BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780472|ref|YP_003064885.1| cytochrome o ubiquinol oxidase
subunit III [Candidatus Liberibacter asiaticus str. psy62]
         (210 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780472|ref|YP_003064885.1| cytochrome o ubiquinol oxidase subunit III [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040149|gb|ACT56945.1| cytochrome o ubiquinol oxidase subunit III [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 210

 Score =  421 bits (1083), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 210/210 (100%), Positives = 210/210 (100%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA
Sbjct: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
           AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII
Sbjct: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ
Sbjct: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RRLICLSMFWHFLDLIWICVFSFVYLMGVV
Sbjct: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210


>gi|315122072|ref|YP_004062561.1| cytochrome o ubiquinol oxidase subunit III [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495474|gb|ADR52073.1| cytochrome o ubiquinol oxidase subunit III [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 209

 Score =  325 bits (833), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 172/211 (81%), Positives = 190/211 (90%), Gaps = 3/211 (1%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDH-DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY 59
           MS++KIGKSPN  +FY+K++K SC+DH DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY
Sbjct: 1   MSKRKIGKSPNTPVFYLKEEKGSCIDHHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY 60

Query: 60  AAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFI 119
           AAGPAPID+F I  I VSTIVLLLSSLS SFAMLAS   +  +KTV WLLVTAFFG+IFI
Sbjct: 61  AAGPAPIDIFGIRDILVSTIVLLLSSLSYSFAMLASEDVK--NKTVFWLLVTAFFGIIFI 118

Query: 120 IMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGN 179
           +MEI+EFAHLIS  A PQRSAFLSSFF+LV LHGLHVFFGLIW+F+LVIQILKKGLI  N
Sbjct: 119 MMEIHEFAHLISKGATPQRSAFLSSFFSLVALHGLHVFFGLIWIFILVIQILKKGLIPDN 178

Query: 180 QRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           +RRL+CLSMFWHFLDLIWICVFSFVYLMGVV
Sbjct: 179 RRRLMCLSMFWHFLDLIWICVFSFVYLMGVV 209


>gi|150376511|ref|YP_001313107.1| cytochrome o ubiquinol oxidase subunit III [Sinorhizobium medicae
           WSM419]
 gi|150031058|gb|ABR63174.1| Cytochrome o ubiquinol oxidase subunit III [Sinorhizobium medicae
           WSM419]
          Length = 210

 Score =  244 bits (623), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 154/204 (75%), Gaps = 7/204 (3%)

Query: 7   GKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI 66
           GK+P F L      KE       T LGFW+YLMSDCL+FAV F T+AVLG+NYAAGP+P 
Sbjct: 13  GKAPAFYL------KEEHHPEGSTMLGFWLYLMSDCLIFAVLFATHAVLGRNYAAGPSPA 66

Query: 67  DVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEF 126
           D+FD+  I ++T +LL SS++  FAML     RL   T++W+ VTA FG++F+ +E+YEF
Sbjct: 67  DLFDLPLIALNTSMLLFSSITYGFAMLEMEKGRL-RATLAWMAVTALFGIVFVGLELYEF 125

Query: 127 AHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
           AHLI   A PQRSAFLSSFF LVG HGLHV  G+IW+FVL+ Q+ K GLI+ N+RRL+CL
Sbjct: 126 AHLIHEGAGPQRSAFLSSFFTLVGTHGLHVSSGIIWMFVLMAQVAKHGLIAENKRRLMCL 185

Query: 187 SMFWHFLDLIWICVFSFVYLMGVV 210
           SMFWHFLD++WI VFSFVYLMGV+
Sbjct: 186 SMFWHFLDVVWIGVFSFVYLMGVL 209


>gi|220924641|ref|YP_002499943.1| cytochrome o ubiquinol oxidase subunit III [Methylobacterium
           nodulans ORS 2060]
 gi|219949248|gb|ACL59640.1| cytochrome o ubiquinol oxidase, subunit III [Methylobacterium
           nodulans ORS 2060]
          Length = 222

 Score =  241 bits (615), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 118/198 (59%), Positives = 149/198 (75%), Gaps = 4/198 (2%)

Query: 13  SLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
            LFY +++        GT LGFWIYLMSDCL+FAV F TY VLG++YAAGP+P DVF++ 
Sbjct: 28  PLFYAEEEH---AHESGTLLGFWIYLMSDCLVFAVLFATYGVLGRSYAAGPSPNDVFNLP 84

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + V+T +LLLSS++  FAML    K  +     WL+VT  FG  FI +E+YEFAH+I  
Sbjct: 85  IVAVNTTMLLLSSITYGFAML-EMDKGQVRGMQRWLVVTGLFGAAFIGIELYEFAHMIRE 143

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
            A PQRS FLSSFFALVG HGLHV FGL+WL VL++Q+ ++GLI+ N RRL+CLSMFWHF
Sbjct: 144 GATPQRSGFLSSFFALVGTHGLHVTFGLVWLSVLMVQVAQRGLIADNMRRLLCLSMFWHF 203

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD++WI VF+FVYLMGV+
Sbjct: 204 LDVVWIGVFTFVYLMGVL 221


>gi|307309511|ref|ZP_07589167.1| cytochrome o ubiquinol oxidase, subunit III [Sinorhizobium meliloti
           BL225C]
 gi|306900096|gb|EFN30716.1| cytochrome o ubiquinol oxidase, subunit III [Sinorhizobium meliloti
           BL225C]
          Length = 210

 Score =  238 bits (606), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 120/205 (58%), Positives = 154/205 (75%), Gaps = 9/205 (4%)

Query: 7   GKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI 66
           G++P F L       E       T LGFW+YLMSDCL+FAV F T+AVLG+NYAAGP+P 
Sbjct: 13  GQAPAFYL------TEEHHPEGSTMLGFWLYLMSDCLIFAVLFATHAVLGRNYAAGPSPA 66

Query: 67  DVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKT-VSWLLVTAFFGMIFIIMEIYE 125
           D+FD+  + V+T +LL SS++  FAMLA   +R   KT ++W+ VTA FG+ F+ +E+YE
Sbjct: 67  DLFDLPLVAVNTSMLLFSSITYGFAMLA--MERYDKKTTLAWMAVTALFGIAFVGLELYE 124

Query: 126 FAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLIC 185
           FAHL+   A PQRSAFLSSFF LVG HGLHV  G++W+FVL+ Q+ K+GLI  N+RRL+C
Sbjct: 125 FAHLLHEGAGPQRSAFLSSFFTLVGTHGLHVTAGIVWMFVLMAQVAKRGLIPENKRRLMC 184

Query: 186 LSMFWHFLDLIWICVFSFVYLMGVV 210
           LSMFWHFLD++WI VFSFVYLMGV+
Sbjct: 185 LSMFWHFLDVVWIGVFSFVYLMGVL 209


>gi|16265065|ref|NP_437857.1| putative cytochrome o ubiquinol oxidase chain III protein
           [Sinorhizobium meliloti 1021]
 gi|307320581|ref|ZP_07599995.1| cytochrome o ubiquinol oxidase, subunit III [Sinorhizobium meliloti
           AK83]
 gi|13398498|gb|AAK21905.1| ubiquinol oxidase subunit-like protein [Sinorhizobium meliloti]
 gi|15141204|emb|CAC49717.1| putative cytochrome o ubiquinol oxidase chain III protein
           [Sinorhizobium meliloti 1021]
 gi|306893731|gb|EFN24503.1| cytochrome o ubiquinol oxidase, subunit III [Sinorhizobium meliloti
           AK83]
          Length = 210

 Score =  237 bits (604), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 120/205 (58%), Positives = 153/205 (74%), Gaps = 9/205 (4%)

Query: 7   GKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI 66
           G++P F L       E       T LGFW+YLMSDCL+FAV F T+AVLG+NYAAGP+P 
Sbjct: 13  GQAPAFYL------TEEHHPEGSTMLGFWLYLMSDCLIFAVLFATHAVLGRNYAAGPSPA 66

Query: 67  DVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHK-TVSWLLVTAFFGMIFIIMEIYE 125
           D+FD+  + V+T +LL SS++  FAMLA   +R   K T++W+ VTA FG+ F+ +E YE
Sbjct: 67  DLFDLPLVAVNTSMLLFSSITYGFAMLA--MERYEKKATLTWMAVTALFGIAFVGLEFYE 124

Query: 126 FAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLIC 185
           FAHL+   A PQRSAFLSSFF LVG HGLHV  G++W+FVL+ Q+ K+GLI  N+RRL+C
Sbjct: 125 FAHLLHEGAGPQRSAFLSSFFTLVGTHGLHVTAGIVWMFVLMAQVAKRGLIPENKRRLMC 184

Query: 186 LSMFWHFLDLIWICVFSFVYLMGVV 210
           LSMFWHFLD++WI VFSFVYLMGV+
Sbjct: 185 LSMFWHFLDVVWIGVFSFVYLMGVL 209


>gi|319783411|ref|YP_004142887.1| cytochrome o ubiquinol oxidase subunit III [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317169299|gb|ADV12837.1| cytochrome o ubiquinol oxidase, subunit III [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 208

 Score =  237 bits (604), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 148/198 (74%), Gaps = 1/198 (0%)

Query: 13  SLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
           ++F+++D          T LGFWIYLMSDCL+FA+ F  Y VLG NYAAGPAP D+FD+ 
Sbjct: 11  TIFHLEDDHGHAESGSSTMLGFWIYLMSDCLIFAMLFAVYGVLGGNYAAGPAPKDLFDLP 70

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + ++T +LLLSS++  FAML  A  R+    V WL++T  FG+ F+ +E+YEFAH I  
Sbjct: 71  LVALNTTMLLLSSITYGFAMLEMAKGRVRPMQV-WLVITGLFGLAFLGIELYEFAHFIHE 129

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
            A PQRS FLSSFF LVG HGLHV FGL+WL VL++Q+ + GLI+ NQRRL+CLSMFWHF
Sbjct: 130 GATPQRSGFLSSFFTLVGTHGLHVTFGLVWLVVLMVQVSRHGLIAANQRRLMCLSMFWHF 189

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD+IWI VF+FVYLMG++
Sbjct: 190 LDVIWIGVFTFVYLMGML 207


>gi|227820111|ref|YP_002824082.1| cytochrome O ubiquinol oxidase subunit III [Sinorhizobium fredii
           NGR234]
 gi|227339110|gb|ACP23329.1| cytochrome o ubiquinol oxidase subunit III [Sinorhizobium fredii
           NGR234]
          Length = 210

 Score =  236 bits (603), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 119/206 (57%), Positives = 151/206 (73%), Gaps = 7/206 (3%)

Query: 5   KIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPA 64
           + GK+P F L      +E       T LGFW+YLMSDCL+FAV F T+AV+G+NYAAGP+
Sbjct: 11  QEGKAPTFYL------EEEHHPEGSTMLGFWLYLMSDCLIFAVLFATHAVVGRNYAAGPS 64

Query: 65  PIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIY 124
           P D+FD+  + V+T +LL SS++  FAML    K     T+ W+ VTA FGM F+ +E+Y
Sbjct: 65  PADLFDLPLVAVNTSMLLFSSITYGFAML-EMEKAKKSTTLVWMAVTALFGMAFVGLELY 123

Query: 125 EFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLI 184
           EFAH+I   A PQRSAFLSSFF LVG HGLHV  G+IW+ VL+ Q+ K+GLI  N+RRL+
Sbjct: 124 EFAHMIHEGAGPQRSAFLSSFFTLVGTHGLHVTSGIIWMLVLMAQVAKRGLILENKRRLM 183

Query: 185 CLSMFWHFLDLIWICVFSFVYLMGVV 210
           CLSMFWHFLD++WI VFSFVYLMGV+
Sbjct: 184 CLSMFWHFLDVVWIGVFSFVYLMGVL 209


>gi|86747366|ref|YP_483862.1| cytochrome c oxidase, subunit III [Rhodopseudomonas palustris HaA2]
 gi|86570394|gb|ABD04951.1| Cytochrome c oxidase, subunit III [Rhodopseudomonas palustris HaA2]
          Length = 209

 Score =  236 bits (601), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 114/198 (57%), Positives = 150/198 (75%), Gaps = 2/198 (1%)

Query: 13  SLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
            +F+V D+  +  +   T LGFWIYLMSDCL+FA+ F TY VLG NYAAGPAP D+FD+ 
Sbjct: 13  PVFHVVDE-HAHPEGASTMLGFWIYLMSDCLIFAILFATYGVLGANYAAGPAPKDLFDLK 71

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + V+T +LL+SS++  FAML +  KR +  T++WL VT  FG+ F+ +E+YEF H+I  
Sbjct: 72  LVAVNTAMLLMSSITYGFAML-TMEKRQVGATLAWLGVTGLFGLAFLGIELYEFHHMIHE 130

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
            A PQRSAFLSSFF LVG HGLHV FG+IWL  L++Q+ + GLI  N+RRL+CLSMFWHF
Sbjct: 131 GATPQRSAFLSSFFTLVGTHGLHVTFGIIWLVTLMVQVARAGLIEANRRRLMCLSMFWHF 190

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD++WI VF+FVYL+G +
Sbjct: 191 LDVVWIGVFTFVYLLGTL 208


>gi|239817018|ref|YP_002945928.1| cytochrome o ubiquinol oxidase subunit III [Variovorax paradoxus
           S110]
 gi|239803595|gb|ACS20662.1| cytochrome o ubiquinol oxidase, subunit III [Variovorax paradoxus
           S110]
          Length = 221

 Score =  235 bits (600), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 149/205 (72%), Gaps = 4/205 (1%)

Query: 4   QKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGP 63
              GK P F LF+V +        +GT LGFW+YLMSDCL+FA  F  Y VLG++YAAGP
Sbjct: 18  DATGKPPVFELFHVGNDHHP---ENGTLLGFWLYLMSDCLVFACLFAVYGVLGRSYAAGP 74

Query: 64  APIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEI 123
           +  D+FD+  + V+T +LLLSS++  FA+L    KR+   T++WL +T   G  FI +E+
Sbjct: 75  SGADLFDLPLVAVNTSLLLLSSITYGFAVLEMQRKRM-GGTLAWLAITGLLGAGFIGLEL 133

Query: 124 YEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRL 183
           YEFAHLI   A PQRSAFLSSFFALVG HGLHV FG++WL VL+IQ+ K G  + N+RRL
Sbjct: 134 YEFAHLIHEGAGPQRSAFLSSFFALVGTHGLHVTFGIVWLIVLMIQLPKHGFTAANRRRL 193

Query: 184 ICLSMFWHFLDLIWICVFSFVYLMG 208
           +CLSMFWHFLD++WI VF+FVYLMG
Sbjct: 194 MCLSMFWHFLDVVWIGVFTFVYLMG 218


>gi|15887495|ref|NP_353176.1| cytochrome o ubiquinol oxidase subunit III [Agrobacterium
           tumefaciens str. C58]
 gi|15155018|gb|AAK85961.1| cytochrome o ubiquinol oxidase subunit III [Agrobacterium
           tumefaciens str. C58]
          Length = 208

 Score =  235 bits (600), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 118/204 (57%), Positives = 152/204 (74%), Gaps = 6/204 (2%)

Query: 7   GKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI 66
           G  P   +FY+K+        +GT +GFW+YLMSDCL+FAV F TYAVLG++YAAGP+  
Sbjct: 11  GAEP--PVFYLKEDHHP---ENGTSIGFWLYLMSDCLIFAVLFATYAVLGRSYAAGPSGA 65

Query: 67  DVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEF 126
           D+FD+  + ++T  LLLSS++  FAML    K+ +  T+ WL +T  FG+ F+ +E+YEF
Sbjct: 66  DLFDLKLVAINTGFLLLSSITYGFAML-EMEKQKVKSTLIWLGITGLFGLAFLAVELYEF 124

