Query         gi|254780472|ref|YP_003064885.1| cytochrome o ubiquinol oxidase subunit III [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 210
No_of_seqs    109 out of 1772
Neff          7.0 
Searched_HMMs 23785
Date          Mon May 30 11:34:37 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780472.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1fft_C Ubiquinol oxidase; elec 100.0       0       0  343.7   5.3  192   16-209    12-203 (204)
  2 1v54_C Cytochrome C oxidase po 100.0       0       0  322.0  19.0  184   21-208    70-260 (261)
  3 1m56_C Cytochrome C oxidase; m 100.0       0       0  316.4  20.1  187   19-208    68-265 (266)
  4 1qle_C Cytochrome C oxidase po 100.0       0       0  318.3  17.3  186   20-208    76-272 (273)
  5 2k1a_A Integrin alpha-IIB; sin   8.3      74  0.0031   10.7   3.3   25  155-179    16-40  (42)
  6 3h90_A Ferrous-iron efflux pum   7.5      81  0.0034   10.5   9.6   37   18-56     60-96  (283)
  7 1jb0_I Photosystem 1 reaction    5.9   1E+02  0.0042   10.0   2.5   18  105-122    18-35  (38)
  8 1z0x_A Transcriptional regulat   4.7      71   0.003   10.8  -1.4   14  179-192    34-47  (220)
  9 1dlf_L Anti-dansyl immunoglobu   4.6 1.3E+02  0.0057    9.3   0.2   25    3-27     42-66  (113)
 10 1xg0_B Phycoerythrin alpha-2 c   3.6 1.8E+02  0.0076    8.6   0.2   30    4-33      3-32  (67)

No 1  
>1fft_C Ubiquinol oxidase; electron transport, cytochrome oxidase, membrane protein, oxidoreductase; HET: HEM HEO; 3.50A {Escherichia coli} SCOP: f.25.1.1
Probab=100.00  E-value=0  Score=343.74  Aligned_cols=192  Identities=50%  Similarity=0.935  Sum_probs=176.7

Q ss_pred             EECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             53077657202566026888999999999999999999942788888866000024035789999999999999999999
Q gi|254780472|r   16 YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLAS   95 (210)
Q Consensus        16 ~~~~~~~~~~~~~~~~~G~w~Fi~SE~~~Fa~lf~~y~~~~~~~~~~~~~~~~~~~~~~~~nT~iLl~SS~~~~~a~~a~   95 (210)
                      ++++++|++ +.+++++|||+||+||+|+|++++++|+++|...+.+|++.+.++++.+.+||.+|++||+++++|+++.
T Consensus        12 ~~~~~~~~~-~~~~~~~Gmwlfi~SE~m~F~~lf~ay~~~~~~~~~~~~~~~~~~~~~~~~~T~lLl~SS~~~~~a~~a~   90 (204)
T 1fft_C           12 HAHEHGHHD-AGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAM   90 (204)
T ss_dssp             -------CC-STTHHHHHHHTTHHHHTTHHHHHHHHHTTTTTTCCCSCCCCCCTTHHHHHHHHHHHGGGTTTTTSGGGTT
T ss_pred             CCCCCCCCC-CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             666668888-8765058999999999999999999999999676889861020131089999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             63333688776558999999999889999875543111001478601679999899799999999999999999970799
Q gi|254780472|r   96 ATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGL  175 (210)
Q Consensus        96 ~~~~~~~~~~~~L~~t~~lG~~Fl~~Q~~E~~~l~~~g~~~~~~~~~S~fy~lTG~H~lHV~~Gli~L~~~~~~~~~~~~  175 (210)
                      +++ ++++.+.++..|+++|.+|++.|.+||.++.+.|+++++|+|+|+||++||+|++||++|+++|.++.+|.+++++
T Consensus        91 ~~~-~~~~~~~~L~~t~~lG~~Fl~~q~~e~~~l~~~g~~~~~~~~~s~fy~lTGlH~lHVi~Gli~L~~~~~r~~~~~~  169 (204)
T 1fft_C           91 YKN-NKSQVISWLALTWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGL  169 (204)
T ss_dssp             TTC-CGGGGTHHHHHHHHHHHHHHHHHHHHHHHHHHSSCSCCCCSTTTHHHHHHHHHTTHHHHTTHHHHHHHHHHHHTCC
T ss_pred             HCC-CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             847-8888999999999999999888998899999746776565078999999999999999999999999999983699


