~~a~~Ft~~ii~ii 94 (119) |.-+++.+++++--+. T Consensus 73 werlal~yaiilppll 88 (115) T COG5605 73 WERLALVYAIILPPLL 88 (115) T ss_pred HHHHHHHHHHHHHHHH T ss_conf 9999999999850799 No 15 >pfam03189 Otopetrin Protein of unknown function, DUF270. Probab=53.77 E-value=15 Score=16.39 Aligned_cols=78 Identities=12% Similarity=0.163 Sum_probs=34.8 Q ss_pred HHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCC---------CCCCCHHHHHHHHHHHHHHH Q ss_conf 999999999999999998065788469999999999999999999997047---------78765025999999999999 Q gi|254780471|r 22 VGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS---------TKVEDGWSIMAMIFTIIMVA 92 (119) Q Consensus 22 iGFiLsiiLT~iaF~lV~~~~~~~~~~~~~~I~~~Av~Qi~VqL~~FLHl~---------~~~~~~~n~~a~~Ft~~ii~ 92 (119) .|..+--.++++|...-... -.|.+....+-.++.++|..+|-.+=+.-- .+++++-++.+|+. T Consensus 294 ~G~~lys~fsIva~~~~~~~-~~~~~~l~l~~~ll~iiQ~~~Q~~fIi~a~rrr~~~~~~~~~kpgRqiitFLl------ 366 (414) T pfam03189 294 TGEYIYCMFGIDGGIFGKLE-SDPVSVLVLIAFVFRLIQVSIQTLFILDASRRRCLGSEQNRTKPGKQIITFLL------ 366 (414) T ss_pred HHHHHHHHHHHHHHHHCCCC-CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHCCCCCCHHHHHHHH------ T ss_conf 99999999999998652676-78744299999999999999999999999964778832246785078999999------ Q ss_pred HHHHHHHHHHHHHHH Q ss_conf 999999999985113 Q gi|254780471|r 93 ICFVGSMWVMYHLNN 107 (119) Q Consensus 93 iiv~GSiWIM~~l~~ 107 (119) +.=-++|+|+.... T Consensus 367 -vcNiaLW~~~tFe~ 380 (414) T pfam03189 367 -VCNMALFFIHTFEK 380 (414) T ss_pred -HHHHHHHHHHHHCC T ss_conf -99999998764146 No 16 >KOG4788 consensus Probab=53.39 E-value=16 Score=16.36 Aligned_cols=84 Identities=14% Similarity=0.330 Sum_probs=48.1 Q ss_pred HHHHHHHHHHHHHHHCCCCCC--HHHHHHHHHHHHH-HHHHHH--HHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999999998065788--4699999999999-999999--99997047787650259999999999999999999 Q gi|254780471|r 25 ILSLILTIIPFGIVMKGFFLD--KNIMCLTIVLCAI-AQIIVH--LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSM 99 (119) Q Consensus 25 iLsiiLT~iaF~lV~~~~~~~--~~~~~~~I~~~Av-~Qi~Vq--L~~FLHl~~~~~~~~n~~a~~Ft~~ii~iiv~GSi 99 (119) ++.++|.+++|..+....-.. ..... .+..+++ ++...= ...++|..-...-+|....-++...+......... T Consensus 43 i~e~~l~li~fi~i~~~~~~~~~~~~~~-~vsv~~~i~tl~fl~~~~~~~~~~~~~~i~wp~~~~l~~~~v~~~~~~i~~ 121 (172) T KOG4788 43 ILEIVLGLIIFICIASSLAYHLALAFFE-FVSVFAFLLTLAFLILYLTLLHETIVLPIRWPFLLDLLNLVVALLLFAIAS 121 (172) T ss_pred HHHHHHHHHHHHEEECCCCCCCCHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999897501314410145127899-999999999999999999998860033777599999999999999999999 Q ss_pred HHHHHHHHCC Q ss_conf 9998511304 Q gi|254780471|r 100 WVMYHLNNNM 109 (119) Q Consensus 100 WIM~~l~~nM 109 (119) |++...+.