Query: 127 AHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
            HLI   A PQRSAFLS+FFALVG HGLHV FG IWL  L++Q+ K GLI+ N+RRL+CL
Sbjct: 125 HHLIEEGAGPQRSAFLSAFFALVGTHGLHVTFGTIWLVTLMVQVAKHGLIAANKRRLMCL 184

Query: 187 SMFWHFLDLIWICVFSFVYLMGVV 210
           SMFWHFLD+IWI VFSFVYLMGV+
Sbjct: 185 SMFWHFLDVIWIGVFSFVYLMGVL 208


>gi|325291582|ref|YP_004277446.1| cytochrome ubiquinol oxidase subunit III [Agrobacterium sp. H13-3]
 gi|325059435|gb|ADY63126.1| cytochrome ubiquinol oxidase subunit III [Agrobacterium sp. H13-3]
          Length = 208

 Score =  234 bits (597), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 148/197 (75%), Gaps = 4/197 (2%)

Query: 14  LFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISG 73
           +FY+K+        +GT LGFW+YLMSDCL+FA  F TYAV+G+NYAAGP+  D+FD+  
Sbjct: 16  VFYLKEDHHP---ENGTSLGFWLYLMSDCLIFATLFATYAVVGRNYAAGPSGADLFDLKL 72

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           + ++T  LL SS++  FAML    K+ +  T+ WL +T  FG+ F+ +E+YEF HLI   
Sbjct: 73  VAINTAFLLFSSITYGFAML-EMEKQKVKTTLIWLGITGLFGLAFLAVELYEFHHLIEEG 131

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
           A PQRSAFLS+FFALVG HGLHV FG+IWL  L+ Q+ K GLI+ N+RRL+CLSMFWHFL
Sbjct: 132 AGPQRSAFLSAFFALVGTHGLHVTFGVIWLVTLMFQVAKHGLIAANKRRLMCLSMFWHFL 191

Query: 194 DLIWICVFSFVYLMGVV 210
           D+IWI VFSFVYLMGV+
Sbjct: 192 DVIWIGVFSFVYLMGVL 208


>gi|148253543|ref|YP_001238128.1| cytochrome o ubiquinol oxidase subunit III [Bradyrhizobium sp.
           BTAi1]
 gi|146405716|gb|ABQ34222.1| cytochrome bo3 quinol oxidase subunit 3 [Bradyrhizobium sp. BTAi1]
          Length = 209

 Score =  234 bits (596), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 149/210 (70%), Gaps = 6/210 (2%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           M   K G+     +FYV D+ E   +   T LGFWIYLMSDCL+FA+ F  Y VLG  YA
Sbjct: 5   MGSMKAGEP----VFYVVDEHEHP-EGSSTMLGFWIYLMSDCLIFAILFAVYGVLGAKYA 59

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
           AGPAP D+FD+S + V+T  LLLSSL+  FAML+    R +    +WL +T  FG+ F+ 
Sbjct: 60  AGPAPKDLFDLSLVAVNTSFLLLSSLTYGFAMLSMQQNR-VGAMQAWLAITGLFGLAFLG 118

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           +E+ EFAH+I   A PQRSAFLSSFF LVG HGLHV FGLIWL  L++Q+   GLI  N+
Sbjct: 119 IELTEFAHMIHEGATPQRSAFLSSFFTLVGTHGLHVTFGLIWLVTLMVQVKTYGLIEANR 178

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RRL+CLSMFWHFLD+IWI VF+FVYLMG++
Sbjct: 179 RRLVCLSMFWHFLDVIWIGVFTFVYLMGML 208


>gi|91975077|ref|YP_567736.1| cytochrome c oxidase, subunit III [Rhodopseudomonas palustris
           BisB5]
 gi|91681533|gb|ABE37835.1| cytochrome c oxidase, subunit III [Rhodopseudomonas palustris
           BisB5]
          Length = 209

 Score =  234 bits (596), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 148/198 (74%), Gaps = 2/198 (1%)

Query: 13  SLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
            +F+V D+  +  +   T LGFW+YLMSDCL+FA+ F TY VLG NYAAGPAP D+FD+ 
Sbjct: 13  PVFHVVDE-HAHPEGASTMLGFWLYLMSDCLIFAILFATYGVLGANYAAGPAPKDLFDLK 71

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + V+T +LLLSS++  FAML  A  R +  T  WL +T  FG+ F+ +E+YEFAH+I  
Sbjct: 72  LVAVNTAMLLLSSITYGFAMLEMARAR-VGATQLWLGITGLFGLAFLGIELYEFAHMIHE 130

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
            A PQRSAFLSSFF LVG HGLHV FG++WL  L++Q+ + GLI  N+RRL+CLSMFWHF
Sbjct: 131 GATPQRSAFLSSFFTLVGTHGLHVTFGIVWLVTLMVQVARTGLIEANRRRLMCLSMFWHF 190

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD++WI VF+FVYL+G +
Sbjct: 191 LDVVWIGVFTFVYLLGTL 208


>gi|218532590|ref|YP_002423406.1| cytochrome o ubiquinol oxidase subunit III [Methylobacterium
           chloromethanicum CM4]
 gi|218524893|gb|ACK85478.1| cytochrome o ubiquinol oxidase, subunit III [Methylobacterium
           chloromethanicum CM4]
          Length = 215

 Score =  233 bits (595), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 121/209 (57%), Positives = 146/209 (69%), Gaps = 6/209 (2%)

Query: 2   SRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAA 61
            R      P+F     +   E      GT LGFWIYLMSDCL+FAV F TYAVLG++YAA
Sbjct: 12  DRMSGADVPDFLDLEGEHHPEG-----GTMLGFWIYLMSDCLIFAVLFATYAVLGRSYAA 66

Query: 62  GPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIM 121
           GP+P D+FD+  + V+T +LL SS++  FAMLA     L  KT  WL +T  FG  F+ +
Sbjct: 67  GPSPKDLFDLPIVAVNTSMLLFSSITYGFAMLAMEKDDLA-KTQLWLAITGLFGAAFVGL 125

Query: 122 EIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQR 181
           E+YEFAHLI   A PQRS FLS+FF LVG HGLHV FGLIWL  L+IQ   KGL+  N+R
Sbjct: 126 ELYEFAHLIHEGATPQRSGFLSAFFTLVGTHGLHVTFGLIWLVTLMIQTRLKGLVVENKR 185

Query: 182 RLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RL+CLSMFWHFLD+IWI VF+FVYLMGV+
Sbjct: 186 RLMCLSMFWHFLDVIWIGVFTFVYLMGVL 214


>gi|319795347|ref|YP_004156987.1| cytochrome o ubiquinol oxidase, subunit iii [Variovorax paradoxus
           EPS]
 gi|315597810|gb|ADU38876.1| cytochrome o ubiquinol oxidase, subunit III [Variovorax paradoxus
           EPS]
          Length = 221

 Score =  233 bits (594), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 116/205 (56%), Positives = 148/205 (72%), Gaps = 4/205 (1%)

Query: 4   QKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGP 63
            + GK P F LF+V +        +GT LGFW+YLMSDCL+FA  F  Y VLG++YAAGP
Sbjct: 18  DQTGKPPVFELFHVGNDHHP---ENGTLLGFWLYLMSDCLIFACLFAVYGVLGRSYAAGP 74

Query: 64  APIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEI 123
           +  D+FD+  + ++T +LLLSS++  FAML    KR+    + WL +T   G  FI +E+
Sbjct: 75  SGADLFDLPLVAINTSLLLLSSITYGFAMLEMQKKRM-GGVLVWLAITGLLGAGFIGLEL 133

Query: 124 YEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRL 183
           YEFAHL+   A PQRSAFLSSFFALVG HGLHV FG+IWL VL+IQ+ K G  + N+RRL
Sbjct: 134 YEFAHLLHEGAGPQRSAFLSSFFALVGTHGLHVSFGIIWLIVLMIQLPKHGFTAANRRRL 193

Query: 184 ICLSMFWHFLDLIWICVFSFVYLMG 208
           +CLSMFWHFLD++WI VF+FVYLMG
Sbjct: 194 MCLSMFWHFLDVVWIGVFTFVYLMG 218


>gi|188584038|ref|YP_001927483.1| cytochrome o ubiquinol oxidase, subunit III [Methylobacterium
           populi BJ001]
 gi|179347536|gb|ACB82948.1| cytochrome o ubiquinol oxidase, subunit III [Methylobacterium
           populi BJ001]
          Length = 215

 Score =  233 bits (593), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 147/209 (70%), Gaps = 6/209 (2%)

Query: 2   SRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAA 61
            R     +PNF     +   E       T LGFWIYLMSDCL+FAV F TYAVLG++YAA
Sbjct: 12  ERMSDADAPNFLDLEGEHHPEGS-----TMLGFWIYLMSDCLIFAVLFATYAVLGRSYAA 66

Query: 62  GPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIM 121
           GP+P D+FD+  + V+T +LL SS++  FAMLA   K  + KT  WL VT  FG  F+ +
Sbjct: 67  GPSPKDLFDLPIVAVNTSMLLFSSITYGFAMLA-MEKDDLSKTQLWLAVTGLFGAAFVGL 125

Query: 122 EIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQR 181
           E++EF+HLI   A PQRS FLS+FF LVG HGLHV FGLIWL  L++Q   KGLI  N+R
Sbjct: 126 ELWEFSHLIHEGATPQRSGFLSAFFTLVGTHGLHVTFGLIWLVTLMVQTRWKGLIPENKR 185

Query: 182 RLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RL+CLSMFWHFLD+IWI VF+FVYLMGV+
Sbjct: 186 RLMCLSMFWHFLDVIWIGVFTFVYLMGVL 214


>gi|163853732|ref|YP_001641775.1| cytochrome o ubiquinol oxidase, subunit III [Methylobacterium
           extorquens PA1]
 gi|240141157|ref|YP_002965637.1| cytochrome o ubiquinol oxidase, subunit III [Methylobacterium
           extorquens AM1]
 gi|163665337|gb|ABY32704.1| cytochrome o ubiquinol oxidase, subunit III [Methylobacterium
           extorquens PA1]
 gi|240011134|gb|ACS42360.1| cytochrome o ubiquinol oxidase, subunit III [Methylobacterium
           extorquens AM1]
          Length = 215

 Score =  233 bits (593), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 121/209 (57%), Positives = 146/209 (69%), Gaps = 6/209 (2%)

Query: 2   SRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAA 61
            R      P+F     +   E      GT LGFWIYLMSDCL+FAV F TYAVLG++YAA
Sbjct: 12  DRMSGADVPDFLDLEGEHHPEG-----GTMLGFWIYLMSDCLIFAVLFATYAVLGRSYAA 66

Query: 62  GPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIM 121
           GP+P D+FD+  + V+T +LL SS++  FAMLA     L  KT  WL +T  FG  F+ +
Sbjct: 67  GPSPKDLFDLPIVAVNTSMLLFSSITYGFAMLAMEKDDLA-KTQLWLAITGLFGAAFVGL 125

Query: 122 EIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQR 181
           E+YEFAHLI   A PQRS FLS+FF LVG HGLHV FGLIWL  L+IQ   KGL + N+R
Sbjct: 126 ELYEFAHLIHEGATPQRSGFLSAFFTLVGTHGLHVTFGLIWLVTLMIQTRLKGLGAENKR 185

Query: 182 RLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RL+CLSMFWHFLD+IWI VF+FVYLMGV+
Sbjct: 186 RLMCLSMFWHFLDVIWIGVFTFVYLMGVL 214


>gi|13475708|ref|NP_107275.1| cytochrome o ubiquinol oxidase subunit III [Mesorhizobium loti
           MAFF303099]
 gi|14026464|dbj|BAB53061.1| cytochrome o ubiquinol oxidase subunit III [Mesorhizobium loti
           MAFF303099]
          Length = 208

 Score =  233 bits (593), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 147/204 (72%), Gaps = 5/204 (2%)

Query: 7   GKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI 66
           G  P F L    +++    +   T LGFW+YLMSDCL+FA+ F  Y VLG NYAAGPAP 
Sbjct: 9   GTEPVFHL----EEEHVHAEGSSTMLGFWLYLMSDCLIFAMLFAAYGVLGANYAAGPAPK 64

Query: 67  DVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEF 126
           D+FD+  + V+T +LLLSS++  FAML     R +  T +WL VT  FG+ F+ +E+YEF
Sbjct: 65  DLFDLDLVAVNTTMLLLSSITYGFAMLTMDKGR-VAATQAWLAVTGLFGLAFLSIELYEF 123

Query: 127 AHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
           AH+I   A PQRSAFLSSFF LVG HGLHV FG++WL  L+ Q+ + GLI  N+RR++CL
Sbjct: 124 AHMIHEGATPQRSAFLSSFFTLVGTHGLHVTFGIVWLVTLMTQVARFGLIEANRRRVMCL 183

Query: 187 SMFWHFLDLIWICVFSFVYLMGVV 210
           SMFWHFLD++WI VF+FVYLMG++
Sbjct: 184 SMFWHFLDVVWIGVFTFVYLMGML 207


>gi|311108525|ref|YP_003981378.1| cytochrome O ubiquinol oxidase subunit III 2 [Achromobacter
           xylosoxidans A8]
 gi|310763214|gb|ADP18663.1| cytochrome O ubiquinol oxidase, subunit III 2 [Achromobacter
           xylosoxidans A8]
          Length = 213

 Score =  232 bits (592), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 145/203 (71%), Gaps = 4/203 (1%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPID 67
             P   +FYV  +       +GT LGFW+YLMSDCL+FA  F TY VLG+NYAAGP+  D
Sbjct: 14  APPAEPVFYVAGEHHP---KNGTLLGFWVYLMSDCLIFACLFATYGVLGRNYAAGPSGAD 70

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
           +FD+  + V+T +LLLSS++  FAML     R +  T  WL VT   G+ F+ +E+YEFA
Sbjct: 71  LFDLPLVAVNTALLLLSSITYGFAMLEMRRNR-VGATQLWLAVTGILGLGFLSLELYEFA 129

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
           HLI   A PQRSAFLSSFF LVG HGLHV FG++WL  ++IQ+   GLI  N+RRL+CLS
Sbjct: 130 HLIHQGAGPQRSAFLSSFFTLVGTHGLHVTFGIVWLVTMMIQVQMHGLIPENRRRLMCLS 189

Query: 188 MFWHFLDLIWICVFSFVYLMGVV 210
           MFWHFLDLIW+ VF+FVYLMGV+
Sbjct: 190 MFWHFLDLIWVGVFTFVYLMGVL 212


>gi|146338787|ref|YP_001203835.1| cytochrome o ubiquinol oxidase subunit III [Bradyrhizobium sp.
           ORS278]
 gi|146191593|emb|CAL75598.1| Cytochrome o ubiquinol oxidase subunit III (Ubiquinol oxidase chain
           C) [Bradyrhizobium sp. ORS278]
          Length = 209

 Score =  231 bits (589), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 146/197 (74%), Gaps = 2/197 (1%)

Query: 14  LFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISG 73
           +FYV D+ +   +   T LGFWIYLMSDCL+FA+ F  Y VLG  YAAGPAP D+FD+S 
Sbjct: 14  VFYVVDEHDHP-EGSSTQLGFWIYLMSDCLIFAILFAVYGVLGTKYAAGPAPKDLFDLSL 72

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           + ++T  LLLSSL+  FAML+    R +     WL+VT  FG+ F+ +E+ EFAH+I   
Sbjct: 73  VALNTSFLLLSSLTYGFAMLSMQQNR-VGAMQGWLVVTGLFGLAFLGIELTEFAHMIHEG 131

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
           A PQRSAFLSSFF LVG HGLHV FGL+WL  L++Q+ + GLI  N+RRL+CLSMFWHFL
Sbjct: 132 ATPQRSAFLSSFFTLVGTHGLHVTFGLVWLVTLMVQVKRFGLIEANRRRLVCLSMFWHFL 191