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             8304267999989999999999999999999820
Q gi|254780472|r  176 ISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV  209 (210)
Q Consensus       176 ~~~~~~~~~~~~~YWHFVdivWi~lf~llYl~g~  209 (210)
                      +++++.++|.+++||||||+||+++|+++|++|.
T Consensus       170 ~~~~~~~v~~~~~YWHFvD~vWl~lf~~lYl~G~  203 (204)
T 1fft_C          170 TSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMGA  203 (204)
T ss_dssp             CTTCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCC
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             9531026899999999999999999999999727


No 2  
>1v54_C Cytochrome C oxidase polypeptide III; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: f.25.1.1 PDB: 1v55_C* 2dyr_C* 2eij_C* 2eik_C* 2eil_C* 2eim_C* 2ein_C* 2zxw_C* 3abk_C* 3abl_C* 3abm_C* 3ag1_C* 3ag2_C* 3ag3_C* 3ag4_C* 2occ_C* 1oco_C* 1occ_C* 1ocz_C* 1ocr_C* ...
Probab=100.00  E-value=0  Score=321.99  Aligned_cols=184  Identities=23%  Similarity=0.431  Sum_probs=162.7

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC-----CCC-CHHH-CCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             65720256602688899999999999999999994278888-----886-6000-0240357899999999999999999
Q gi|254780472|r   21 KESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAA-----GPA-PIDV-FDISGIFVSTIVLLLSSLSCSFAML   93 (210)
Q Consensus        21 ~~~~~~~~~~~~G~w~Fi~SE~~~Fa~lf~~y~~~~~~~~~-----~~~-~~~~-~~~~~~~~nT~iLl~SS~~~~~a~~   93 (210)
                      +|+....++.|+|||+||+||+|+|+++|++|+..|...++     ||| +.+. .+...+++||.+|++||.++++|++
T Consensus        70 ~ht~~~~~~~~~Gm~lFI~SEvm~F~sfF~ay~~~~~~~~~~~g~~wpp~~i~~~~~~~~pllnT~iLl~Ss~t~~~A~~  149 (261)
T 1v54_C           70 HHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHH  149 (261)
T ss_dssp             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCGGGTSSSSCTTCCCCCTTSHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             77455530650255999999999999999999998817775437818997710453141189999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             99633336887765589999999998899998755431110014786016799998997999999999999999999707
Q gi|254780472|r   94 ASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKK  173 (210)
Q Consensus        94 a~~~~~~~~~~~~~L~~t~~lG~~Fl~~Q~~E~~~l~~~g~~~~~~~~~S~fy~lTG~H~lHV~~Gli~L~~~~~~~~~~  173 (210)
                      +.+++ ++++.+.++..|+++|.+|+..|..||.+   .+.++++|+|+|.||++||+|++||++|++++.++.+|.+++
T Consensus       150 ~~~~~-~~~~~~~~l~~T~~LG~~F~~~q~~Ey~~---~~~t~~~~~~gS~Ff~lTG~Hg~HVi~G~i~L~~~~~r~~~~  225 (261)
T 1v54_C          150 SLMEG-DRKHMLQALFITITLGVYFTLLQASEYYE---APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKF  225 (261)
T ss_dssp             HHHTT-BHHHHHHHHHHHHHHHHHHHHHHHHHHHH---CSSCTTSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             HHHHC-CCHHHHHHHHHHHHHHHHHHHHHHHHHHC---CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             99907-84028999999999999999999987634---766766884268999999999999999999999999999836


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99830426799998999999999999999999982
Q gi|254780472|r  174 GLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG  208 (210)
Q Consensus       174 ~~~~~~~~~~~~~~~YWHFVdivWi~lf~llYl~g  208 (210)
                      +++++++.++|.+++||||||+||+++|+++|++|
T Consensus       226 ~~~~~~~~~~e~~~~YWHFVDvVWiflf~~vYlwG  260 (261)
T 1v54_C          226 HFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIYWWG  260 (261)
T ss_dssp             CCCSSCCHHHHHHHHHHHHHHHHHHHHHHHTTTTT
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             89842228999999998788988999999899618


No 3  
>1m56_C Cytochrome C oxidase; membrane protein, oxidoreductase; HET: HEA PEH; 2.30A {Rhodobacter sphaeroides} SCOP: f.25.1.1 PDB: 1m57_C*
Probab=100.00  E-value=0  Score=316.36  Aligned_cols=187  Identities=22%  Similarity=0.447  Sum_probs=163.5

Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC---------CCC-CHHH-CCCCHHHHHHHHHHHHHHH
Q ss_conf             7765720256602688899999999999999999994278888---------886-6000-0240357899999999999
Q gi|254780472|r   19 DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAA---------GPA-PIDV-FDISGIFVSTIVLLLSSLS   87 (210)
Q Consensus        19 ~~~~~~~~~~~~~~G~w~Fi~SE~~~Fa~lf~~y~~~~~~~~~---------~~~-~~~~-~~~~~~~~nT~iLl~SS~~   87 (210)
                      +.+|+....++.|+|||+||+||+|+|+++|++|+..|...+.         +|| +... .+...+.+||.+|++||.+
T Consensus        68 ~G~~t~~v~~~~~~Gm~~Fi~SEvm~F~~~f~ay~~~~~~~~~~~~~~~~~~~~p~g~~~~~~~~l~l~nT~iLl~Ss~t  147 (266)
T 1m56_C           68 EGDHTPVVRLGLRWGFILFIMSEVMFFSAWFWSFFKHALYPMGPESPIIDGIFPPEGIITFDPWHLPLINTLILLCSGCA  147 (266)
T ss_dssp             TTCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCCTBTTTBCCCSSCTTCCCCCTTTTHHHHHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             58684888741689999999999999999999999997386788886547878996544367477789999999988999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999633336887765589999999998899998755431110014786016799998997999999999999999
Q gi|254780472|r   88 CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLV  167 (210)
Q Consensus        88 ~~~a~~a~~~~~~~~~~~~~L~~t~~lG~~Fl~~Q~~E~~~l~~~g~~~~~~~~~S~fy~lTG~H~lHV~~Gli~L~~~~  167 (210)
                      +++|+++.+++++++.+..++..|+++|.+|+..|.+||.+   .+.+++||+|+|.||++||+|++||++|+++++++.
T Consensus       148 ~~~a~~~~~~~~~~~~~~~~l~~ti~lG~~Fl~~q~~Ey~~---~~~~~~~~~~gS~ff~lTG~Hg~HV~~G~i~l~~~~  224 (266)
T 1m56_C          148 ATWAHHALVHENNRRDVAWGLALAIALGALFTVFQAYEYSH---AAFGFAGNIYGANFFMATGFHGFHVIVGTIFLLVCL  224 (266)
T ss_dssp             HHHHHHHHHHTCCHHHHHHHHHHHHHHHHHHHHHHHHHHHT---CSSCSSSSHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999998852322558999999999999999999999998---765650658998999999999999999999999999


Q ss_pred             HHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99970799830426799998999999999999999999982
Q gi|254780472|r  168 IQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG  208 (210)
Q Consensus       168 ~~~~~~~~~~~~~~~~~~~~~YWHFVdivWi~lf~llYl~g  208 (210)
                      .|..+++++++++.++|.+++||||||+||+++|+++|++|
T Consensus       225 ~~~~~~~~~~~~~~~~e~~~~YWHFVDvVWi~lf~~vYl~G  265 (266)
T 1m56_C          225 IRVQRGHFTPEKHVGFEAAIWYWHFVDVVWLFLFASIYIWG  265 (266)
T ss_dssp             HHHHTCCCCSSCCHHHHHHHHHHHHHHHHHHHHHHHHTTTC
T ss_pred             HHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99971799844017899999999888988998899898017


No 4  
>1qle_C Cytochrome C oxidase polypeptide III; oxidoreductase/immune system, complex (oxidoreductase/antibody), electron transport; HET: HEA PC1; 3.0A {Paracoccus denitrificans} SCOP: f.25.1.1
Probab=100.00  E-value=0  Score=318.28  Aligned_cols=186  Identities=26%  Similarity=0.538  Sum_probs=162.0

