BLAST/PSIBLAST alignment of GI: 254780472 and GI: 220924641 at iteration 1
>gi|220924641|ref|YP_002499943.1| cytochrome o ubiquinol oxidase subunit III [Methylobacterium nodulans ORS 2060] Length = 222
>gi|219949248|gb|ACL59640.1| cytochrome o ubiquinol oxidase, subunit III [Methylobacterium nodulans ORS 2060] Length = 222
 Score =  241 bits (615), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 118/198 (59%), Positives = 149/198 (75%), Gaps = 4/198 (2%)

Query: 13  SLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
            LFY +++        GT LGFWIYLMSDCL+FAV F TY VLG++YAAGP+P DVF++ 
Sbjct: 28  PLFYAEEEH---AHESGTLLGFWIYLMSDCLVFAVLFATYGVLGRSYAAGPSPNDVFNLP 84

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + V+T +LLLSS++  FAML    K  +     WL+VT  FG  FI +E+YEFAH+I  
Sbjct: 85  IVAVNTTMLLLSSITYGFAML-EMDKGQVRGMQRWLVVTGLFGAAFIGIELYEFAHMIRE 143

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
            A PQRS FLSSFFALVG HGLHV FGL+WL VL++Q+ ++GLI+ N RRL+CLSMFWHF
Sbjct: 144 GATPQRSGFLSSFFALVGTHGLHVTFGLVWLSVLMVQVAQRGLIADNMRRLLCLSMFWHF 203

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD++WI VF+FVYLMGV+
Sbjct: 204 LDVVWIGVFTFVYLMGVL 221