Query: 194 DLIWICVFSFVYLMGVV 210
           D+IWI VF+FVYLMG++
Sbjct: 192 DVIWIGVFTFVYLMGML 208


>gi|307293186|ref|ZP_07573032.1| cytochrome o ubiquinol oxidase, subunit III [Sphingobium
           chlorophenolicum L-1]
 gi|306881252|gb|EFN12468.1| cytochrome o ubiquinol oxidase, subunit III [Sphingobium
           chlorophenolicum L-1]
          Length = 207

 Score =  231 bits (589), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 115/186 (61%), Positives = 141/186 (75%), Gaps = 3/186 (1%)

Query: 27  HDG--TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLS 84
           H+G  T LGFW+YLMSDCL+FA+ F TYAVLG +YA GP P D+FD+  I ++T +LL S
Sbjct: 22  HEGHSTNLGFWMYLMSDCLIFAILFATYAVLGGSYAGGPGPKDLFDLPLIALNTAMLLFS 81

Query: 85  SLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSS 144
           S++  FAMLA    R +  T  WL VT  FG  F+ +E+YEF+HLI   A PQRSAFLSS
Sbjct: 82  SITYGFAMLAMEKNR-VSATQGWLFVTLLFGGAFLCIELYEFSHLIHEGAGPQRSAFLSS 140

Query: 145 FFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFV 204
           FF LVG HGLHV FG +WL  L++Q+ KKGLI  N+RRL+CLSMFWHFLD+IWI VF+FV
Sbjct: 141 FFTLVGTHGLHVTFGSVWLITLMVQVAKKGLIPANKRRLMCLSMFWHFLDVIWIGVFTFV 200

Query: 205 YLMGVV 210
           YLMGV+
Sbjct: 201 YLMGVL 206


>gi|254563669|ref|YP_003070764.1| cytochrome o ubiquinol oxidase subunit III [Methylobacterium
           extorquens DM4]
 gi|254270947|emb|CAX26952.1| cytochrome o ubiquinol oxidase, subunit III [Methylobacterium
           extorquens DM4]
          Length = 215

 Score =  230 bits (586), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 145/209 (69%), Gaps = 6/209 (2%)

Query: 2   SRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAA 61
            R      P+F     +   E      GT LGFWIYLMSDCL+FAV F TYAVLG++YAA
Sbjct: 12  DRMSGADVPDFLDLEGEHHPEG-----GTMLGFWIYLMSDCLIFAVLFATYAVLGRSYAA 66

Query: 62  GPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIM 121
           GP+P D+FD+  + V+T +LL SS++  FAMLA     L  KT  WL +T  FG  F+ +
Sbjct: 67  GPSPKDLFDLPIVAVNTSMLLFSSITYGFAMLAMEKDDLA-KTQLWLAITGLFGAAFVGL 125

Query: 122 EIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQR 181
           E+YEFAHLI   A PQRS FLS+FF LVG HGLHV FGLIWL  L+IQ   KGL+  N+ 
Sbjct: 126 ELYEFAHLIHEGATPQRSGFLSAFFTLVGTHGLHVTFGLIWLVTLMIQTRLKGLVVENKL 185

Query: 182 RLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RL+CLSMFWHFLD+IWI VF+FVYLMGV+
Sbjct: 186 RLMCLSMFWHFLDVIWIGVFTFVYLMGVL 214


>gi|222107118|ref|YP_002547909.1| cytochrome o ubiquinol oxidase subunit III [Agrobacterium vitis S4]
 gi|221738297|gb|ACM39193.1| cytochrome o ubiquinol oxidase subunit III [Agrobacterium vitis S4]
          Length = 205

 Score =  230 bits (586), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 115/196 (58%), Positives = 144/196 (73%), Gaps = 4/196 (2%)

Query: 15  FYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
           FY+ ++         T LGFW+YLMSDCL+FA+ F TYAVLG+NYAAGPAP D+FD+  +
Sbjct: 13  FYLTEEHHP---ESSTNLGFWLYLMSDCLIFAMLFATYAVLGRNYAAGPAPADLFDLKLV 69

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            ++T +LL SS++  FAML S  K     T+ WL VT  FG IF+ +E+YEF HLI   A
Sbjct: 70  AINTAMLLFSSITYGFAML-SMEKNNKAATLIWLGVTGVFGAIFLALELYEFVHLIHEGA 128

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            P RSAFLS+FF LVG HGLHV FG+IWL  L+ Q+ K GLI  N+RRL+CLSMFWHFLD
Sbjct: 129 GPNRSAFLSAFFTLVGTHGLHVTFGIIWLVTLMAQVGKHGLIEANRRRLMCLSMFWHFLD 188

Query: 195 LIWICVFSFVYLMGVV 210
           +IWI VFS+VYL+GV+
Sbjct: 189 VIWIGVFSYVYLLGVI 204


>gi|86360306|ref|YP_472194.1| cytochrome O ubiquinol oxidase, subunit III protein [Rhizobium etli
           CFN 42]
 gi|86284408|gb|ABC93467.1| cytochrome O ubiquinol oxidase, subunit III protein [Rhizobium etli
           CFN 42]
          Length = 206

 Score =  229 bits (584), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 115/210 (54%), Positives = 147/210 (70%), Gaps = 5/210 (2%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           MS Q I ++     +  +D          T LGFW+YLMSDCL+FAV F T+ VLG+NYA
Sbjct: 1   MSDQTIDRAEKPEFYLTEDHHPE----GSTNLGFWLYLMSDCLIFAVLFATHGVLGRNYA 56

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
           AGP+P D+FD+  + ++T +LLLSS++  FAML    +    +T+ WL VT  FG  FI 
Sbjct: 57  AGPSPADLFDLPIVALNTSMLLLSSITYGFAML-QMERNAKAETLFWLAVTGLFGAAFIG 115

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           +E+YEF HLI   A P RSAFLSSFF LVG HGLHV FG+IWL  L++Q+   GL+  N+
Sbjct: 116 LELYEFIHLIHEGAGPTRSAFLSSFFTLVGTHGLHVTFGIIWLITLMVQVSMHGLVEANR 175

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RRL+CLSMFWHFLD++WI VFSFVYL+GVV
Sbjct: 176 RRLMCLSMFWHFLDVVWIGVFSFVYLLGVV 205


>gi|330824828|ref|YP_004388131.1| cytochrome o ubiquinol oxidase subunit III [Alicycliphilus
           denitrificans K601]
 gi|329310200|gb|AEB84615.1| cytochrome o ubiquinol oxidase, subunit III [Alicycliphilus
           denitrificans K601]
          Length = 210

 Score =  229 bits (583), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 138/183 (75%), Gaps = 1/183 (0%)

Query: 28  DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
           +GT LGFW+YLMSDCL+FAV F TY VLG+NYA GP   ++FD+  + ++T  LLLSS++
Sbjct: 29  NGTSLGFWLYLMSDCLIFAVLFATYGVLGRNYAGGPTGAELFDLKLVAINTAFLLLSSIT 88

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
             FAML    +R +  T++WL VT   G+ F+ +E+YEFAHL+   A PQRSAFLSSFF 
Sbjct: 89  FGFAML-QKQQRDVRGTLAWLAVTGLLGLAFLAVELYEFAHLLHEGAGPQRSAFLSSFFT 147

Query: 148 LVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           LVG HGLHV FG IWL  L+IQI K GLI  N RRL CLSMFWHFLD++WI VF+FVYLM
Sbjct: 148 LVGTHGLHVTFGTIWLVTLMIQIGKHGLIPENARRLNCLSMFWHFLDVVWIGVFTFVYLM 207

Query: 208 GVV 210
           GV+
Sbjct: 208 GVL 210


>gi|326317720|ref|YP_004235392.1| cytochrome o ubiquinol oxidase subunit III [Acidovorax avenae
           subsp. avenae ATCC 19860]
 gi|323374556|gb|ADX46825.1| cytochrome o ubiquinol oxidase, subunit III [Acidovorax avenae
           subsp. avenae ATCC 19860]
          Length = 210

 Score =  229 bits (583), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 115/189 (60%), Positives = 141/189 (74%), Gaps = 1/189 (0%)

Query: 22  ESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVL 81
           E     +GT LGFW+YLMSDCL+FA  F TY VLG++YAAGP    +FD+S + ++T  L
Sbjct: 23  EEPHPENGTALGFWLYLMSDCLIFAALFATYGVLGRSYAAGPTGAQLFDLSLVAINTAFL 82

Query: 82  LLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAF 141
           LLSS++  FAML    K  +  T+ WL VT  FG+ F+ +E+YEF HLI   A PQRSAF
Sbjct: 83  LLSSITFGFAML-QKQKGNVGGTLGWLAVTGLFGLCFLGLELYEFHHLIHEGAGPQRSAF 141

Query: 142 LSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVF 201
           LS+FF LVG HGLHV FGLIWL VL+IQI K GLI  N+RRL+CLSMFWHFLD++WI VF
Sbjct: 142 LSAFFTLVGTHGLHVTFGLIWLVVLMIQISKHGLIHENKRRLMCLSMFWHFLDVVWIGVF 201

Query: 202 SFVYLMGVV 210
           +FVYLMGV+
Sbjct: 202 TFVYLMGVL 210


>gi|319762687|ref|YP_004126624.1| cytochrome o ubiquinol oxidase, subunit iii [Alicycliphilus
           denitrificans BC]
 gi|317117248|gb|ADU99736.1| cytochrome o ubiquinol oxidase, subunit III [Alicycliphilus
           denitrificans BC]
          Length = 210

 Score =  229 bits (583), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 138/183 (75%), Gaps = 1/183 (0%)

Query: 28  DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
           +GT LGFW+YLMSDCL+FAV F TY VLG+NYA GP   ++FD+  + ++T  LLLSS++
Sbjct: 29  NGTSLGFWLYLMSDCLIFAVLFATYGVLGRNYAGGPTGAELFDLKLVAINTAFLLLSSIT 88

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
             FAML    +R +  T++WL VT   G+ F+ +E+YEFAHL+   A PQRSAFLSSFF 
Sbjct: 89  FGFAML-QKQQRDVRGTLAWLAVTGLLGLAFLAVELYEFAHLLHEGAGPQRSAFLSSFFT 147

Query: 148 LVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           LVG HGLHV FG IWL  L+IQI K GLI  N RRL CLSMFWHFLD++WI VF+FVYLM
Sbjct: 148 LVGTHGLHVTFGTIWLVTLMIQIGKHGLIPENARRLNCLSMFWHFLDVVWIGVFTFVYLM 207

Query: 208 GVV 210
           GV+
Sbjct: 208 GVL 210


>gi|120610895|ref|YP_970573.1| cytochrome c oxidase subunit III [Acidovorax citrulli AAC00-1]
 gi|120589359|gb|ABM32799.1| cytochrome bo3 quinol oxidase subunit 3 [Acidovorax citrulli
           AAC00-1]
          Length = 210

 Score =  228 bits (582), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 113/189 (59%), Positives = 141/189 (74%), Gaps = 1/189 (0%)

Query: 22  ESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVL 81
           E     +GT LGFW+YLMSDCL+FA  F TY VLG++YAAGP    +FD++ + ++T  L
Sbjct: 23  EEPHPENGTALGFWLYLMSDCLIFAALFATYGVLGRSYAAGPTGAQLFDLTLVAINTAFL 82

Query: 82  LLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAF 141
           LLSS++  FAML    K  +  T+ WL +T  FG+ F+ +E+YEF HLI   A PQRSAF
Sbjct: 83  LLSSITFGFAML-QKQKGNVRGTLGWLAITGLFGLCFLGLELYEFHHLIHQGAGPQRSAF 141

Query: 142 LSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVF 201
           LS+FF LVG HGLHV FGLIWL VL+IQI K GLI  N+RRL+CLSMFWHFLD++WI VF
Sbjct: 142 LSAFFTLVGTHGLHVTFGLIWLVVLMIQIGKHGLIHENKRRLMCLSMFWHFLDVVWIGVF 201

Query: 202 SFVYLMGVV 210
           +FVYLMGV+
Sbjct: 202 TFVYLMGVL 210


>gi|209546367|ref|YP_002278257.1| cytochrome o ubiquinol oxidase, subunit III [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209539224|gb|ACI59157.1| cytochrome o ubiquinol oxidase, subunit III [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 208

 Score =  228 bits (581), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 115/210 (54%), Positives = 146/210 (69%), Gaps = 5/210 (2%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           MS Q I  S     +  +D        + T LGFW+YLMSDCL+FAV F T+ VLG+NYA
Sbjct: 3   MSDQTIDTSEKPEFYLTEDHHPE----NSTNLGFWLYLMSDCLIFAVLFATHGVLGRNYA 58

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
           AGP+P D+FD+  + ++T +LLLSS++  FAML    +    +T+ WL VT  FG  FI 
Sbjct: 59  AGPSPADLFDLPIVALNTSMLLLSSITYGFAML-QMERNAKAETLFWLAVTGLFGAAFIG 117

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           +E+YEF HLI   A P RSAFLSSFF LVG HGLHV FG+IWL  L++Q+   GL   N+
Sbjct: 118 LELYEFIHLIHEGAGPTRSAFLSSFFTLVGTHGLHVTFGIIWLITLMVQVSMHGLAEANR 177

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RRL+CLSMFWHFLD++WI VFSFVYL+GV+
Sbjct: 178 RRLMCLSMFWHFLDVVWIGVFSFVYLLGVL 207


>gi|222084385|ref|YP_002542914.1| cytochrome o ubiquinol oxidase, subunit III [Agrobacterium
           radiobacter K84]
 gi|221721833|gb|ACM24989.1| cytochrome o ubiquinol oxidase, subunit III [Agrobacterium
           radiobacter K84]
          Length = 209

 Score =  227 bits (579), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 117/206 (56%), Positives = 146/206 (70%), Gaps = 7/206 (3%)

Query: 5   KIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPA 64
           K G++P F L       E       T LGFWIY+MSDCL+FAV F TYAVLG NYAAGP+
Sbjct: 10  KDGETPAFYL------TEEHHPEGSTMLGFWIYIMSDCLIFAVLFATYAVLGHNYAAGPS 63

Query: 65  PIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIY 124
           P D+F++  + ++T +LL SS++  FAMLA   K     T+ WL +T  FG  FI  E+Y
Sbjct: 64  PADLFELPLVALNTAMLLFSSITYGFAMLA-MEKGNKSGTMMWLAITGLFGAAFIYFELY 122

Query: 125 EFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLI 184
           EF HLI   A PQRSAFLS+FFALVG HGLHV  G++WL  L++Q+ + GLI  N+RRL+
Sbjct: 123 EFYHLILEGAGPQRSAFLSAFFALVGTHGLHVTVGIVWLITLMVQVSQHGLIPENKRRLM 182

Query: 185 CLSMFWHFLDLIWICVFSFVYLMGVV 210
           CLSMFWHFLD++WI VFSFVYLMGV+
Sbjct: 183 CLSMFWHFLDVVWIGVFSFVYLMGVL 208


>gi|149926919|ref|ZP_01915178.1| cytochrome o ubiquinol oxidase, subunit III [Limnobacter sp.
           MED105]
 gi|149824471|gb|EDM83689.1| cytochrome o ubiquinol oxidase, subunit III [Limnobacter sp.
           MED105]
          Length = 207

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 111/196 (56%), Positives = 145/196 (73%), Gaps = 5/196 (2%)

Query: 15  FYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
           +YVKD        +G+ LGFWIYLMSDCL+FA  F TYAV+G+NYA GP   ++FD++ +
Sbjct: 16  YYVKDHHPK----NGSSLGFWIYLMSDCLIFACLFATYAVIGRNYAGGPTGAEIFDLNLV 71

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            ++T  LLLSS++   AM+     R + KT+ WL +T   G+ F+ +EIYEF H IS+ A
Sbjct: 72  ALNTAFLLLSSITYGVAMVG-MQNRNVKKTIQWLAITGVLGLAFLAVEIYEFWHFISIGA 130

