HHsearch alignment for GI: 254780472 and conserved domain: MTH00075

>MTH00075 COX3 cytochrome c oxidase subunit III; Provisional.
Probab=100.00  E-value=0  Score=328.54  Aligned_cols=191  Identities=21%  Similarity=0.442  Sum_probs=165.3

Q ss_pred             EEEECCCCCCCC-------CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC-----CCCC-CHHHCC-CCHHHHHHH
Q ss_conf             465307765720-------25660268889999999999999999999427888-----8886-600002-403578999
Q gi|254780472|r   14 LFYVKDKKESCV-------DHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA-----AGPA-PIDVFD-ISGIFVSTI   79 (210)
Q Consensus        14 ~~~~~~~~~~~~-------~~~~~~~G~w~Fi~SE~~~Fa~lf~~y~~~~~~~~-----~~~~-~~~~~~-~~~~~~nT~   79 (210)
T Consensus        56 ~W~rdvi~Es~~~G~ht~~v~~g~~~Gm~lFI~SEvmfF~sfFwa~fh~~l~p~~e~g~~WPP~gi~~~~p~~lPllNT~  135 (261)
T MTH00075         56 QWWRDIVREGTFQGHHTPPVQKGLRYGMILFITSEVFFFLGFFWAFYNSSLAPTPELGECWPPTGITPLDPFEVPLLNTA  135 (261)
T ss_pred             HHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCHHHHH
T ss_conf             99998731135688884999974689779999999999999999999997267634376289998625773337098899


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999996333368877655899999999988999987554311100147860167999989979999999
Q gi|254780472|r   80 VLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFG  159 (210)
Q Consensus        80 iLl~SS~~~~~a~~a~~~~~~~~~~~~~L~~t~~lG~~Fl~~Q~~E~~~l~~~g~~~~~~~~~S~fy~lTG~H~lHV~~G  159 (210)
T Consensus       136 iLLsSg~tvt~Ah~al~~~-~~~~~~~~L~~Ti~LG~~F~~~Q~~EY~~---~~ft~~d~vygS~Ff~~TGfHG~HViiG  211 (261)
T MTH00075        136 VLLASGVTVTWAHHSIMQG-NRKEAIQSLALTIILGLYFTALQAMEYYE---APFTIADGVYGSTFFVATGFHGLHVIIG  211 (261)
T ss_pred             HHHHHHHHHHHHHHHHHHC-CHHHHHHHHHHHHHHHHHHHHHHHHHHHH---CCCCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             9971135899999999938-89999999999999999999999999997---7776468617899999984899999999


Q ss_pred             HHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999970799830426799998999999999999999999982
Q gi|254780472|r  160 LIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG  208 (210)
Q Consensus       160 li~L~~~~~~~~~~~~~~~~~~~~~~~~~YWHFVdivWi~lf~llYl~g  208 (210)
T Consensus       212 ~~~L~~~~~r~~~~~~~~~~~~~~e~~~~YWHFVDvVWlflf~~vY~WG  260 (261)
T MTH00075        212 SLFLLVCLLRQINFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIYWWG  260 (261)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHEEC
T ss_conf             9999999999971888866550467767467675767854644520637