+. T Consensus 122 ~~~~~~~~~~ 131 (172) T KOG4788 122 WVLAQFSATT 131 (172) T ss_pred HHHHHHHHCC T ss_conf 9999862300 No 17 >pfam09472 MtrF Tetrahydromethanopterin S-methyltransferase, F subunit (MtrF). Many archaea have evolved energy-yielding pathways marked by one-carbon biochemistry featuring novel cofactors and enzymes. This domain is mostly found in MtrF, where it covers the entire length of the protein. This polypeptide is one of eight subunits of the N5-methyltetrahydromethanopterin: coenzyme M methyltransferase complex found in methanogenic archaea. This is a membrane-associated enzyme complex that uses methyl-transfer reactions to drive a sodium-ion pump. MtrF itself is involved in the transfer of the methyl group from N5-methyltetrahydromethanopterin to coenzyme M. Subsequently, methane is produced by two-electron reduction of the methyl moiety in methyl-coenzyme M by another enzyme, methyl-coenzyme M reductase. In some organisms this domain is found at the C terminal region of what appears to be a fusion of the MtrA and MtrF proteins. The function of these proteins is unknown, though it is likely Probab=52.43 E-value=15 Score=16.50 Aligned_cols=27 Identities=19% Similarity=0.392 Sum_probs=21.5 Q ss_pred CCCCCHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 788852568999999999999999999 Q gi|254780471|r 12 HSYGTKKQCLVGFILSLILTIIPFGIV 38 (119) Q Consensus 12 ~~hgs~k~yliGFiLsiiLT~iaF~lV 38 (119) -..-+.+...+||+++++|-.+|..+. T Consensus 37 v~~~~~~G~~~G~~~Alvlv~ip~~l~ 63 (64) T pfam09472 37 VIATGILGFAIGFVFAVLLVLIPILLL 63 (64) T ss_pred HHHCCHHHHHHHHHHHHHHHHHHHHHH T ss_conf 520004999999999999999999982 No 18 >pfam05297 Herpes_LMP1 Herpesvirus latent membrane protein 1 (LMP1). This family consists of several latent membrane protein 1 or LMP1s mostly from Epstein-Barr virus. LMP1 of EBV is a 62-65 kDa plasma membrane protein possessing six membrane spanning regions, a short cytoplasmic N-terminus and a long cytoplasmic carboxy tail of 200 amino acids. EBV latent membrane protein 1 (LMP1) is essential for EBV-mediated transformation and has been associated with several cases of malignancies. EBV-like viruses in Cynomolgus monkeys (Macaca fascicularis) have been associated with high lymphoma rates in immunosuppressed monkeys. Probab=42.62 E-value=23 Score=15.39 Aligned_cols=66 Identities=26% Similarity=0.316 Sum_probs=39.5 Q ss_pred CCCCCCCCCCC---CCCCCHHHHHHHHHHHHHHHHHHHH--HHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 98788889877---7888525689999999999999999--998065788469999999999999999999997 Q gi|254780471|r 1 MKYDNIHNMNM---HSYGTKKQCLVGFILSLILTIIPFG--IVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFL 69 (119) Q Consensus 1 m~~~~~h~~~~---~~hgs~k~yliGFiLsiiLT~iaF~--lV~~~~~~~~~~~~~~I~~~Av~Qi~VqL~~FL 69 (119) ||||-..+.-+ ..-|..-|--+|..+-+.|-++-|| +||++.-. +. ..++..+|++-|++-++-|+ T Consensus 1 me~dlergppgpprpplgpplsssiglallllllAlLfW~~IiMSd~T~--~A-~~VL~SFAvvLIIIIiII~i 71 (382) T pfam05297 1 MEHDLERGPPGPPRPPLGPPLSSSIGLALLLLLLALLFWLYIVMSDWTG--GA-LLVLYSFALILIIIILIIFI 71 (382) T ss_pred CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCC--CH-HHHHHHHHHHHHHHHHHHHH T ss_conf 9764345989889899998750047899999999999999999730244--16-99999999999999999999 No 19 >PRK03557 zinc transporter ZitB; Provisional Probab=41.71 E-value=24 Score=15.31 Aligned_cols=36 Identities=11% Similarity=0.114 Sum_probs=18.5 Q ss_pred CCCCCCCCCCCC-CCCCHHHHHHHHHHHHHHHHHHHH Q ss_conf 987888898777-888525689999999999999999 Q gi|254780471|r 1 MKYDNIHNMNMH-SYGTKKQCLVGFILSLILTIIPFG 36 (119) Q Consensus 1 m~~~~~h~~~~~-~hgs~k~yliGFiLsiiLT~iaF~ 36 (119) |+|++.