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            PQ S FL++FFALVG HGLHVFFG+IWL VL+ Q+ K GLI  N+RR++CLSMFWHFLD
Sbjct: 131 TPQTSGFLTAFFALVGTHGLHVFFGIIWLVVLLFQLKKHGLIVENRRRVMCLSMFWHFLD 190

Query: 195 LIWICVFSFVYLMGVV 210
           +IWI VF+FVYLMGV+
Sbjct: 191 VIWIGVFTFVYLMGVL 206


>gi|116255240|ref|YP_771073.1| putative cytochrome o ubiquinol oxidase subunit III [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115259888|emb|CAK02982.1| putative cytochrome o ubiquinol oxidase subunit III [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 209

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 146/210 (69%), Gaps = 5/210 (2%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           MS Q I  +     +  +D        + T LGFW+YLMSDCL+FAV F T+ VLG+NYA
Sbjct: 4   MSDQTIDTAEKPEFYLTEDHHPE----NSTNLGFWLYLMSDCLIFAVLFATHGVLGRNYA 59

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
           AGP+P D+FD+  + ++T +LL SS++  FAML    +    +T+ WL VT  FG  FI 
Sbjct: 60  AGPSPADLFDLPIVALNTSMLLFSSITYGFAML-QMERNAKAETLFWLGVTGLFGAAFIG 118

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           +E+YEF HLI   A P RSAFLSSFF LVG HGLHV FG+IWL  L++Q+   GLI  N+
Sbjct: 119 LELYEFVHLIHEGAGPTRSAFLSSFFTLVGTHGLHVTFGIIWLITLMVQVSMHGLIEANR 178

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RRL+CLSMFWHFLD++WI VFSFVYL+GV+
Sbjct: 179 RRLMCLSMFWHFLDVVWIGVFSFVYLLGVL 208


>gi|294012086|ref|YP_003545546.1| cytochrome o ubiquinol oxidase subunit III [Sphingobium japonicum
           UT26S]
 gi|292675416|dbj|BAI96934.1| cytochrome o ubiquinol oxidase subunit III [Sphingobium japonicum
           UT26S]
          Length = 200

 Score =  226 bits (576), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 115/186 (61%), Positives = 139/186 (74%), Gaps = 3/186 (1%)

Query: 27  HDG--TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLS 84
           H+G  T LGFW+YLMSDCL+FA+ F TYAVLG +YA GP P D+FD+  I ++T +LL S
Sbjct: 15  HEGHSTMLGFWMYLMSDCLIFAILFATYAVLGGSYAGGPGPKDLFDLPLIALNTAMLLFS 74

Query: 85  SLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSS 144
           S++  FAMLA    R +  T  WL VT  FG  F+ +E+YEF+HLI   A P RSAFLSS
Sbjct: 75  SITYGFAMLAMEKNR-VSATQGWLFVTLLFGGAFLFIELYEFSHLIHEGAGPWRSAFLSS 133

Query: 145 FFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFV 204
           FF LVG HGLHV FG IWL  L+ Q+ KKGLI  N+RRL+CLSMFWHFLD+IWI VF+FV
Sbjct: 134 FFTLVGTHGLHVTFGSIWLVTLMAQVAKKGLIPANKRRLLCLSMFWHFLDVIWIGVFTFV 193

Query: 205 YLMGVV 210
           YLMGV+
Sbjct: 194 YLMGVL 199


>gi|222111441|ref|YP_002553705.1| cytochrome o ubiquinol oxidase subunit III [Acidovorax ebreus TPSY]
 gi|221730885|gb|ACM33705.1| cytochrome o ubiquinol oxidase, subunit III [Acidovorax ebreus
           TPSY]
          Length = 211

 Score =  226 bits (576), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 111/183 (60%), Positives = 136/183 (74%), Gaps = 1/183 (0%)

Query: 28  DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
           +GT LGFW+YLMSDCL+FA  F TY VLG++YAAGP    +FD+S + ++T  LL SS++
Sbjct: 30  NGTSLGFWLYLMSDCLIFAALFATYGVLGRSYAAGPTGAQLFDLSLVAINTAFLLTSSIT 89

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
             FAML          T++WL VT   G+ F+ +E+YEFAHLI   A PQRSAFLS+FF 
Sbjct: 90  FGFAMLQKQAGN-ARGTLAWLAVTGLLGLAFLGVELYEFAHLIHQGATPQRSAFLSAFFT 148

Query: 148 LVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           LVG HGLHV FGLIWL  L+IQI K GLI  N+RRL CLSMFWHFLD++WI VF+FVYLM
Sbjct: 149 LVGTHGLHVTFGLIWLVTLMIQISKHGLIHENKRRLNCLSMFWHFLDVVWIGVFTFVYLM 208

Query: 208 GVV 210
           GV+
Sbjct: 209 GVL 211


>gi|152980608|ref|YP_001354328.1| cytochrome o ubiquinol oxidase subunit III [Janthinobacterium sp.
           Marseille]
 gi|151280685|gb|ABR89095.1| cytochrome o ubiquinol oxidase subunit III [Janthinobacterium sp.
           Marseille]
          Length = 210

 Score =  226 bits (576), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 142/196 (72%), Gaps = 5/196 (2%)

Query: 15  FYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
           +YV++        +GT LGFW+YLMSDCL+FA  F TYAVLG+NYA GP   ++FD+  +
Sbjct: 19  YYVQEHHPE----NGTLLGFWLYLMSDCLIFACLFATYAVLGRNYAGGPTGAELFDLPLV 74

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
             +T  LLLSS++  FAML +  KRL   T+ WL +T   G  F+ +E+YEF+HLI   A
Sbjct: 75  AANTAFLLLSSITYGFAMLEAQRKRL-KATMIWLAITGLLGAAFLALELYEFSHLIHEGA 133

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            PQRSAFL+SFFALV  HGLHV FG+IWL  L+ Q+ + GLI  N RRL+CLSMFWHFLD
Sbjct: 134 GPQRSAFLTSFFALVATHGLHVTFGIIWLITLMFQLKRHGLIPENGRRLMCLSMFWHFLD 193

Query: 195 LIWICVFSFVYLMGVV 210
           +IWI VF+FVYLMGV+
Sbjct: 194 VIWIGVFTFVYLMGVL 209


>gi|241667023|ref|YP_002985107.1| cytochrome o ubiquinol oxidase, subunit III [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240862480|gb|ACS60145.1| cytochrome o ubiquinol oxidase, subunit III [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 208

 Score =  226 bits (576), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 146/210 (69%), Gaps = 5/210 (2%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           MS Q I  +     +  +D        + T LGFW+YLMSDCL+FAV F T+ VLG+NYA
Sbjct: 3   MSDQTIDTAEKPEFYLTEDHHPE----NSTNLGFWLYLMSDCLIFAVLFATHGVLGRNYA 58

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
           AGP+P D+FD+  + ++T +LL SS++  FAML    +    +T+ WL VT  FG  FI 
Sbjct: 59  AGPSPADLFDLPIVALNTSMLLFSSITYGFAML-QMERNAKAETLFWLGVTGLFGAAFIG 117

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           +E+YEF HLI   A P RSAFLSSFF LVG HGLHV FG+IWL  L++Q+   GLI  N+
Sbjct: 118 LELYEFIHLIHEGAGPTRSAFLSSFFTLVGTHGLHVTFGIIWLITLMVQVSMHGLIEANR 177

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RRL+CLSMFWHFLD++WI VFSFVYL+GV+
Sbjct: 178 RRLMCLSMFWHFLDVVWIGVFSFVYLLGVL 207


>gi|327188657|gb|EGE55863.1| cytochrome O ubiquinol oxidase protein, subunit III [Rhizobium etli
           CNPAF512]
          Length = 206

 Score =  226 bits (575), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 113/210 (53%), Positives = 145/210 (69%), Gaps = 5/210 (2%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           MS   +  +     +  +D        + T LGFW+YLMSDCL+FAV F T+ VLG+NYA
Sbjct: 1   MSDHTVDTAEKPEFYLTEDHHPE----NSTNLGFWLYLMSDCLIFAVLFATHGVLGRNYA 56

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
           AGP+P D+FD+  + ++T +LL SS++  FAML    +    +T+ WL VT  FG  FI 
Sbjct: 57  AGPSPADLFDLPIVALNTSMLLFSSITYGFAML-QMERNAKAETLFWLAVTGLFGAAFIG 115

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           +E+YEF HLI   A P RSAFLSSFF LVG HGLHV FG+IWL  L++Q+   GLI  N+
Sbjct: 116 LELYEFIHLIHEGAGPTRSAFLSSFFTLVGTHGLHVTFGIIWLITLMVQVSMHGLIEANR 175

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RRL+CLSMFWHFLD++WI VFSFVYL+GVV
Sbjct: 176 RRLMCLSMFWHFLDVVWIGVFSFVYLLGVV 205


>gi|158423724|ref|YP_001525016.1| cytochrome o ubiquinol oxidase subunit III [Azorhizobium
           caulinodans ORS 571]
 gi|158330613|dbj|BAF88098.1| cytochrome o ubiquinol oxidase subunit III [Azorhizobium
           caulinodans ORS 571]
          Length = 208

 Score =  226 bits (575), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 112/198 (56%), Positives = 145/198 (73%), Gaps = 2/198 (1%)

Query: 13  SLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
            +FY  D+      H  T LGFWIYLMSDCL+FA+ F T+ VLG NYAAGP P D+FD+ 
Sbjct: 12  PVFYEVDEHAHPEGHS-TALGFWIYLMSDCLIFAMLFATFGVLGGNYAAGPGPKDLFDLK 70

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + V+T +LL SS++  FAMLA    R     + WL +TA FG+ F+ +E+YEF H+I  
Sbjct: 71  LVAVNTAMLLFSSITYGFAMLAMEKGRQSQVQL-WLAITALFGLAFLSIELYEFHHMIHE 129

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
            A PQRSAFLS+FF LVG HG+HV FGLIWL  +++Q+ + GLI+ N+RRL+CLSMFWHF
Sbjct: 130 GAGPQRSAFLSAFFTLVGTHGVHVTFGLIWLVTMMVQVGRFGLITANRRRLMCLSMFWHF 189

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD+IWI VF+FVYLMG++
Sbjct: 190 LDVIWIGVFTFVYLMGML 207


>gi|121595098|ref|YP_986994.1| cytochrome c oxidase subunit III [Acidovorax sp. JS42]
 gi|120607178|gb|ABM42918.1| cytochrome bo3 quinol oxidase subunit 3 [Acidovorax sp. JS42]
          Length = 211

 Score =  225 bits (574), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 109/183 (59%), Positives = 138/183 (75%), Gaps = 1/183 (0%)

Query: 28  DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
           +GT LGFW+YLMSDCL+FA  F TY VLG++YAAGP    +FD++ + ++T  LL SS++
Sbjct: 30  NGTSLGFWLYLMSDCLIFAALFATYGVLGRSYAAGPTGAQLFDLTLVAINTAFLLTSSIT 89

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
             FAML       +  T++WL VT   G+ F+ +E+YEFAH+I + A PQRSAFLSSFF 
Sbjct: 90  FGFAMLQKQAGN-VRGTLTWLAVTGLLGLAFLGVELYEFAHMIHLGATPQRSAFLSSFFT 148

Query: 148 LVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           LVG HGLHV FGLIWL  L++QI K GLI  N+RRL CLSMFWHFLD++WI VF+FVYLM
Sbjct: 149 LVGTHGLHVTFGLIWLVTLMLQISKHGLIHENKRRLNCLSMFWHFLDVVWIGVFTFVYLM 208

Query: 208 GVV 210
           GV+
Sbjct: 209 GVL 211


>gi|194292956|ref|YP_002008863.1| cytochrome o ubiquinol oxidase, subunit iii [Cupriavidus
           taiwanensis LMG 19424]
 gi|193226860|emb|CAQ72811.1| cytochrome o ubiquinol oxidase, subunit III [Cupriavidus
           taiwanensis LMG 19424]
          Length = 224

 Score =  225 bits (573), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 143/207 (69%), Gaps = 4/207 (1%)

Query: 4   QKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGP 63
           Q     P    FY+ ++       +GT LGFW+YLMSDCL+FA  F  Y VLG+NYA GP
Sbjct: 21  QHAPAQPAALRFYMTEEYHVP---NGTLLGFWLYLMSDCLVFACLFAAYGVLGRNYAGGP 77

Query: 64  APIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEI 123
           +  ++FD+  + ++T  LLLSS++  FAML +   RL   T  WL VT   G  F+ +EI
Sbjct: 78  SGAELFDLPLVALNTSFLLLSSITYGFAMLEAQRGRL-GPTQGWLAVTGLLGAAFLAVEI 136

Query: 124 YEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRL 183
           YEFAHL+   A PQRS FL+SFFALVG HGLHV FG++WL  LV Q+ + GLI  N+RRL
Sbjct: 137 YEFAHLVGEGAGPQRSGFLTSFFALVGTHGLHVTFGIVWLVTLVSQLRRHGLIPENRRRL 196

Query: 184 ICLSMFWHFLDLIWICVFSFVYLMGVV 210
           +CLSMFWHFLD++WI VF+FVYLMGV+
Sbjct: 197 MCLSMFWHFLDVVWIGVFTFVYLMGVL 223


>gi|160899493|ref|YP_001565075.1| cytochrome o ubiquinol oxidase subunit III [Delftia acidovorans
           SPH-1]
 gi|160365077|gb|ABX36690.1| cytochrome o ubiquinol oxidase, subunit III [Delftia acidovorans
           SPH-1]
          Length = 210

 Score =  225 bits (573), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 137/189 (72%), Gaps = 1/189 (0%)

Query: 22  ESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVL 81
           E     +GT LGFW+YLMSDCL+FA  F TY VLG+NYAAGP    +FD+  + ++T  L
Sbjct: 23  EEPHPENGTALGFWLYLMSDCLIFAALFATYGVLGRNYAAGPTGAQLFDLPLVAMNTAFL 82

Query: 82  LLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAF 141
           LLSS++  FAML     +L   T  WL +T  FG+ F+ +E+YEF+HL+   A PQRSAF
Sbjct: 83  LLSSITFGFAMLQKQQGKL-GGTQLWLAITGLFGLCFLGLELYEFSHLLHEGAGPQRSAF 141

Query: 142 LSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVF 201
           LSSFF LVG HGLHV FGLIWL  L+IQI K GL   N RRL+CLSMFWHFLD++WI VF
Sbjct: 142 LSSFFTLVGTHGLHVSFGLIWLVTLMIQINKHGLTHENNRRLMCLSMFWHFLDVVWIGVF 201

Query: 202 SFVYLMGVV 210
           +FVYLMGV+
Sbjct: 202 TFVYLMGVL 210


>gi|119387828|ref|YP_918862.1| cytochrome c oxidase, subunit III [Paracoccus denitrificans PD1222]
 gi|461329|emb|CAA55034.1| cytochrome ba(3) [Paracoccus denitrificans]
 gi|119378403|gb|ABL73166.1| cytochrome ba3 quinol oxidase subunit 3 [Paracoccus denitrificans
           PD1222]
          Length = 205

 Score =  225 bits (573), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 138/181 (76%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T LGFW+YLMSDCLMFAV F  Y VLG ++AAGP P D+FD+  + V+T +LLLSS++  
Sbjct: 26  TSLGFWVYLMSDCLMFAVLFAVYGVLGTSFAAGPGPKDLFDLELVAVNTAMLLLSSITFG 85

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAMLA   K     T+ WL VT FFG+ F+ +E+YEF HLI + A PQRS FLS+FF LV
Sbjct: 86  FAMLAMG-KGDQRGTLRWLAVTLFFGLCFLAIELYEFHHLIHIGAGPQRSGFLSAFFTLV 144

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV FG IWL  L++QI + GLI  NQRR++CLSMFWHFLD+IWI VF+FVYL+G+
Sbjct: 145 GTHGLHVTFGSIWLVTLMVQITRTGLIPANQRRMVCLSMFWHFLDVIWIGVFTFVYLLGM 204

