HHsearch results for GI: 254780472 and protein with PDBid: 1v54_C

>1v54_C Cytochrome C oxidase polypeptide III; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: f.25.1.1 PDB: 1v55_C* 2dyr_C* 2eij_C* 2eik_C* 2eil_C* 2eim_C* 2ein_C* 2zxw_C* 3abk_C* 3abl_C* 3abm_C* 3ag1_C* 3ag2_C* 3ag3_C* 3ag4_C* 2occ_C* 1oco_C* 1occ_C* 1ocz_C* 1ocr_C* ...
Probab=100.00  E-value=0  Score=321.99  Aligned_cols=184  Identities=23%  Similarity=0.431  Sum_probs=162.7

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC-----CCC-CHHH-CCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             65720256602688899999999999999999994278888-----886-6000-0240357899999999999999999
Q gi|254780472|r   21 KESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAA-----GPA-PIDV-FDISGIFVSTIVLLLSSLSCSFAML   93 (210)
Q Consensus        21 ~~~~~~~~~~~~G~w~Fi~SE~~~Fa~lf~~y~~~~~~~~~-----~~~-~~~~-~~~~~~~~nT~iLl~SS~~~~~a~~   93 (210)
                      +|+....++.|+|||+||+||+|+|+++|++|+..|...++     ||| +.+. .+...+++||.+|++||.++++|++
T Consensus        70 ~ht~~~~~~~~~Gm~lFI~SEvm~F~sfF~ay~~~~~~~~~~~g~~wpp~~i~~~~~~~~pllnT~iLl~Ss~t~~~A~~  149 (261)
T 1v54_C           70 HHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHH  149 (261)
T ss_dssp             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCGGGTSSSSCTTCCCCCTTSHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             77455530650255999999999999999999998817775437818997710453141189999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             99633336887765589999999998899998755431110014786016799998997999999999999999999707
Q gi|254780472|r   94 ASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKK  173 (210)
Q Consensus        94 a~~~~~~~~~~~~~L~~t~~lG~~Fl~~Q~~E~~~l~~~g~~~~~~~~~S~fy~lTG~H~lHV~~Gli~L~~~~~~~~~~  173 (210)
                      +.+++ ++++.+.++..|+++|.+|+..|..||.+   .+.++++|+|+|.||++||+|++||++|++++.++.+|.+++
T Consensus       150 ~~~~~-~~~~~~~~l~~T~~LG~~F~~~q~~Ey~~---~~~t~~~~~~gS~Ff~lTG~Hg~HVi~G~i~L~~~~~r~~~~  225 (261)
T 1v54_C          150 SLMEG-DRKHMLQALFITITLGVYFTLLQASEYYE---APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKF  225 (261)
T ss_dssp             HHHTT-BHHHHHHHHHHHHHHHHHHHHHHHHHHHH---CSSCTTSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             HHHHC-CCHHHHHHHHHHHHHHHHHHHHHHHHHHC---CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             99907-84028999999999999999999987634---766766884268999999999999999999999999999836


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99830426799998999999999999999999982
Q gi|254780472|r  174 GLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG  208 (210)
Q Consensus       174 ~~~~~~~~~~~~~~~YWHFVdivWi~lf~llYl~g  208 (210)
                      +++++++.++|.+++||||||+||+++|+++|++|
T Consensus       226 ~~~~~~~~~~e~~~~YWHFVDvVWiflf~~vYlwG  260 (261)
T 1v54_C          226 HFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIYWWG  260 (261)
T ss_dssp             CCCSSCCHHHHHHHHHHHHHHHHHHHHHHHTTTTT
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             89842228999999998788988999999899618