|++... +-..-|+-.+.++++++++++-+. T Consensus 1 m~h~h~h~~~~~~~~~~~rrl~~a~~l~~~~~v~eii 37 (312) T PRK03557 1 MAHSHSHTSSHLPEDNNARRLLYAFGVTAGFMLVEVV 37 (312) T ss_pred CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH T ss_conf 9999899988887776632779999999999999999 No 20 >pfam05799 COX5C Cytochrome c oxidase subunit Vc (COX5C). This family consists of plant cytochrome c oxidase subunit 5c proteins. Probab=34.77 E-value=22 Score=15.55 Aligned_cols=30 Identities=27% Similarity=0.368 Sum_probs=17.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 0259999999999999999999999851130 Q gi|254780471|r 78 GWSIMAMIFTIIMVAICFVGSMWVMYHLNNN 108 (119) Q Consensus 78 ~~n~~a~~Ft~~ii~iiv~GSiWIM~~l~~n 108 (119) ++++.-=++-.+. +-+.+|++|-|+|.|.. T Consensus 12 GPsvvKEi~~G~~-lgl~aGglWKmhHWn~Q 41 (62) T pfam05799 12 GPSVVKEIVIGLT-LGLAAGGLWKMHHWNEQ 41 (62) T ss_pred CCHHHHHHHHHHH-HHHHHCHHHHHHHHHHH T ss_conf 8558999999999-99861415655555456 No 21 >COG4325 Predicted membrane protein [Function unknown] Probab=32.49 E-value=34 Score=14.47 Aligned_cols=81 Identities=16% Similarity=0.360 Sum_probs=44.3 Q ss_pred HHHHHHHHHHHHHHHHHHHHCCCCCCHHH----------HHHHHHHHHHHHHHHHHHHHHHCCCCCCC--H-HHHHHHHH Q ss_conf 89999999999999999998065788469----------99999999999999999999704778765--0-25999999 Q gi|254780471|r 20 CLVGFILSLILTIIPFGIVMKGFFLDKNI----------MCLTIVLCAIAQIIVHLVFFLHMSTKVED--G-WSIMAMIF 86 (119) Q Consensus 20 yliGFiLsiiLT~iaF~lV~~~~~~~~~~----------~~~~I~~~Av~Qi~VqL~~FLHl~~~~~~--~-~n~~a~~F 86 (119) -++||++|+ |+++|.++.++ +.|+.. +...+++|+++--+.-+.+- .+..++ + .--.+..- T Consensus 92 sVtg~~fSI--tvvalqlaSsq-fsPRll~~fmrd~~nqvvLa~FlctFvysl~vlrtv---g~e~d~~g~FIp~~avtv 165 (464) T COG4325 92 SVTGIVFSI--TVVALQLASSQ-FSPRLLRTFLRDVPNQVVLAIFLCTFVYSLGVLRTV---GEERDGQGAFIPKVAVTV 165 (464) T ss_pred HHHHHHHHH--HHHHHHHHHCC-CCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHH---HCCCCCCCCCEEHHHHHH T ss_conf 999999999--99999998646-887899888616720778999999999999999986---203476555111189999 Q ss_pred HHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999999999998511 Q gi|254780471|r 87 TIIMVAICFVGSMWVMYHLN 106 (119) Q Consensus 87 t~~ii~iiv~GSiWIM~~l~ 106 (119) +.+.++|.++--+.-.+++. T Consensus 166 ~lLlaiisig~~iyfl~~l~ 185 (464) T COG4325 166 SLLLAIISIGALIYFLHHLM 185 (464) T ss_pred HHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999999999987 No 22 >PRK13454 F0F1 ATP synthase subunit B'; Provisional Probab=31.72 E-value=20 Score=15.78 Aligned_cols=28 Identities=18% Similarity=0.305 Sum_probs=21.0 Q ss_pred HHHHHHHHHHHHHHHHHHHHHCCCCCCH Q ss_conf 6899999999999999999980657884 Q gi|254780471|r 19 QCLVGFILSLILTIIPFGIVMKGFFLDK 46 (119) Q Consensus 19 ~yliGFiLsiiLT~iaF~lV~~~~~~~~ 46 (119) ++..