Query: 210 V 210
           +
Sbjct: 205 I 205


>gi|27375262|ref|NP_766791.1| cytochrome O ubiquinol oxidase subunit III [Bradyrhizobium
           japonicum USDA 110]
 gi|27348398|dbj|BAC45416.1| cytochrome O ubiquinol oxidase subunit III [Bradyrhizobium
           japonicum USDA 110]
          Length = 209

 Score =  224 bits (571), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 144/198 (72%), Gaps = 2/198 (1%)

Query: 13  SLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
            +FY+ D+      +  T LGFWIYLMSDCL+FA+ F  + VLG NYAAGPAP D+FD+ 
Sbjct: 13  PVFYLADEHPHPEGYS-TSLGFWIYLMSDCLIFAMLFAAFGVLGANYAAGPAPKDLFDLD 71

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + V+T +LLLSS++  FAML     + I +T  WL +T  FG  FI +E+ EFAH+I  
Sbjct: 72  LVAVNTSMLLLSSITYGFAMLTMQQNK-IAQTQMWLAITGLFGAAFIGIELTEFAHMIHE 130

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
            A PQRSAFLS+FF LVG HGLHV  GLIWL  L++Q+ K GLI  N+RRL+CLSMFWHF
Sbjct: 131 GATPQRSAFLSAFFTLVGTHGLHVSCGLIWLVTLMVQVWKFGLIEANRRRLMCLSMFWHF 190

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD++WI VF+FVYL+GV+
Sbjct: 191 LDVVWIGVFTFVYLLGVL 208


>gi|293607336|ref|ZP_06689675.1| quinol oxidase subunit III [Achromobacter piechaudii ATCC 43553]
 gi|292814180|gb|EFF73322.1| quinol oxidase subunit III [Achromobacter piechaudii ATCC 43553]
          Length = 213

 Score =  224 bits (571), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 117/207 (56%), Positives = 146/207 (70%), Gaps = 4/207 (1%)

Query: 4   QKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGP 63
           Q     P   +FYV  +       +GT LGFW+YLMSDCL+FA  F TY VLG++YAAGP
Sbjct: 10  QGGATPPTEPVFYVPGEHHP---KNGTLLGFWVYLMSDCLIFACLFATYGVLGRSYAAGP 66

Query: 64  APIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEI 123
           +  D+FD+  + V+T +LLLSS++  FAML     R I  T  WL VT   G+ F+ +EI
Sbjct: 67  SGADLFDLPLVAVNTSLLLLSSITYGFAMLEMRRNR-IGATQLWLAVTGLLGLGFLSLEI 125

Query: 124 YEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRL 183
           YEFAHLI   A PQRSAFLS+FF LVG HGLHV FG++WL  ++IQ+   GLI  N+RRL
Sbjct: 126 YEFAHLIHQGAGPQRSAFLSAFFTLVGTHGLHVTFGIVWLVTMMIQVQMHGLIPENRRRL 185

Query: 184 ICLSMFWHFLDLIWICVFSFVYLMGVV 210
           +CLSMFWHFLDLIW+ VF+FVYLMGV+
Sbjct: 186 MCLSMFWHFLDLIWVGVFTFVYLMGVL 212


>gi|288962726|ref|YP_003453020.1| cytochrome o ubiquinol oxidase subunit III [Azospirillum sp. B510]
 gi|288914992|dbj|BAI76476.1| cytochrome o ubiquinol oxidase subunit III [Azospirillum sp. B510]
          Length = 212

 Score =  224 bits (571), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 113/200 (56%), Positives = 146/200 (73%), Gaps = 7/200 (3%)

Query: 13  SLFYVKDKKESCVDHDG--TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFD 70
            +F+VKD+      H+G  T LGFWIYLMSDCL+FAV F TY VLG +YA GP P ++FD
Sbjct: 17  PVFHVKDEHA----HEGASTALGFWIYLMSDCLIFAVLFATYGVLGTSYAGGPTPKELFD 72

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
           +  + ++T +LL SS++  FAMLA    R   +T  WL +T  FG+ F+ +E++EFAHLI
Sbjct: 73  LKLVALNTSMLLFSSITYGFAMLAMEKGR-TGQTQGWLFITLLFGLAFLGIELFEFAHLI 131

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
              A P RSAFLSSFF LVG HGLHV FG +WL  L+IQ+ ++GLI  N+RRL+CLSMFW
Sbjct: 132 HEGAGPWRSAFLSSFFTLVGTHGLHVTFGSVWLVTLMIQVARRGLIPANRRRLMCLSMFW 191

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD+IWI VF++VYLMG +
Sbjct: 192 HFLDVIWIGVFTYVYLMGAL 211


>gi|319786909|ref|YP_004146384.1| cytochrome o ubiquinol oxidase subunit III [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317465421|gb|ADV27153.1| cytochrome o ubiquinol oxidase, subunit III [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 211

 Score =  224 bits (571), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 115/213 (53%), Positives = 150/213 (70%), Gaps = 6/213 (2%)

Query: 1   MSRQKIGKSP---NFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK 57
           MS   +  SP   + + FY  D        +GT LGFW+YLMSD L+FA  F  Y VLG+
Sbjct: 1   MSDAALASSPLAGDPNRFY--DTGGHHHPQNGTLLGFWLYLMSDLLIFACLFAVYGVLGR 58

Query: 58  NYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMI 117
           +YAAGP   D+FD+  + V+T +LLLSS++  FAML S  +R     + WL VT  FG+ 
Sbjct: 59  SYAAGPTGADLFDLPLVAVNTAMLLLSSITYGFAML-SMQRRNTAGVLGWLAVTGLFGLA 117

Query: 118 FIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLIS 177
           F+ +E+YEF+HLI   A PQRSAFLSSFFALVG HGLHV FG++WL VL++Q+ + GL  
Sbjct: 118 FLGLELYEFSHLIHEGAGPQRSAFLSSFFALVGTHGLHVAFGIVWLVVLMVQVQRHGLHE 177

Query: 178 GNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
            N+RRL+CLS+FWHFLD++WI VF+FVYLMGV+
Sbjct: 178 ANRRRLMCLSLFWHFLDVVWIGVFTFVYLMGVL 210


>gi|301631835|ref|XP_002945000.1| PREDICTED: cytochrome o ubiquinol oxidase subunit 3-like [Xenopus
           (Silurana) tropicalis]
          Length = 214

 Score =  224 bits (571), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 139/183 (75%), Gaps = 1/183 (0%)

Query: 28  DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
           +GT LGFW+YLMSDCL+FA  F TY VLG++YA GP   ++FD+  + ++T  LLLSS++
Sbjct: 33  NGTALGFWLYLMSDCLIFAALFATYGVLGRSYAGGPTGAELFDLPLVALNTAFLLLSSIT 92

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
             FAML     + +  T+ WL VT  FG+ F+ +E+YEF HLI   A PQRSAFLS+FF 
Sbjct: 93  FGFAMLQKQQNK-VGGTLVWLAVTGLFGLCFLGLELYEFHHLIHQGAGPQRSAFLSAFFT 151

Query: 148 LVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           LV  HGLHV FGL+WL VL++QI ++GLI  NQRRL+CLSMFWHFLD++WI VF+FVYLM
Sbjct: 152 LVATHGLHVSFGLVWLVVLMVQIAQRGLIHENQRRLMCLSMFWHFLDVVWIGVFTFVYLM 211

Query: 208 GVV 210
           GV+
Sbjct: 212 GVL 214


>gi|221067297|ref|ZP_03543402.1| cytochrome o ubiquinol oxidase, subunit III [Comamonas testosteroni
           KF-1]
 gi|264678284|ref|YP_003278191.1| cytochrome C oxidase subunit III [Comamonas testosteroni CNB-2]
 gi|299532080|ref|ZP_07045474.1| cytochrome o ubiquinol oxidase, subunit III [Comamonas testosteroni
           S44]
 gi|220712320|gb|EED67688.1| cytochrome o ubiquinol oxidase, subunit III [Comamonas testosteroni
           KF-1]
 gi|262208797|gb|ACY32895.1| cytochrome c oxidase, subunit III [Comamonas testosteroni CNB-2]
 gi|298719742|gb|EFI60705.1| cytochrome o ubiquinol oxidase, subunit III [Comamonas testosteroni
           S44]
          Length = 210

 Score =  223 bits (569), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 109/183 (59%), Positives = 138/183 (75%), Gaps = 1/183 (0%)

Query: 28  DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
           +GT LGFW+YLMSDCL+FA  F TY VLG++YA GP+  D+FD+S + V+T  LL+SS++
Sbjct: 29  NGTSLGFWLYLMSDCLIFAALFATYGVLGRSYAGGPSGKDLFDLSLVAVNTAFLLMSSIT 88

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
             FAML    K+ ++ T+ WL VT   G  F+ +E+YEF HLI   A PQ SAFLSSFF 
Sbjct: 89  FGFAML-QKQKKNVNGTLLWLAVTGLLGAAFLAVELYEFHHLIHQGATPQSSAFLSSFFT 147

Query: 148 LVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           LVG HG+HV FGL+WL  L+IQI K GLI+ N RR+ CLSMFWHFLD++WI VF+FVYLM
Sbjct: 148 LVGTHGIHVTFGLVWLITLMIQIKKHGLINENVRRINCLSMFWHFLDVVWIGVFTFVYLM 207

Query: 208 GVV 210
           GV+
Sbjct: 208 GVL 210


>gi|103486991|ref|YP_616552.1| cytochrome c oxidase, subunit III [Sphingopyxis alaskensis RB2256]
 gi|98977068|gb|ABF53219.1| cytochrome c oxidase, subunit III [Sphingopyxis alaskensis RB2256]
          Length = 208

 Score =  223 bits (568), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 114/197 (57%), Positives = 145/197 (73%), Gaps = 4/197 (2%)

Query: 15  FYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
           FY  D+      H  T LGFWIYLMSDCL+FA+ F  YAVLG +YAAGPAP D+FD+  I
Sbjct: 14  FYDLDEHPHPEGHS-TMLGFWIYLMSDCLIFAILFACYAVLGGSYAAGPAPKDLFDLKLI 72

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVS-WLLVTAFFGMIFIIMEIYEFAHLISME 133
            ++T +LL SS++  FA+L     R+  K V  WL VT  FG+ F+ +E+YEF HLI + 
Sbjct: 73  ALNTAMLLFSSITYGFAVLQMQQGRV--KGVQLWLAVTGLFGLAFLGIELYEFHHLIEIG 130

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
           A PQRSAFLS+FF LVG HGLHV FG+IWL  L++Q+ K GLI+ N+RR++CLSMFWHFL
Sbjct: 131 ATPQRSAFLSAFFTLVGTHGLHVTFGIIWLVTLMVQLSKHGLIAANKRRVMCLSMFWHFL 190

Query: 194 DLIWICVFSFVYLMGVV 210
           D++WI VF+FVYL GV+
Sbjct: 191 DVVWIGVFTFVYLTGVL 207


>gi|254419944|ref|ZP_05033668.1| cytochrome o ubiquinol oxidase, subunit III [Brevundimonas sp.
           BAL3]
 gi|196186121|gb|EDX81097.1| cytochrome o ubiquinol oxidase, subunit III [Brevundimonas sp.
           BAL3]
          Length = 207

 Score =  222 bits (565), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 139/181 (76%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T LGFW+YLMSDCL+FA+ F  + VLG NYAAGP P ++FD+  + V+T +LL SS++  
Sbjct: 27  TMLGFWLYLMSDCLIFAMLFAVFGVLGGNYAAGPGPKELFDLELVAVNTAMLLFSSITYG 86

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAMLA   K    +T+ WL +T  FG+ F+ +E+YEFAHLI   A PQRSAFLS+FF LV
Sbjct: 87  FAMLA-MDKNNRTQTLIWLAITGLFGLAFLGIELYEFAHLIHEGATPQRSAFLSAFFTLV 145

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV FG+IWL  L++Q+  KGLI  N+RRL+CLSMFWHFLD+IWI VF+FVYL+G+
Sbjct: 146 GTHGLHVTFGIIWLVTLMVQVSWKGLIPANKRRLMCLSMFWHFLDVIWIGVFTFVYLLGM 205

Query: 210 V 210
           V
Sbjct: 206 V 206


>gi|16126015|ref|NP_420579.1| ubiquinol oxidase subunit III [Caulobacter crescentus CB15]
 gi|221234786|ref|YP_002517222.1| quinol cytochrome oxidase polypeptide III [Caulobacter crescentus
           NA1000]
 gi|13423197|gb|AAK23747.1| ubiquinol oxidase subunit III [Caulobacter crescentus CB15]
 gi|220963958|gb|ACL95314.1| quinol cytochrome oxidase polypeptide III [Caulobacter crescentus
           NA1000]
          Length = 208

 Score =  221 bits (564), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 113/203 (55%), Positives = 148/203 (72%), Gaps = 4/203 (1%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPID 67
            + +   FY+  +       +GT LGFWIYLMSDCL+FAV F  YAVLG++YAAGP+  D
Sbjct: 9   SAADTDQFYLTKEHHP---ENGTLLGFWIYLMSDCLIFAVLFACYAVLGQSYAAGPSGAD 65

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
           +FD+  + ++T +LLLSS++  FAM+A A  R +   + WL VT   G+ F+ +EIYEFA
Sbjct: 66  LFDLKLVAINTGLLLLSSITYGFAMIA-AQAREVRPVLIWLGVTGLLGVGFLSLEIYEFA 124

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
           HLI   A PQRSAFLS+FF LVG HGLHV FG+IWL  L++Q+ ++GL    +RRL+CLS
Sbjct: 125 HLIHEGATPQRSAFLSAFFLLVGTHGLHVTFGVIWLVTLMVQVAQRGLGIEMRRRLMCLS 184

Query: 188 MFWHFLDLIWICVFSFVYLMGVV 210
           MFWHFLD+IWI VFSFVYL+GV+
Sbjct: 185 MFWHFLDVIWIGVFSFVYLLGVL 207


>gi|332184930|ref|ZP_08386679.1| cytochrome o ubiquinol oxidase, subunit III [Sphingomonas sp. S17]
 gi|332014654|gb|EGI56710.1| cytochrome o ubiquinol oxidase, subunit III [Sphingomonas sp. S17]
          Length = 212

 Score =  221 bits (564), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 110/212 (51%), Positives = 149/212 (70%), Gaps = 3/212 (1%)

Query: 1   MSRQKIGKSP--NFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKN 58
           MS   +   P  N + + V+D+         T +GFW+YLMSDCL+FA+ F TY VLG +
Sbjct: 1   MSTDVLSADPAKNPTYYLVEDEDHHHESGGSTAIGFWMYLMSDCLIFAILFATYGVLGTS 60

Query: 59  YAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIF 118
           YA GP P ++F++  + ++T +LLLSS++  FAM+A   K     T+ WL +T  FG+ F
Sbjct: 61  YAGGPTPREIFELPLVALNTSMLLLSSITYGFAMIA-MEKNQKSNTLIWLGITGLFGLAF 119

Query: 119 IIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISG 178
           + +E+YEFA+LI   A PQRSAFLSSFF LVG HGLHV FG IWL  L++Q+ + GLI  
Sbjct: 120 LSIELYEFANLIHEGAGPQRSAFLSSFFTLVGTHGLHVTFGSIWLVTLMVQVGRFGLIEA 179

Query: 179 NQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           N+RRL+CLSMFWHFLD++WI VF+FVYL+GV+
Sbjct: 180 NKRRLMCLSMFWHFLDVVWIGVFTFVYLLGVL 211


>gi|190895345|ref|YP_001985637.1| cytochrome O ubiquinol oxidase protein, subunit III [Rhizobium etli
           CIAT 652]
 gi|190699290|gb|ACE93374.1| cytochrome O ubiquinol oxidase protein, subunit III [Rhizobium etli
           CIAT 652]
          Length = 206

