HHSEARCH alignment of GI: 254780472 and SCOP domain: d1fftc_

Alignment
>d1fftc_ f.25.1.1 (C:) Cytochrome O ubiquinol oxidase, subunit III {Escherichia coli [TaxId: 562]}
Probab=100.00  E-value=0  Score=337.55  Aligned_cols=182  Identities=53%  Similarity=0.990  Sum_probs=172.0

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             25660268889999999999999999999427888888660000240357899999999999999999996333368877
Q gi|254780472|r   26 DHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTV  105 (210)
Q Consensus        26 ~~~~~~~G~w~Fi~SE~~~Fa~lf~~y~~~~~~~~~~~~~~~~~~~~~~~~nT~iLl~SS~~~~~a~~a~~~~~~~~~~~  105 (210)
                      +++++++|||+||+||+|+|+++|++|++.|.+.+.+|++.+..+++.+++||.+|++||+++++|+++.++ +++++++
T Consensus         3 ~~~~~~~G~w~Fi~se~~~F~~lf~~y~~~~~~~~~~~~~~~~~~~~~~~~nT~vLl~SS~~~~~a~~~~~~-~~~~~~~   81 (185)
T d1fftc_           3 AGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAMYK-NNKSQVI   81 (185)
T ss_dssp             STTHHHHHHHTTHHHHTTHHHHHHHHHTTTTTTCCCSCCCCCCTTHHHHHHHHHHHGGGTTTTTSGGGTTTT-CCGGGGT
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHH
T ss_conf             998762658999999999999999999999967777876410124239999999999999999999999998-7889999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHH
Q ss_conf             65589999999998899998755431110014786016799998997999999999999999999707998304267999
Q gi|254780472|r  106 SWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLIC  185 (210)
Q Consensus       106 ~~L~~t~~lG~~Fl~~Q~~E~~~l~~~g~~~~~~~~~S~fy~lTG~H~lHV~~Gli~L~~~~~~~~~~~~~~~~~~~~~~  185 (210)
                      .++..|+++|.+|+..|..||++++++|.++++|+|+|+||++||+|++||++|+++|.++.+|..+++.+++++.++|.
T Consensus        82 ~~L~~t~~lG~~Fl~~q~~e~~~l~~~g~~~~~~~~~s~fy~lTGlH~lHV~~Gli~L~~~~~r~~~~~~~~~~~~~v~~  161 (185)
T d1fftc_          82 SWLALTWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMC  161 (185)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHSSCSCCCCSTTTHHHHHHHHHTTHHHHTTHHHHHHHHHHHHTCCCTTCCCHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHH
T ss_conf             99999999999999988876999997166643342033399989999999999999999999999807999540068999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             98999999999999999999982
Q gi|254780472|r  186 LSMFWHFLDLIWICVFSFVYLMG  208 (210)
Q Consensus       186 ~~~YWHFVdivWi~lf~llYl~g  208 (210)
                      +++||||||++|+++|+++|++|
T Consensus       162 ~~~YWHFvd~vWi~lf~~lYl~g  184 (185)
T d1fftc_         162 LSLFWHFLDVVWICVFTVVYLMG  184 (185)
T ss_dssp             HHHHHHHHHHHHHHHCCCCCCCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999999999999999897049


SCOP domain information

class: Membrane and cell surface proteins and peptides
fold: Cytochrome c oxidase subunit III-like
superfamily: Cytochrome c oxidase subunit III-like
family: Cytochrome c oxidase subunit III-like
domain: Cytochrome O ubiquinol oxidase, subunit III
species: Escherichia coli [TaxId: 562]