+=++=+++|++-++++++....|+ T Consensus 28 ~~f~sQiFWl~i~F~ily~vl~k~~lPr 55 (181) T PRK13454 28 DTFPNQIFWLLVTLVAIYFVLTRVALPR 55 (181) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 2407899999999999999999999988 No 23 >TIGR02978 phageshock_pspC phage shock protein C; InterPro: IPR014320 All members of this protein are the phage shock protein PspC. The phage shock regulon is restricted to the Proteobacteria and somewhat sparsely distributed there. It is expressed, under positive control of a sigma-54-dependent transcription factor; PspF, which binds and is modulated by PspA. Stresses that induce the psp regulon include phage secretin over expression, ethanol, heat shock and protein export defects.. Probab=31.62 E-value=36 Score=14.38 Aligned_cols=19 Identities=16% Similarity=0.053 Sum_probs=11.2 Q ss_pred HHHHHHHHHHHHHHHHHHC Q ss_conf 9999999999999999980 Q gi|254780471|r 22 VGFILSLILTIIPFGIVMK 40 (119) Q Consensus 22 iGFiLsiiLT~iaF~lV~~ 40 (119) |.++++.+||..+|.+++| T Consensus 33 il~v~~~lfg~~~~~~~AY 51 (128) T TIGR02978 33 ILVVSALLFGGGFFVLVAY 51 (128) T ss_pred HHHHHHHHHHHHHHHHHHH T ss_conf 9999999998799999999 No 24 >PRK07668 hypothetical protein; Validated Probab=29.70 E-value=39 Score=14.20 Aligned_cols=81 Identities=14% Similarity=0.162 Sum_probs=36.0 Q ss_pred HHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHH-HHHHHHHHHCCCCCCC--HHHHHHHHHHHHHHHHHH Q ss_conf 6899999999999999999980657884699999999999999-9999999704778765--025999999999999999 Q gi|254780471|r 19 QCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI-IVHLVFFLHMSTKVED--GWSIMAMIFTIIMVAICF 95 (119) Q Consensus 19 ~yliGFiLsiiLT~iaF~lV~~~~~~~~~~~~~~I~~~Av~Qi-~VqL~~FLHl~~~~~~--~~n~~a~~Ft~~ii~iiv 95 (119) +|.+-+++++..+...|-.+.-+ ++......+.++++++. ..=++.|+.---.+.= -.+..+.+-+.+++.+++ T Consensus 111 gypi~l~l~I~~~i~~~r~~~fk---sk~~~~~~i~~~~ii~~~liv~i~~l~~~Y~t~~~~lt~~qSyil~~ii~ii~i 187 (248) T PRK07668 111 GYPISLILTIIGLIFLLRMSSFK---SKTKEFGIIYVVAIIPMLLIVAIMFLNKWYGTPMLQFTQMQSYILAGLIFLVTV 187 (248) T ss_pred CHHHHHHHHHHHHHHHHHHHCCC---CCCEEHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCHHHHHHHHHHHHH T ss_conf 44699999999999986750003---565201899999999999999999997148996799747427999999999999 Q ss_pred HHHHHHH Q ss_conf 9999999 Q gi|254780471|r 96 VGSMWVM 102 (119) Q Consensus 96 ~GSiWIM 102 (119) +++.|.- T Consensus 188 i~~~~~~ 194 (248) T PRK07668 188 IINIYFL 194 (248) T ss_pred HHHHHHH T ss_conf 9999999 No 25 >pfam09726 Macoilin Transmembrane protein. This entry is a highly conserved protein present in eukaryotes. Probab=28.19 E-value=41 Score=14.04 Aligned_cols=42 Identities=14% Similarity=0.177 Sum_probs=20.5 Q ss_pred HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999999999980657884699999999999999999999 Q gi|254780471|r 23 GFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVF 67 (119) Q Consensus 23 GFiLsiiLT~iaF~lV~~~~~~~~~~~~~~I~~~Av~Qi~VqL~~ 67 (119) |+..