 Score =  221 bits (562), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 143/210 (68%), Gaps = 5/210 (2%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           MS   +  +     +  +D        + T LGFW+YLMSDCL+FAV F T+ VLG+NYA
Sbjct: 1   MSDHTVDTAEKPEFYLTEDHHPE----NSTNLGFWLYLMSDCLIFAVLFATHGVLGRNYA 56

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
           AG  P D+FD+  + ++T +LL SS++  FAML    +    +T+ WL VT  FG  FI 
Sbjct: 57  AGRRPADLFDLPIVALNTSMLLFSSITYGFAML-QMERNAKAETLFWLAVTGLFGAAFIG 115

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           +E+YEF HLI   A P RSAFLSSFF LVG HGLHV FG+IWL  L++Q+   GLI  N+
Sbjct: 116 LELYEFIHLIHEGAGPTRSAFLSSFFTLVGTHGLHVTFGIIWLITLMVQVSMHGLIEANR 175

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RRL+CLSMFWHFLD++WI VFSFVYL+GVV
Sbjct: 176 RRLMCLSMFWHFLDVVWIGVFSFVYLLGVV 205


>gi|170748151|ref|YP_001754411.1| cytochrome o ubiquinol oxidase, subunit III [Methylobacterium
           radiotolerans JCM 2831]
 gi|170654673|gb|ACB23728.1| cytochrome o ubiquinol oxidase, subunit III [Methylobacterium
           radiotolerans JCM 2831]
          Length = 210

 Score =  221 bits (562), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 112/198 (56%), Positives = 140/198 (70%), Gaps = 2/198 (1%)

Query: 13  SLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
            +FY  D+ E       T LGFW+YLMSDCL+FA  F TY VLG++YAAGP P ++FD+ 
Sbjct: 14  PVFYQIDE-EGHHSEGSTMLGFWLYLMSDCLIFATLFATYGVLGRSYAAGPTPKELFDLP 72

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
           GI V+T +LL SS++  FAML     R + +T  WL VT  FG  F+ +EI EF HL   
Sbjct: 73  GIAVNTAMLLFSSITYGFAMLEMDRDR-VKQTQIWLAVTGLFGAAFVALEIREFVHLFHE 131

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
            A P RSAFLSSF+ LV  HGLHV  G++WL VL++Q+ K+GLI  N+RRL+CLSMFWHF
Sbjct: 132 GAPPWRSAFLSSFYTLVSTHGLHVSMGILWLVVLMVQVGKRGLIVENKRRLMCLSMFWHF 191

Query: 193 LDLIWICVFSFVYLMGVV 210
           LDLIWI VF+ VYLMGV+
Sbjct: 192 LDLIWIGVFTVVYLMGVL 209


>gi|124266932|ref|YP_001020936.1| cytochrome ubiquinol oxidase subunit III [Methylibium
           petroleiphilum PM1]
 gi|124259707|gb|ABM94701.1| cytochrome ubiquinol oxidase subunit III [Methylibium
           petroleiphilum PM1]
          Length = 215

 Score =  220 bits (561), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 141/183 (77%), Gaps = 1/183 (0%)

Query: 28  DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
           +GT LGFW+YLMSDCL+FA  F  + VLG++YA GP+  ++FD+  + ++T +LLLSS++
Sbjct: 33  NGTLLGFWLYLMSDCLIFACLFAVHGVLGRSYAGGPSGAELFDLKLVAINTSLLLLSSIT 92

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
             FAM+    +R    T+ WL +T  FG  FI +E+YEFAHLI   AVPQRSAFLSSFF 
Sbjct: 93  YGFAMI-EMQRRRQGATLLWLAITGLFGAGFIGLELYEFAHLIHEGAVPQRSAFLSSFFT 151

Query: 148 LVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           LVG HGLHV FG++WL  L++Q+ + GL++ N+RRL+CLSMFWHFLD++WI VF+FVYLM
Sbjct: 152 LVGTHGLHVSFGVVWLVTLMVQVGRHGLVAENRRRLMCLSMFWHFLDVVWIGVFTFVYLM 211

Query: 208 GVV 210
           GV+
Sbjct: 212 GVL 214


>gi|300311777|ref|YP_003775869.1| cytochrome o ubiquinol oxidase subunit III protein [Herbaspirillum
           seropedicae SmR1]
 gi|300074562|gb|ADJ63961.1| cytochrome o ubiquinol oxidase subunit III protein [Herbaspirillum
           seropedicae SmR1]
          Length = 208

 Score =  220 bits (561), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 112/198 (56%), Positives = 140/198 (70%), Gaps = 5/198 (2%)

Query: 13  SLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
           S ++V+         +GT LGFWIYLMSDCL+FA  F  YAVLG+NYA GP   ++FD+ 
Sbjct: 15  SRYFVRHHHPE----NGTLLGFWIYLMSDCLIFACLFACYAVLGRNYAGGPTGAELFDLP 70

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + ++T +LLLSS++  FAMLA   K+    T+ WL++T   G  FI  E+YEF HLI  
Sbjct: 71  LVALNTALLLLSSITYGFAMLAMQAKKQ-QNTIFWLIITGLLGAGFIYFELYEFLHLIHE 129

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
            A P RS FL+SFFALVG HGLHV FG+IWL VL+ QI K GL   N RRL+CLSMFWHF
Sbjct: 130 GAGPTRSGFLTSFFALVGTHGLHVTFGIIWLVVLLFQINKHGLTEANGRRLMCLSMFWHF 189

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD++WI VF+FVYLMGV+
Sbjct: 190 LDVVWIGVFTFVYLMGVL 207


>gi|94314529|ref|YP_587738.1| cytochrome o ubiquinol oxidase subunit III [Cupriavidus
           metallidurans CH34]
 gi|93358381|gb|ABF12469.1| cytochrome o ubiquinol oxidase subunit III [Cupriavidus
           metallidurans CH34]
          Length = 218

 Score =  220 bits (560), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 142/201 (70%), Gaps = 4/201 (1%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPID 67
             P    FY+ ++       +GT LGFW+YLMSDCL+FA  F  Y VLG+ YA GP+  +
Sbjct: 19  APPGGYQFYLTEEVHP---QNGTLLGFWLYLMSDCLIFACLFAAYGVLGREYAGGPSGAE 75

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
           +F++  + ++T  LL+SS++  FAML     R +  T  WL +T  FG  F+ +E+YEFA
Sbjct: 76  LFELPLVALNTSFLLISSITYGFAMLQMQQNR-VASTQIWLAITGVFGAAFLTVELYEFA 134

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
           HLI   A PQRSAFL+SFF+LVG HGLHV FG+IWL VL+ Q+ + GLI+ N+RRL+CLS
Sbjct: 135 HLIHEGAGPQRSAFLTSFFSLVGTHGLHVTFGIIWLIVLMTQVARHGLITANKRRLMCLS 194

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
           MFWHFLD++WI VF+FVYLMG
Sbjct: 195 MFWHFLDVVWIGVFTFVYLMG 215


>gi|317403927|gb|EFV84396.1| cytochrome ubiquinol oxidase subunit III [Achromobacter
           xylosoxidans C54]
          Length = 213

 Score =  219 bits (559), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 145/203 (71%), Gaps = 4/203 (1%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPID 67
             P   +F+V  +       +GT LGFW+YLMSDCL+FA  F TY VLG+NYAAGP+  D
Sbjct: 14  APPAEPVFHVAGEHHP---KNGTLLGFWVYLMSDCLIFACLFATYGVLGRNYAAGPSGAD 70

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
           +FD+  + V+T +LLLSS++  FAML     R +  T  WL VT   G+ F+ +E+YEFA
Sbjct: 71  LFDLPLVAVNTSLLLLSSITYGFAMLEMRRNR-VGATQGWLAVTGLLGLGFLSLELYEFA 129

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
           HLI   A PQRSAFLSSFF LVG HGLHV FG++WL  +++Q+   GLI  N+RRL+CLS
Sbjct: 130 HLIHQGAGPQRSAFLSSFFTLVGTHGLHVTFGIVWLVTMMVQVRMHGLIPENRRRLMCLS 189

Query: 188 MFWHFLDLIWICVFSFVYLMGVV 210
           MFWHFLDLIW+ VF+FVYLMGV+
Sbjct: 190 MFWHFLDLIWVGVFTFVYLMGVL 212


>gi|116694972|ref|YP_729183.1| bo3-type chinol oxidase, subunit III [Ralstonia eutropha H16]
 gi|113529471|emb|CAJ95818.1| bo3-type chinol oxidase, subunit III [Ralstonia eutropha H16]
          Length = 218

 Score =  219 bits (559), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 109/203 (53%), Positives = 142/203 (69%), Gaps = 4/203 (1%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPID 67
             P    FY+ +        +GT LGFW+YLMSDCL+FA  F  Y VLG+ YA GP+  +
Sbjct: 19  APPGGYQFYLPEDHHP---QNGTLLGFWLYLMSDCLIFACLFAAYGVLGREYAGGPSGAE 75

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
           +F++  + ++T  LLLSS++  FAML     R I  T  WL +T  FG  F+ +E+YEFA
Sbjct: 76  LFELPLVALNTSFLLLSSITYGFAMLQMQQNR-IAGTQIWLAITGVFGAGFLAVELYEFA 134

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
           HLI+  A PQRSAFL+SFFALVG HGLHV  G+IWL VL+ Q+ + GLI+ N+RRL+CLS
Sbjct: 135 HLINEGAGPQRSAFLTSFFALVGTHGLHVTCGIIWLVVLMTQVAQHGLITANKRRLMCLS 194

Query: 188 MFWHFLDLIWICVFSFVYLMGVV 210
           MFWHFLD++WI VF+FVYLMG +
Sbjct: 195 MFWHFLDVVWIGVFTFVYLMGAL 217


>gi|33593693|ref|NP_881337.1| cytochrome ubiquinol oxidase subunit III [Bordetella pertussis
           Tohama I]
 gi|33563766|emb|CAE43006.1| cytochrome ubiquinol oxidase subunit III [Bordetella pertussis
           Tohama I]
 gi|332383097|gb|AEE67944.1| cytochrome ubiquinol oxidase subunit III [Bordetella pertussis CS]
          Length = 213

 Score =  217 bits (553), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 112/197 (56%), Positives = 143/197 (72%), Gaps = 4/197 (2%)

Query: 14  LFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISG 73
           LFYV  +       +GT LGFW+YLMSDCL+FA  F TY V+G+NY  GP   ++FD+  
Sbjct: 20  LFYVPGEHHP---KNGTLLGFWVYLMSDCLVFACLFATYGVVGRNYDGGPTGAELFDLPL 76

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           + V+T +LLLSS++  FAML    +R I  T +WL VT   G  F+ +E+YEFAHLI   
Sbjct: 77  VAVNTSLLLLSSITYGFAMLEMRRQR-IGATQAWLAVTGLLGAGFLGLELYEFAHLIHQG 135

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
           A PQRSAFLS+FF LVG HGLHV FG++WL  L++Q+ + GLI  N+RRL+CLSMFWHFL
Sbjct: 136 AGPQRSAFLSAFFTLVGTHGLHVTFGIVWLVTLMVQVARHGLIPENRRRLMCLSMFWHFL 195

Query: 194 DLIWICVFSFVYLMGVV 210
           DLIW+ VF+FVYLMGV+
Sbjct: 196 DLIWVGVFTFVYLMGVL 212


>gi|114767473|ref|ZP_01446256.1| Cytochrome c oxidase, subunit III [Pelagibaca bermudensis HTCC2601]
 gi|114540453|gb|EAU43535.1| Cytochrome c oxidase, subunit III [Roseovarius sp. HTCC2601]
          Length = 219

 Score =  217 bits (552), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 114/204 (55%), Positives = 135/204 (66%), Gaps = 1/204 (0%)

Query: 4   QKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGP 63
           + +   P       K  +++      T +GFWIYLMSDC++F   F TYAVLG NYA GP
Sbjct: 14  EPLADRPMHHAREAKPHEDAHAHSSPTPVGFWIYLMSDCVIFGALFATYAVLGGNYAGGP 73

Query: 64  APIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEI 123
           AP D+F+   I V T +LL SS++   AML  A K   + T+ WL VTA FG  FI MEI
Sbjct: 74  APKDLFEPGFIAVETALLLFSSVTFGLAML-RAGKSDTNGTLMWLAVTALFGAGFIGMEI 132

Query: 124 YEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRL 183
           YEF HLI + A P RSAFLSSFFALVG HGLHV  GLIWL  L++QI   GLI  N +RL
Sbjct: 133 YEFNHLIHLGAGPDRSAFLSSFFALVGTHGLHVTGGLIWLITLMVQIRMHGLIGPNMQRL 192

Query: 184 ICLSMFWHFLDLIWICVFSFVYLM 207
             LSMFWHFLDL+WI VFSFVYL+
Sbjct: 193 GTLSMFWHFLDLVWIGVFSFVYLV 216


>gi|33600294|ref|NP_887854.1| cytochrome ubiquinol oxidase subunit III [Bordetella bronchiseptica
           RB50]
 gi|33567893|emb|CAE31806.1| cytochrome ubiquinol oxidase subunit III [Bordetella bronchiseptica
           RB50]
          Length = 212

 Score =  217 bits (552), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 112/197 (56%), Positives = 143/197 (72%), Gaps = 4/197 (2%)

Query: 14  LFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISG 73
           LFYV  +       +GT LGFW+YLMSDCL+FA  F TY V+G+NY  GP   ++FD+  
Sbjct: 19  LFYVPGEHHP---KNGTLLGFWVYLMSDCLVFACLFATYGVVGRNYDGGPTGAELFDLPL 75

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           + V+T +LLLSS++  FAML    +R I  T +WL VT   G  F+ +E+YEFAHLI   
Sbjct: 76  VAVNTSLLLLSSITYGFAMLEMRRQR-IGATQAWLAVTGLLGAGFLGLELYEFAHLIHQG 134

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
           A PQRSAFLS+FF LVG HGLHV FG++WL  L++Q+ + GLI  N+RRL+CLSMFWHFL
Sbjct: 135 AGPQRSAFLSAFFTLVGTHGLHVTFGIVWLVTLMVQVSRHGLIPENRRRLMCLSMFWHFL 194

Query: 194 DLIWICVFSFVYLMGVV 210
           DLIW+ VF+FVYLMGV+
Sbjct: 195 DLIWVGVFTFVYLMGVL 211


>gi|326389122|ref|ZP_08210702.1| cytochrome c oxidase, subunit III [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326206353|gb|EGD57190.1| cytochrome c oxidase, subunit III [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 212

 Score =  216 bits (549), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 140/195 (71%), Gaps = 1/195 (0%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF 75
           Y    +    +   T LGFWIYLMSD L+FA+ F  +AVLG NYAAGP P D+F++  + 
Sbjct: 18  YYDLNEHDHPEGGSTQLGFWIYLMSDLLIFAMLFAAFAVLGGNYAAGPGPKDLFELPLVA 77

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
            +T +LL SS++  FAM+     R +     WL+VTA FG  F+ +E+YEF++LI   A 
Sbjct: 78  FNTSMLLFSSITYGFAMIEMQKGR-VGGVQFWLVVTALFGATFLGVELYEFSNLIHEGAT 136

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           PQRSAFLS+FF LVG HGLHV FGLIWL VL++Q+ ++GL   N+RRL+CLSMFWHFLD+
Sbjct: 137 PQRSAFLSAFFTLVGTHGLHVTFGLIWLGVLLVQLSQRGLEEANKRRLLCLSMFWHFLDV 196

Query: 196 IWICVFSFVYLMGVV 210
           +W+ VF+FVYLMGV+
Sbjct: 197 VWVGVFTFVYLMGVL 211


>gi|114707978|ref|ZP_01440870.1| Cytochrome c oxidase, subunit III [Fulvimarina pelagi HTCC2506]
 gi|114536607|gb|EAU39739.1| Cytochrome c oxidase, subunit III [Fulvimarina pelagi HTCC2506]
          Length = 208