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-----C----CCCC-CHHHCC-CCHHHHHHHHHHHHHHHH
Q ss_conf             7657202566026888999999999999999999942788-----8----8886-600002-403578999999999999
Q gi|254780472|r   20 KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY-----A----AGPA-PIDVFD-ISGIFVSTIVLLLSSLSC   88 (210)
Q Consensus        20 ~~~~~~~~~~~~~G~w~Fi~SE~~~Fa~lf~~y~~~~~~~-----~----~~~~-~~~~~~-~~~~~~nT~iLl~SS~~~   88 (210)
                      .+|+....++-|+|||+||+||+|+|+++|++|+..+...     +    .||| +.+..+ ...+++||.+|++||.++
T Consensus        76 G~ht~~v~~~~~~Gm~~FI~SEvmfF~~~F~a~~~~~l~~~~~~~~~~~~~wpp~gi~~~~~~~lpllnT~iLl~Ss~tv  155 (273)
T 1qle_C           76 GEHTPVVRIGLQYGFILFIMSEVMFFVAWFWAFIKNALYPMGPDSPIKDGVWPPEGIVTFDPWHLPLINTLILLLSGVAV  155 (273)
T ss_dssp             TCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCCTTTTTSCCCSSCTTCCCCCTTTHHHHHHHHHHHHHHHH
T ss_pred             CCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             76755542453599999999999999999999985112667887632258799986665674777899999999989999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999996333368877655899999999988999987554311100147860167999989979999999999999999
Q gi|254780472|r   89 SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVI  168 (210)
Q Consensus        89 ~~a~~a~~~~~~~~~~~~~L~~t~~lG~~Fl~~Q~~E~~~l~~~g~~~~~~~~~S~fy~lTG~H~lHV~~Gli~L~~~~~  168 (210)
                      ++|+++..+++++++...++..|+++|.+|+.+|.+||.+   .+++++||+|||.||++||+|++||++|++++.++.+
T Consensus       156 t~a~~~~~~~~~~~~~~~~L~~Ti~LG~~Fl~~Q~~Ey~~---~~f~~~~~~ygS~Ff~~TG~Hg~HV~~G~~~l~~~~~  232 (273)
T 1qle_C          156 TWAHHAFVLEGDRKTTINGLIVAVILGVCFTGLQAYEYSH---AAFGLADTVYAGAFYMATGFHGAHVIIGTIFLFVCLI  232 (273)
T ss_dssp             HHHHHHHHHTCCHHHHHHHTHHHHTHHHHHHHHHHHHGGG---CSCCSSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH---CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999983656657899999999999999988988860---4357664101117999999999899999999999999


Q ss_pred             HHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9970799830426799998999999999999999999982
Q gi|254780472|r  169 QILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG  208 (210)
Q Consensus       169 ~~~~~~~~~~~~~~~~~~~~YWHFVdivWi~lf~llYl~g  208 (210)
                      |..+++++++++.++|++++||||||+||+++|+++|++|
T Consensus       233 r~~~~~~~~~~~~~~e~~~~YWHFVDvVWlflf~~vYlwG  272 (273)
T 1qle_C          233 RLLKGQMTQKQHVGFEAAAWYWHFVDVVWLFLFVVIYIWG  272 (273)
T ss_dssp             HHTTTCCBTTBCHHHHHHHHHHHHHHHHHHHHHHCCCCCT
T ss_pred             HHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHEEC
T ss_conf             9971799965007999999998788978999888898028


No 5  
>2k1a_A Integrin alpha-IIB; single-PASS transmembrane segment, alternative splicing, calcium, cell adhesion, cleavage on PAIR of basic residues; NMR {Homo sapiens} PDB: 2k9j_A
Probab=8.31  E-value=74  Score=10.72  Aligned_cols=25  Identities=36%  Similarity=0.563  Sum_probs=13.4

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCHHH
Q ss_conf             9999999999999999707998304
Q gi|254780472|r  155 HVFFGLIWLFVLVIQILKKGLISGN  179 (210)
Q Consensus       155 HV~~Gli~L~~~~~~~~~~~~~~~~  179 (210)
                      -|++|++.|..+.+-..+.++..++
T Consensus        16 sv~~Gll~L~ll~~~lwKcGFFKR~   40 (42)
T 2k1a_A           16 GVLGGLLLLTILVLAMWKVGFFKRN   40 (42)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTTTCCC
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             9999999999999999982732468


No 6  
>3h90_A Ferrous-iron efflux pump FIEF; membrane protein, zinc transporter, cell inner membrane, cell membrane, ION transport, iron transport; 2.90A {Escherichia coli k-12} PDB: 2qfi_A
Probab=7.50  E-value=81  Score=10.51  Aligned_cols=37  Identities=11%  Similarity=0.011  Sum_probs=21.1

Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             077657202566026888999999999999999999942
Q gi|254780472|r   18 KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG   56 (210)
Q Consensus        18 ~~~~~~~~~~~~~~~G~w~Fi~SE~~~Fa~lf~~y~~~~   56 (210)
                      ++.++|.+.+.-..  +..++.+-.+++.+++..+-...
T Consensus        60 ~d~~~pyG~~r~E~--l~~l~~~~~l~~~~~~~~~~ai~   96 (283)
T 3h90_A           60 ADDNHSFGHGKAES--LAALAQSMFISGSALFLFLTGIQ   96 (283)
T ss_dssp             CCSSCSSCSTTHHH--HHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCHHHHH--HHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             87569984034507--99999999999999999999999