|+++..|+|..=+--.+ .-.+=+ ++.+|-.=++||+++ T Consensus 72 GLafSVlFVCiA~TSDliCl~--FIPvhW-LfFaASTYVWVQyvw 113 (680) T pfam09726 72 GLAFSVFFVCIAITSDTICLL--FIPVQW-LFFAASTYVWVQYVW 113 (680) T ss_pred CCEEEEEHHHHHHHHCHHHHH--HHHHHH-HHHHHHHHHHHHEEE T ss_conf 200143102477641226644--467899-999875664321022 No 26 >pfam11982 DUF3483 Domain of unknown function (DUF3483). This presumed domain is functionally uncharacterized. This domain is found in bacteria. This domain is about 230 amino acids in length. This domain is found associated with pfam02754. Probab=27.48 E-value=42 Score=13.97 Aligned_cols=60 Identities=15% Similarity=0.269 Sum_probs=33.2 Q ss_pred HHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHH Q ss_conf 9999999999999999980657884699999999999999999999970477876502599 Q gi|254780471|r 22 VGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIM 82 (119) Q Consensus 22 iGFiLsiiLT~iaF~lV~~~~~~~~~~~~~~I~~~Av~Qi~VqL~~FLHl~~~~~~~~n~~ 82 (119) =||++|.+|+++......+...+.+....... ..++--.+|.-+=----.+=|.++||.+ T Consensus 72 GG~v~a~~L~~l~~~~~l~~~~l~~~lla~a~-~m~vGa~fV~~RR~~~P~RLS~G~w~~L 131 (224) T pfam11982 72 GGFVLASVLVILVYGLGLASRILGWLLLAAAL-VMFVGALFVARRRRNPPARLSKGPWMRL 131 (224) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHCCCCCCCCCCCHHHH T ss_conf 25999999999999786201578999999999-9999999999985089603477976674 No 27 >pfam06667 PspB Phage shock protein B. This family consists of several bacterial phage shock protein B (PspB) sequences. The phage shock protein (psp) operon is induced in response to heat, ethanol, osmotic shock and infection by filamentous bacteriophages. Expression of the operon requires the alternative sigma factor sigma54 and the transcriptional activator PspF. In addition, PspA plays a negative regulatory role, and the integral-membrane proteins PspB and PspC play a positive one. Probab=26.16 E-value=45 Score=13.83 Aligned_cols=22 Identities=18% Similarity=0.680 Sum_probs=14.7 Q ss_pred HHHHHHHHHHHHHHHHHHHHHH Q ss_conf 9999999999999999999985 Q gi|254780471|r 83 AMIFTIIMVAICFVGSMWVMYH 104 (119) Q Consensus 83 a~~Ft~~ii~iiv~GSiWIM~~ 104 (119) -+++.-++++.++++-+|+..| T Consensus 4 ~fl~vPliiF~ifVaP~WL~LH 25 (75) T pfam06667 4 EFLAVPLIIFMLFVAPIWLILH 25 (75) T ss_pred HHHHHHHHHHHHHHHHHHHHHH T ss_conf 8989979999999999999996 No 28 >pfam11286 DUF3087 Protein of unknown function (DUF3087). This family of proteins with unknown function appears to be restricted to Gammaproteobacteria. Probab=25.00 E-value=47 Score=13.71 Aligned_cols=39 Identities=10% Similarity=0.273 Sum_probs=22.6 Q ss_pred HHHHHHHHHHHHHHHHHHHCCCCCCC-HHHHHHHHHHHHHHHHH Q ss_conf 99999999999999999704778765-02599999999999999 Q gi|254780471|r 52 TIVLCAIAQIIVHLVFFLHMSTKVED-GWSIMAMIFTIIMVAIC 94 (119) Q Consensus 52 ~I~~~Av~Qi~VqL~~FLHl~~~~~~-~~n~~a~~Ft~~ii~ii 94 (119) .++.+++.|..++|+= +++++. +||+.-.+.+.++...