 Score =  215 bits (548), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 140/203 (68%), Gaps = 3/203 (1%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPID 67
            +P  S F + +          T LGFWIYLMSDCL+FAV F TY VLG NYAAGP P D
Sbjct: 9   NAPPESFFELNEHGHET--GSSTMLGFWIYLMSDCLIFAVLFATYGVLGANYAAGPRPED 66

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
           +F++  + V+T +LL SS++  FAM+A    R     + WL VT  FG +F+ +E+YEF 
Sbjct: 67  IFELPLLAVNTAMLLFSSITYGFAMIA-MQARQTKMVLLWLAVTGVFGALFLGIELYEFG 125

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
             I   A PQRS FLS+FF LVG HGLHV FG++WL  L++QI K GLIS N+RR++CLS
Sbjct: 126 VFIGEGASPQRSGFLSAFFTLVGTHGLHVTFGIVWLVTLMVQIQKYGLISANRRRIMCLS 185

Query: 188 MFWHFLDLIWICVFSFVYLMGVV 210
           MFWHFLD++WI VF+FVYL+ ++
Sbjct: 186 MFWHFLDVVWIGVFTFVYLIRMI 208


>gi|295691074|ref|YP_003594767.1| cytochrome o ubiquinol oxidase subunit III [Caulobacter segnis ATCC
           21756]
 gi|295432977|gb|ADG12149.1| cytochrome o ubiquinol oxidase, subunit III [Caulobacter segnis
           ATCC 21756]
          Length = 208

 Score =  215 bits (548), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 113/196 (57%), Positives = 149/196 (76%), Gaps = 4/196 (2%)

Query: 18  KDKKESCVDH---DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
           KD+     +H   +GT LGFWIYLMSDCL+FAV F  YAVLG+NYAAGP+  D+FD+  +
Sbjct: 13  KDRFYMTKEHHPENGTLLGFWIYLMSDCLIFAVLFACYAVLGRNYAAGPSGADLFDLPLV 72

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            V+T +LLLSS++  FAM+++  K+ +   ++WL VT   G+ F+ +E+YEF HLI   A
Sbjct: 73  AVNTALLLLSSITYGFAMISAQAKK-VKPVLAWLAVTGLLGLGFLSLELYEFHHLIHEGA 131

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            PQRSAFLSSFF LVG HGLHV FG+IWL  L++Q+ ++GL +  +RRL+CLSMFWHFLD
Sbjct: 132 GPQRSAFLSSFFVLVGTHGLHVTFGVIWLVTLMVQVAQRGLGAEMKRRLMCLSMFWHFLD 191

Query: 195 LIWICVFSFVYLMGVV 210
           +IWI VFSFVYL+GV+
Sbjct: 192 VIWIGVFSFVYLLGVL 207


>gi|241663144|ref|YP_002981504.1| cytochrome o ubiquinol oxidase subunit III [Ralstonia pickettii
           12D]
 gi|309781938|ref|ZP_07676669.1| cytochrome o ubiquinol oxidase, subunit III [Ralstonia sp.
           5_7_47FAA]
 gi|240865171|gb|ACS62832.1| cytochrome o ubiquinol oxidase, subunit III [Ralstonia pickettii
           12D]
 gi|308919282|gb|EFP64948.1| cytochrome o ubiquinol oxidase, subunit III [Ralstonia sp.
           5_7_47FAA]
          Length = 221

 Score =  214 bits (546), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 107/202 (52%), Positives = 142/202 (70%), Gaps = 4/202 (1%)

Query: 9   SPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDV 68
            P    F+V ++       +GT LGFW+YLMSDCL+FA  F  Y VLG+ YA GP   ++
Sbjct: 23  PPGGYQFHVTEEPHVP---NGTLLGFWLYLMSDCLIFACLFAAYGVLGREYAGGPTGAEL 79

Query: 69  FDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAH 128
           F++  + ++T  LLLSS++  FAML     ++    + WL +T  FG  F+ +E+YEFAH
Sbjct: 80  FELPLVALNTSFLLLSSITYGFAMLQLQQNKISAMQI-WLAITWVFGAAFLAVELYEFAH 138

Query: 129 LISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSM 188
           LI   A P RSAFL+SFF+LVG HGLHV FGLIWL VL++Q+ K GLI+ N+RRL+CLSM
Sbjct: 139 LIHEGAGPTRSAFLTSFFSLVGTHGLHVTFGLIWLIVLMVQVSKHGLITANKRRLMCLSM 198

Query: 189 FWHFLDLIWICVFSFVYLMGVV 210
           FWHFLD++WI VF+FVYLMG +
Sbjct: 199 FWHFLDVVWIGVFTFVYLMGTL 220


>gi|187928956|ref|YP_001899443.1| cytochrome o ubiquinol oxidase subunit III [Ralstonia pickettii
           12J]
 gi|187725846|gb|ACD27011.1| cytochrome o ubiquinol oxidase, subunit III [Ralstonia pickettii
           12J]
          Length = 221

 Score =  214 bits (545), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 107/202 (52%), Positives = 142/202 (70%), Gaps = 4/202 (1%)

Query: 9   SPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDV 68
            P    F+V ++       +GT LGFW+YLMSDCL+FA  F  Y VLG+ YA GP   ++
Sbjct: 23  PPGGYQFHVTEEPHVP---NGTLLGFWLYLMSDCLIFACLFAAYGVLGREYAGGPTGAEL 79

Query: 69  FDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAH 128
           F++  + ++T  LLLSS++  FAML     ++    + WL +T  FG  F+ +E+YEFAH
Sbjct: 80  FELPLVALNTSFLLLSSITYGFAMLQLQQNKVSAMQI-WLAITWVFGAAFLAVELYEFAH 138

Query: 129 LISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSM 188
           LI   A P RSAFL+SFF+LVG HGLHV FGLIWL VL++Q+ K GLI+ N+RRL+CLSM
Sbjct: 139 LIHEGAGPTRSAFLTSFFSLVGTHGLHVTFGLIWLIVLMVQVSKHGLITANKRRLMCLSM 198

Query: 189 FWHFLDLIWICVFSFVYLMGVV 210
           FWHFLD++WI VF+FVYLMG +
Sbjct: 199 FWHFLDVVWIGVFTFVYLMGTL 220


>gi|329915609|ref|ZP_08276293.1| Cytochrome O ubiquinol oxidase subunit III [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327544870|gb|EGF30240.1| Cytochrome O ubiquinol oxidase subunit III [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 202

 Score =  214 bits (544), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 105/203 (51%), Positives = 141/203 (69%), Gaps = 5/203 (2%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPID 67
            + + + +YV +        +GT LGFW+YLMSDCL+FA  F  YAVLG+NYA GP   +
Sbjct: 4   PTTDSTRYYVLEHHPE----NGTTLGFWLYLMSDCLVFAALFAVYAVLGRNYAGGPTGAE 59

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
           +FD+  + ++T  LL+SS++  FAML    KR +  T+ W+ +T   G  FI +E+YEF 
Sbjct: 60  LFDLPLVALNTAFLLVSSITYGFAMLEMQRKR-VRSTLIWMGITGLIGACFIGLEMYEFI 118

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
           HLI   A PQRS FL++FF LVG HGLHV FG+IWL  L++Q+   GL + N RRL+CLS
Sbjct: 119 HLIHEGAGPQRSGFLTAFFTLVGTHGLHVMFGIIWLVTLMLQVSVHGLTTENSRRLMCLS 178

Query: 188 MFWHFLDLIWICVFSFVYLMGVV 210
           MFWHFLD++WI VF+FVYLMGV+
Sbjct: 179 MFWHFLDVVWIGVFTFVYLMGVL 201


>gi|134095868|ref|YP_001100943.1| cytochrome o ubiquinol oxidase subunit III [Herminiimonas
           arsenicoxydans]
 gi|133739771|emb|CAL62822.1| Cytochrome o ubiquinol oxidase subunit 3 (Cytochrome o ubiquinol
           oxidase subunit III) [Herminiimonas arsenicoxydans]
          Length = 214

 Score =  213 bits (542), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 109/196 (55%), Positives = 139/196 (70%), Gaps = 5/196 (2%)

Query: 15  FYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
           +YVK+          T LGFWIYLMSDCL+FA  F TYAVLG++YA GP   ++FD+  +
Sbjct: 23  YYVKEHHPE----SSTSLGFWIYLMSDCLIFACLFATYAVLGRSYAGGPTGAELFDLPLV 78

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            ++T  LL+SS++   AML +   R +  T+ WL +T   G  F+ +E+YEF HLI   A
Sbjct: 79  AMNTAFLLVSSITYGVAMLEAHRNR-VRSTLIWLAITGMLGAGFLALELYEFNHLIHEGA 137

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            PQ SAFL+SFFALVG HGLHV FG+IWL VL+ Q+ K GL   N+RRL+CLSMFWHFLD
Sbjct: 138 GPQTSAFLTSFFALVGTHGLHVTFGIIWLIVLMFQVGKFGLNVENKRRLMCLSMFWHFLD 197

Query: 195 LIWICVFSFVYLMGVV 210
           +IWI VF+FVYLMGV+
Sbjct: 198 VIWIGVFTFVYLMGVL 213


>gi|170743801|ref|YP_001772456.1| cytochrome o ubiquinol oxidase subunit III [Methylobacterium sp.
           4-46]
 gi|168198075|gb|ACA20022.1| cytochrome o ubiquinol oxidase, subunit III [Methylobacterium sp.
           4-46]
          Length = 208

 Score =  212 bits (540), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 105/192 (54%), Positives = 140/192 (72%), Gaps = 1/192 (0%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +E      GT LGFW+YLM DCL+FAV F T+ VLG+NYAAGP+  D+FD+  + ++T
Sbjct: 17  ETEEHAHGDGGTLLGFWVYLMGDCLIFAVLFATFGVLGRNYAAGPSGADLFDLRLVALNT 76

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
            +LLLSS++  FAML     RL   T  WL++T  FG  F+++E+YEF HLI   A PQR
Sbjct: 77  SLLLLSSITYGFAMLEMDKDRL-DMTRRWLIITGLFGAGFLMIELYEFGHLIHEGATPQR 135

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAFLS+FF LVG HGLHV FG++WL  L+ Q+ + GL++  +R L+CLSMFWHFLD++WI
Sbjct: 136 SAFLSAFFTLVGTHGLHVTFGIVWLLTLLAQLRRYGLVAETRRGLLCLSMFWHFLDVVWI 195

Query: 199 CVFSFVYLMGVV 210
            VF+FVYLMG +
Sbjct: 196 GVFTFVYLMGAM 207


>gi|260426790|ref|ZP_05780769.1| cytOchrome o ubiquinol oxidase, subunit III [Citreicella sp. SE45]
 gi|260421282|gb|EEX14533.1| cytOchrome o ubiquinol oxidase, subunit III [Citreicella sp. SE45]
          Length = 219

 Score =  211 bits (537), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 130/193 (67%), Gaps = 7/193 (3%)

Query: 21  KESCVDHDG------TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
           + +   HD       T +GFWIYLMSDC++F   F TYAVLG NYA GPAP D+F+   +
Sbjct: 25  RNNDAHHDAHAHSSPTPIGFWIYLMSDCIIFGALFATYAVLGGNYAGGPAPKDLFEPGFV 84

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            + T +LL SS++   AML  A K      + WL VTA FG  FI MEIYEF HLI + A
Sbjct: 85  AIETALLLFSSITFGLAML-RADKDDRDGVLKWLAVTAVFGAGFIAMEIYEFNHLIHIGA 143

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            P RSAFLSSFFALVG HGLHV  GLIWL  L++QI   GLI  N RRL  LSMFWHFLD
Sbjct: 144 GPDRSAFLSSFFALVGTHGLHVTGGLIWLVTLMVQIRMHGLIGENMRRLGTLSMFWHFLD 203

Query: 195 LIWICVFSFVYLM 207
           L+WI VFSFVYL+
Sbjct: 204 LVWIGVFSFVYLV 216


>gi|329890317|ref|ZP_08268660.1| cytochrome o ubiquinol oxidase, subunit III [Brevundimonas diminuta
           ATCC 11568]
 gi|328845618|gb|EGF95182.1| cytochrome o ubiquinol oxidase, subunit III [Brevundimonas diminuta
           ATCC 11568]
          Length = 172

 Score =  210 bits (535), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 103/172 (59%), Positives = 133/172 (77%), Gaps = 1/172 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           MSDCL+FA+ F  YAVLG NYAAGPAP D+FD+  + V+T +LL SS++  FAMLA    
Sbjct: 1   MSDCLIFAILFAVYAVLGGNYAAGPAPKDLFDLPLVAVNTSMLLFSSITYGFAMLAMYRN 60

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
           + + +T  WL VT  FG+ F+ +E+YEFAH+I + A PQRS FLS+FF LVG HGLHV F
Sbjct: 61  K-VAQTQVWLAVTGLFGLCFLGIELYEFAHMIHLGATPQRSGFLSAFFILVGTHGLHVTF 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           G+IWL  L+IQ+ +KGLI  N+RRL+CLS+FWHFLD+IWI VF+FVYL G++
Sbjct: 120 GVIWLVTLMIQVGQKGLIQANKRRLMCLSLFWHFLDVIWIGVFTFVYLFGML 171


>gi|73538717|ref|YP_299084.1| cytochrome ubiquinol oxidase subunit III [Ralstonia eutropha
           JMP134]
 gi|72122054|gb|AAZ64240.1| cytochrome ubiquinol oxidase subunit III [Ralstonia eutropha
           JMP134]
          Length = 229

 Score =  206 bits (525), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 102/183 (55%), Positives = 131/183 (71%), Gaps = 1/183 (0%)

Query: 28  DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
           +GT LGFWIYLMSDCL+FA  F  Y VLG++YA GP   ++FD+  + ++T  LLLSS++
Sbjct: 47  NGTLLGFWIYLMSDCLIFACLFAAYGVLGRSYAGGPTGAELFDLPLVALNTSFLLLSSIT 106

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
             FAML     R +  T  WL +T   G  F+ +EIYEF HL+   A P RS FL+SFF+
Sbjct: 107 YGFAMLQMQQGR-VGGTQGWLAITGVLGACFLGVEIYEFVHLVGEGAGPWRSGFLTSFFS 165

Query: 148 LVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           LV  HGLHV FG+IWL  L++Q+   GLI  N+RRL+CLSMFWHFLD++WI VF+FVYLM
Sbjct: 166 LVSTHGLHVTFGIIWLITLMVQVRLHGLIPENRRRLMCLSMFWHFLDVVWIGVFTFVYLM 225

Query: 208 GVV 210
           GV+
Sbjct: 226 GVL 228


>gi|99082126|ref|YP_614280.1| cytochrome c oxidase, subunit III [Ruegeria sp. TM1040]
 gi|99038406|gb|ABF65018.1| cytochrome c oxidase subunit III [Ruegeria sp. TM1040]
          Length = 214

 Score =  205 bits (521), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 109/214 (50%), Positives = 140/214 (65%), Gaps = 5/214 (2%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDH----DGTYLGFWIYLMSDCLMFAVFFVTYAVLG 56
           MS      +P    FYV +   +         GT LGFWIYLMSDCL+F + F  +AV+G
Sbjct: 1   MSHSAATPAPEALEFYVTEDPHAGHGDHHHDTGTMLGFWIYLMSDCLIFGILFAVHAVVG 60

Query: 57  KNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGM 116
            +YAAGP+P D+F+I  I ++T  LL SS++  FA++ +  +R     + WL VT  FG+
Sbjct: 61  TSYAAGPSPADLFEIDKILLATFFLLFSSITYGFAVI-NMQQRKQRAMMLWLGVTLVFGL 119

Query: 117 IFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLI 176
            F++MEI EF HL  + A P  SAFLSSF+ LVG HGLHV  G IWL VL++Q+   GL 
Sbjct: 120 GFLVMEILEFQHLWHLGAGPGASAFLSSFWVLVGTHGLHVTAGAIWLVVLLVQVQMHGLT 179