No 7  
>1jb0_I Photosystem 1 reaction centre subunit VIII; membrane protein, multiprotein-pigment complex, photosynthesis; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: f.23.17.1
Probab=5.91  E-value=1e+02  Score=10.04  Aligned_cols=18  Identities=39%  Similarity=1.006  Sum_probs=11.9

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q ss_conf             765589999999998899
Q gi|254780472|r  105 VSWLLVTAFFGMIFIIME  122 (210)
Q Consensus       105 ~~~L~~t~~lG~~Fl~~Q  122 (210)
                      .-||.-+..+|++|+...
T Consensus        18 v~wl~p~vvmgllfiyie   35 (38)
T 1jb0_I           18 VCWLMPTVVMGLLFLYIE   35 (38)
T ss_dssp             HHTHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHEEEE
T ss_conf             999999999988715852


No 8  
>1z0x_A Transcriptional regulator, TETR family; structural genomics, PSI, protein structure initiative, midwest center for structural genomics; 2.40A {Enterococcus faecalis V583} SCOP: a.4.1.9 a.121.1.1
Probab=4.69  E-value=71  Score=10.83  Aligned_cols=14  Identities=21%  Similarity=0.622  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHH
Q ss_conf             42679999899999
Q gi|254780472|r  179 NQRRLICLSMFWHF  192 (210)
Q Consensus       179 ~~~~~~~~~~YWHF  192 (210)
                      ...++...++|+||
T Consensus        34 ~~aGvs~~~lY~hF   47 (220)
T 1z0x_A           34 KQLGVQAPAIYWYF   47 (220)
T ss_dssp             HHHTSCHHHHHTTC
T ss_pred             HHHCCCHHHHHHHC
T ss_conf             99696787899996


No 9  
>1dlf_L Anti-dansyl immunoglobulin IGG2A(S); FV fragment; 1.45A {Mus musculus} SCOP: b.1.1.1 PDB: 1wz1_L* 2dlf_L 1maj_A 1mak_A 1ktr_L 2cju_L* 2uud_K* 1dsf_L 1n4x_L 1bfv_L* 1cfv_L* 2bfv_L* 1wt5_C
Probab=4.61  E-value=1.3e+02  Score=9.33  Aligned_cols=25  Identities=28%  Similarity=0.464  Sum_probs=0.0

Q ss_pred             HHHCCCCCCCEEEEECCCCCCCCCC
Q ss_conf             0120169870246530776572025
Q gi|254780472|r    3 RQKIGKSPNFSLFYVKDKKESCVDH   27 (210)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~   27 (210)
                      |||-|++|.+-+....+......++
T Consensus        42 rQ~~G~~p~~Li~~~~~~~~~~~~~   66 (113)
T 1dlf_L           42 LQKPGQSPKLLIYKVSNRFSGVPDR   66 (113)
T ss_dssp             EECTTSCCEEEEETTTEECTTCCTT
T ss_pred             EECCCCCCCEEEECCCCCCCCCCCC
T ss_conf             6489998859999169768898878


No 10 
>1xg0_B Phycoerythrin alpha-2 chain; light-harvesting protein, cryptophyte, photosynthesis; HET: LYZ DBV PEB; 0.97A {Rhodomonas SP} SCOP: d.184.1.1 PDB: 1qgw_B* 1xf6_B*
Probab=3.62  E-value=1.8e+02  Score=8.63  Aligned_cols=30  Identities=20%  Similarity=0.310  Sum_probs=0.0

Q ss_pred             HHCCCCCCCEEEEECCCCCCCCCCCCHHHH
Q ss_conf             120169870246530776572025660268
Q gi|254780472|r    4 QKIGKSPNFSLFYVKDKKESCVDHDGTYLG   33 (210)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G   33 (210)
                      .|-+++|.++...++--.+...|..|.+-|
T Consensus         3 dk~~~APvItiFDhRGC~r~~kEYtG~kag   32 (67)
T 1xg0_B            3 DKSAKAPVITIFDHRGCSRAPKEYTGAKAG   32 (67)
T ss_dssp             CSSCEEEEEEEEECTTCSSCCCSCCSCCCS
T ss_pred             CCCCCCCEEEEECCCCCCCCCCCCCCCCCC
T ss_conf             756778768885265666766001488779


Done!