+ T Consensus 27 ailsl~~s~~lI~lFG----~~s~~Nf~~NL~GVi~~~~~~~~~ 66 (165) T pfam11286 27 AVLSLAFGQLLIALFG----GESGGNFHLNLLGVILGLLLTGAL 66 (165) T ss_pred HHHHHHHHHHHHHHCC----CCCCCCEEEEHHHHHHHHHHHHHH T ss_conf 9999999999999818----999996544259999999999999 No 29 >TIGR01476 chlor_syn_BchG bacteriochlorophyll/chlorophyll synthetase; InterPro: IPR006372 These are a subfamily of a large family of polyprenyltransferases that also includes 4-hydroxybenzoate octaprenyltransferase and protoheme IX farnesyltransferase (heme O synthase). Members of this family are found exclusively in photosynthetic organisms, including a single copy in Arabidopsis thaliana.; GO: 0030494 bacteriochlorophyll biosynthetic process. Probab=24.68 E-value=48 Score=13.68 Aligned_cols=48 Identities=19% Similarity=0.286 Sum_probs=34.7 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHH Q ss_conf 469999999999999999999997047787650259999999999999 Q gi|254780471|r 46 KNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAI 93 (119) Q Consensus 46 ~~~~~~~I~~~Av~Qi~VqL~~FLHl~~~~~~~~n~~a~~Ft~~ii~i 93 (119) +...-.++.++=+.|+..|-+||+.=.++.+.++|.-+.-|-++.-.+ T Consensus 242 ~~~~A~~v~~lLvAq~~~~~~~flr~p~~n~v~Y~~~a~~l~vlgml~ 289 (295) T TIGR01476 242 QPLVATIVLLLLVAQIIAQAKLFLRDPEENEVKYNATAVPLYVLGMLA 289 (295) T ss_pred CHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEHHHHHHHHHHHHH T ss_conf 378999999998433664248642686447530101014899999999 No 30 >COG4218 MtrF Tetrahydromethanopterin S-methyltransferase, subunit F [Coenzyme metabolism] Probab=23.21 E-value=51 Score=13.51 Aligned_cols=22 Identities=18% Similarity=0.256 Sum_probs=15.5 Q ss_pred CHHHHHHHHHHHHHHHHHHHHH Q ss_conf 5256899999999999999999 Q gi|254780471|r 16 TKKQCLVGFILSLILTIIPFGI 37 (119) Q Consensus 16 s~k~yliGFiLsiiLT~iaF~l 37 (119) ..+...+||++|++|-.+|-.+ T Consensus 50 ~i~GlaiGfvfA~vLv~illll 71 (73) T COG4218 50 RIAGLAIGFVFAGVLVGILLLL 71 (73) T ss_pred HHHHHHHHHHHHHHHHHHHHHH T ss_conf 0578999999999999988886 No 31 >TIGR02210 rodA_shape rod shape-determining protein RodA; InterPro: IPR011923 This protein is a member of the FtsW/RodA/SpoVE family. It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologues from a number of both rod-shaped and coccoid bacteria (including four proteins in Bacillus anthracis) are not found in this family.; GO: 0008360 regulation of cell shape, 0009276 1-2nm peptidoglycan-based cell wall, 0016021 integral to membrane. Probab=20.15 E-value=59 Score=13.15 Aligned_cols=33 Identities=24% Similarity=0.487 Sum_probs=25.7 Q ss_pred HHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHH Q ss_conf 999999999999999999806578846999999 Q gi|254780471|r 21 LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTI 53 (119) Q Consensus 21 liGFiLsiiLT~iaF~lV~~~~~~~~~~~~~~I 53 (119) .--++.+++.+++|+.+|+-+...+.+..+..+ T Consensus 129 ~~~~~~~~~~i~~P~~Li~~QPDLGTa~~~~~~ 161 (416) T TIGR02210 129 FRELLLPLLIILIPVILILKQPDLGTALLVLAI 161 (416) T ss_pred HHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHH T ss_conf 799999999998668664406887449999999 Done!