HHsearch alignment for GI: 254780472 and conserved domain: PRK10663

>PRK10663 cytochrome o ubiquinol oxidase subunit III; Provisional.
Probab=100.00  E-value=0  Score=359.24  Aligned_cols=184  Identities=52%  Similarity=0.983  Sum_probs=174.5

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             25660268889999999999999999999427888888660000240357899999999999999999996333368877
Q gi|254780472|r   26 DHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTV  105 (210)
Q Consensus        26 ~~~~~~~G~w~Fi~SE~~~Fa~lf~~y~~~~~~~~~~~~~~~~~~~~~~~~nT~iLl~SS~~~~~a~~a~~~~~~~~~~~  105 (210)
T Consensus        21 ~~~~~~~GmWlFL~SE~~~F~~LFaaY~v~~~~~~~~p~~~~~~~~~~~~inT~iLl~SS~t~~~A~~a~~~g-~~~~~~   99 (204)
T PRK10663         21 AGATKVFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAMYKN-NKSQVI   99 (204)
T ss_pred             CCCCCEEHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CHHHHH
T ss_conf             8877542029999999999999999999998166789971775141499999999999999999999999839-899999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHH
Q ss_conf             65589999999998899998755431110014786016799998997999999999999999999707998304267999
Q gi|254780472|r  106 SWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLIC  185 (210)
Q Consensus       106 ~~L~~t~~lG~~Fl~~Q~~E~~~l~~~g~~~~~~~~~S~fy~lTG~H~lHV~~Gli~L~~~~~~~~~~~~~~~~~~~~~~  185 (210)
T Consensus       100 ~~L~~T~~LG~~Fl~~q~~Ey~~li~~G~~~~~~~f~s~ff~lTG~HglHV~~Gli~l~~~~~~~~~~~~~~~~~~~ve~  179 (204)
T PRK10663        100 SWLALTFLFGAGFIGMEIYEFHHLIVEGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQVARRGLTSTNRTRIMC  179 (204)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHH
T ss_conf             99999999999999999999999998679887651999999999899999999999999999999807898530289999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             9899999999999999999998209
Q gi|254780472|r  186 LSMFWHFLDLIWICVFSFVYLMGVV  210 (210)
Q Consensus       186 ~~~YWHFVdivWi~lf~llYl~g~~  210 (210)
T Consensus       180 ~~lYWHFVDvVWI~lF~lvYL~G~~  204 (204)
T PRK10663        180 LSLFWHFLDVVWICVFTVVYLMGAM  204 (204)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             9999999999999999999985179