Query: 177 SGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
             N RR++CLSMFWHFLDLIWI VFSFVYL GV+
Sbjct: 180 EANTRRILCLSMFWHFLDLIWIGVFSFVYLTGVL 213


>gi|237808829|ref|YP_002893269.1| cytochrome o ubiquinol oxidase, subunit III [Tolumonas auensis DSM
           9187]
 gi|237501090|gb|ACQ93683.1| cytochrome o ubiquinol oxidase, subunit III [Tolumonas auensis DSM
           9187]
          Length = 204

 Score =  205 bits (521), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 101/178 (56%), Positives = 127/178 (71%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++FA  F TYAVL  ++A GP   D+F++  +   T  LL+SS +   AM
Sbjct: 28  GFWIYLMSDCILFATLFATYAVLSGSFAGGPTGKDIFELPYVLTETFCLLISSFTYGMAM 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           LA   +      + WL VT FFG  FI MEI EF+HLIS    P RSAFLS FFAL+G H
Sbjct: 88  LA-MNRGEQSSVMKWLAVTFFFGAAFIGMEINEFSHLISEGYGPDRSAFLSGFFALIGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHVF GL+W+ VL+IQ+ + GL + NQ RL+CLS+FWHFLD++WICVF+ VYLMGV+
Sbjct: 147 GLHVFSGLVWMIVLMIQVAQNGLTTTNQTRLMCLSLFWHFLDIVWICVFTVVYLMGVL 204


>gi|254428757|ref|ZP_05042464.1| cytochrome o ubiquinol oxidase, subunit III [Alcanivorax sp. DG881]
 gi|196194926|gb|EDX89885.1| cytochrome o ubiquinol oxidase, subunit III [Alcanivorax sp. DG881]
          Length = 212

 Score =  204 bits (520), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 105/188 (55%), Positives = 141/188 (75%), Gaps = 4/188 (2%)

Query: 26  DH---DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLL 82
           DH   +GT LGFWIYLMSDCL+FA  F TY VLG++YA GP  +++FD+S I ++T +LL
Sbjct: 25  DHHPQNGTLLGFWIYLMSDCLIFAALFATYGVLGRSYAGGPTGMELFDLSLIAINTSLLL 84

Query: 83  LSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFL 142
           +SS++  FAML     + +  T+ WL VT   G+ F+ +E+YEF HLIS+ A PQ S F 
Sbjct: 85  VSSITYGFAMLHMQANK-VKGTMFWLAVTGLLGLGFLSLELYEFHHLISVGAGPQTSGFW 143

Query: 143 SSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFS 202
           ++FFALVG HGLHVFFG++WL  L+ Q+ K GLI  N+RR+ CLSMFWHFLD++W+ VF+
Sbjct: 144 TAFFALVGTHGLHVFFGIVWLVTLLFQLKKHGLIPENKRRVFCLSMFWHFLDVVWVGVFT 203

Query: 203 FVYLMGVV 210
           +VYLMGV+
Sbjct: 204 YVYLMGVL 211


>gi|254252016|ref|ZP_04945334.1| cytochrome c oxidase subunit III [Burkholderia dolosa AUO158]
 gi|124894625|gb|EAY68505.1| cytochrome c oxidase subunit III [Burkholderia dolosa AUO158]
          Length = 202

 Score =  204 bits (519), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 107/200 (53%), Positives = 136/200 (68%), Gaps = 8/200 (4%)

Query: 18  KDKKESCVDHDG-----TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
           K    + ++HD      +  GFW+YLM+DC++FA  F T+AVLG  YA GP   D+FDI 
Sbjct: 4   KTLSATLLEHDDHPPSHSVFGFWLYLMTDCVIFAALFATFAVLGNQYAGGPTAKDLFDIP 63

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
           G+ V T  LLLSS++  FAMLA+  +R     ++WL VT   G  F+ ME+ EFAHLI+ 
Sbjct: 64  GVAVETAALLLSSITYGFAMLAAYRQRR-GALLAWLAVTFVLGAAFLAMELREFAHLIAE 122

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQI-LKKG-LISGNQRRLICLSMFW 190
            A PQRSAFLS+FF LVG HGLHV  GL+W+ VL  QI L+ G L   + RRL CLS+FW
Sbjct: 123 GAGPQRSAFLSAFFTLVGTHGLHVTVGLLWMIVLAAQIVLRSGDLTDRDLRRLTCLSLFW 182

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD++WICVFSFVYL  V+
Sbjct: 183 HFLDIVWICVFSFVYLASVI 202


>gi|172061020|ref|YP_001808672.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia ambifaria
           MC40-6]
 gi|171993537|gb|ACB64456.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia ambifaria
           MC40-6]
          Length = 202

 Score =  204 bits (518), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 105/200 (52%), Positives = 136/200 (68%), Gaps = 8/200 (4%)

Query: 18  KDKKESCVDHDG-----TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
           K    + ++HD      +  GFW+YLM+DC++FA  F T+AVLG  YA GP   D+FDI 
Sbjct: 4   KTLSATLLEHDDHPPSHSVFGFWLYLMTDCVIFAALFATFAVLGNQYAGGPTAKDLFDIP 63

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
           G+ V T  LLLSS++  FAMLA+  +R     ++WL VT   G  F+ ME+ EF+HLI+ 
Sbjct: 64  GVAVETAALLLSSITYGFAMLAAYKQRR-GALLAWLAVTFALGAAFLAMELREFSHLIAD 122

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLICLSMFW 190
            A PQRSAFLS+FF LVG HGLHV  GL+W+ VL  QI+ +G  L   + RRL CLS+FW
Sbjct: 123 GAGPQRSAFLSAFFTLVGTHGLHVTAGLLWMIVLAAQIVLRGGDLTDRDLRRLTCLSLFW 182

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD++WICVFSFVYL  V+
Sbjct: 183 HFLDIVWICVFSFVYLASVI 202


>gi|171318687|ref|ZP_02907831.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia ambifaria
           MEX-5]
 gi|171096122|gb|EDT41047.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia ambifaria
           MEX-5]
          Length = 202

 Score =  203 bits (517), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 105/200 (52%), Positives = 136/200 (68%), Gaps = 8/200 (4%)

Query: 18  KDKKESCVDHDG-----TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
           K    + ++HD      +  GFW+YLM+DC++FA  F T+AVLG  YA GP   D+FDI 
Sbjct: 4   KTLSATLLEHDDHPPSHSVFGFWLYLMTDCVIFAALFATFAVLGNQYAGGPTAKDLFDIP 63

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
           G+ V T  LLLSS++  FAMLA+  +R     ++WL VT   G  F+ ME+ EF+HLI+ 
Sbjct: 64  GVAVETAALLLSSITYGFAMLAAYKQRR-GALLAWLAVTFVLGAAFLAMELREFSHLIAE 122

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLICLSMFW 190
            A PQRSAFLS+FF LVG HGLHV  GL+W+ VL  QI+ +G  L   + RRL CLS+FW
Sbjct: 123 GAGPQRSAFLSAFFTLVGTHGLHVTAGLLWMIVLAGQIVLRGGDLTDRDLRRLTCLSLFW 182

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD++WICVFSFVYL  V+
Sbjct: 183 HFLDIVWICVFSFVYLASVI 202


>gi|78066843|ref|YP_369612.1| Heme/copper-type cytochrome/quinol oxidase subunit 3-like
           [Burkholderia sp. 383]
 gi|77967588|gb|ABB08968.1| cytochrome bo3 quinol oxidase subunit 3 [Burkholderia sp. 383]
          Length = 202

 Score =  203 bits (516), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 138/200 (69%), Gaps = 8/200 (4%)

Query: 18  KDKKESCVDHDG-----TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
           K    + ++HD      +  GFW+YLM+DC++FA  F T+AVLG+ +A GP   D+FDI 
Sbjct: 4   KTLSATLLEHDDHPPSHSVFGFWLYLMTDCVIFAALFATFAVLGQQHAGGPTAKDLFDIP 63

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
           G+ V T  LLLSS++  FAMLA+  +R     ++WL VT   G  F++ME+ EF+HLI+ 
Sbjct: 64  GVAVETAALLLSSITYGFAMLAAYKQRR-GALLAWLAVTFVLGAAFLVMELREFSHLIAE 122

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLICLSMFW 190
            A PQRSAFLS+FF LVG HGLHV  GL+W+ VL  QI+ +G  L   + RRL CLS+FW
Sbjct: 123 GAGPQRSAFLSAFFTLVGTHGLHVTAGLLWMIVLAGQIVFRGGDLTDRDLRRLTCLSLFW 182

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD++WICVFSFVYL  V+
Sbjct: 183 HFLDIVWICVFSFVYLASVI 202


>gi|161524384|ref|YP_001579396.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           multivorans ATCC 17616]
 gi|189350861|ref|YP_001946489.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           multivorans ATCC 17616]
 gi|160341813|gb|ABX14899.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia
           multivorans ATCC 17616]
 gi|189334883|dbj|BAG43953.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           multivorans ATCC 17616]
          Length = 202

 Score =  202 bits (515), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 103/200 (51%), Positives = 136/200 (68%), Gaps = 8/200 (4%)

Query: 18  KDKKESCVDHDG-----TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
           K    + ++HD      +  GFW+YLM+DC++FA  F T+AVLG  YA GP   D+FDI 
Sbjct: 4   KTLSATLLEHDDHPPSHSVFGFWLYLMTDCVIFAALFATFAVLGNQYAGGPTAKDLFDIP 63

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
           G+ + T  LLLSS++  FAMLA+  +R     ++WL VT   G  F+ ME+ EF+HLI+ 
Sbjct: 64  GVAIETAALLLSSITYGFAMLAAYKQRR-GALLAWLAVTFVLGAAFLAMELREFSHLIAG 122

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLICLSMFW 190
            A PQRSAFLS+FF LVG HGLHV  GL+W+ VL  QI+ +G  L   + RRL CLS+FW
Sbjct: 123 GAGPQRSAFLSAFFTLVGTHGLHVTAGLLWMIVLAGQIVARGGDLTDRDLRRLTCLSLFW 182

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD++WICVF+FVYL  V+
Sbjct: 183 HFLDIVWICVFTFVYLASVI 202


>gi|221198371|ref|ZP_03571417.1| ubiquinol oxidase, subunit III [Burkholderia multivorans CGD2M]
 gi|221208952|ref|ZP_03581949.1| ubiquinol oxidase, subunit III [Burkholderia multivorans CGD2]
 gi|221215751|ref|ZP_03588711.1| ubiquinol oxidase, subunit III [Burkholderia multivorans CGD1]
 gi|221164363|gb|EED96849.1| ubiquinol oxidase, subunit III [Burkholderia multivorans CGD1]
 gi|221171235|gb|EEE03685.1| ubiquinol oxidase, subunit III [Burkholderia multivorans CGD2]
 gi|221182303|gb|EEE14704.1| ubiquinol oxidase, subunit III [Burkholderia multivorans CGD2M]
          Length = 202

 Score =  202 bits (515), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 103/200 (51%), Positives = 135/200 (67%), Gaps = 8/200 (4%)

Query: 18  KDKKESCVDHDG-----TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
           K    + ++HD      +  GFW+YLM+DC++FA  F T+AVLG  YA GP   D+FDI 
Sbjct: 4   KTLSATLLEHDDHPPSHSVFGFWLYLMTDCVIFAALFATFAVLGNQYAGGPTAKDLFDIP 63

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
           G+ + T  LLLSS++  FAMLA+  +R     + WL VT   G  F+ ME+ EF+HLI+ 
Sbjct: 64  GVAIETAALLLSSITYGFAMLAAYKQRR-GALLGWLAVTFVLGAAFLAMELREFSHLIAE 122

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLICLSMFW 190
            A PQRSAFLS+FF LVG HGLHV  GL+W+ VL  QI+ +G  L   + RRL CLS+FW
Sbjct: 123 GAGPQRSAFLSAFFTLVGTHGLHVTAGLLWMIVLAGQIVARGGDLTDRDLRRLTCLSLFW 182

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD++WICVF+FVYL  V+
Sbjct: 183 HFLDIVWICVFTFVYLASVI 202


>gi|115352156|ref|YP_773995.1| cytochrome c oxidase subunit III [Burkholderia ambifaria AMMD]
 gi|115282144|gb|ABI87661.1| cytochrome bo3 quinol oxidase subunit 3 [Burkholderia ambifaria
           AMMD]
          Length = 202

 Score =  202 bits (515), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 136/200 (68%), Gaps = 8/200 (4%)

Query: 18  KDKKESCVDHDG-----TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
           K    + ++HD      +  GFW+YLM+DC++FA  F T+AVLG  +A GP   D+FDI 
Sbjct: 4   KTLSATLLEHDDHPPSHSVFGFWLYLMTDCVIFAALFATFAVLGNQHAGGPTAKDLFDIP 63

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
           G+ V T  LLLSS++  FAMLA+  +R     ++WL VT   G  F+ ME+ EF+HLI+ 
Sbjct: 64  GVAVETAALLLSSITYGFAMLAAYKQRR-GALLAWLAVTFVLGAAFLAMELREFSHLIAD 122

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLICLSMFW 190
            A PQRSAFLS+FF LVG HGLHV  GL+W+ VL  QI+ +G  L   + RRL CLS+FW
Sbjct: 123 GAGPQRSAFLSAFFTLVGTHGLHVTAGLLWMIVLAAQIVMRGGDLTDRDLRRLTCLSLFW 182

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD++WICVFSFVYL  V+
Sbjct: 183 HFLDIVWICVFSFVYLASVI 202


>gi|110834896|ref|YP_693755.1| cytochrome o ubiquinol oxidase subunit III [Alcanivorax borkumensis
           SK2]
 gi|110648007|emb|CAL17483.1| cytochrome o ubiquinol oxidase, subunit III [Alcanivorax
           borkumensis SK2]
          Length = 222

 Score =  202 bits (514), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 105/188 (55%), Positives = 139/188 (73%), Gaps = 4/188 (2%)

Query: 26  DH---DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLL 82
           DH   +GT LGFWIYLMSDCL+FA  F TY VL ++YA GP  +++FD+S I V+T +LL
Sbjct: 35  DHHPQNGTLLGFWIYLMSDCLIFACLFATYGVLSRSYAGGPTGMELFDLSLIAVNTSLLL 94

Query: 83  LSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFL 142
           +SS++  FAML     R +  T+ WL VT   G+ F+ +E+YEF HLI + A PQ S F 
Sbjct: 95  VSSITYGFAMLQMQANR-VKGTMFWLAVTGLLGLGFLSLELYEFHHLIHVGAGPQTSGFW 153

Query: 143 SSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFS 202
           ++FFALVG HGLHVFFG++WL  L+ Q+ K GLI  N+RR+ CLSMFWHFLD++W+ VF+
Sbjct: 154 TAFFALVGTHGLHVFFGIVWLVTLLFQLKKHGLIQENKRRVFCLSMFWHFLDVVWVGVFT 213

Query: 203 FVYLMGVV 210
           +VYLMGV+
Sbjct: 214 YVYLMGVL 221


>gi|28198531|ref|NP_778845.1| cytochrome O ubiquinol oxidase subunit III [Xylella fastidiosa
           Temecula1]
 gi|71897569|ref|ZP_00679814.1| Cytochrome c oxidase, subunit III [Xylella fastidiosa Ann-1]
 gi|182681210|ref|YP_001829370.1| cytochrome o ubiquinol oxidase, subunit III [Xylella fastidiosa
           M23]
 gi|28056615|gb|AAO28494.1| cytochrome O ubiquinol oxidase subunit III [Xylella fastidiosa
           Temecula1]
 gi|71732472|gb|EAO34525.1| Cytochrome c oxidase, subunit III [Xylella fastidiosa Ann-1]
 gi|182631320|gb|ACB92096.1| cytochrome o ubiquinol oxidase, subunit III [Xylella fastidiosa
           M23]
          Length = 202

 Score =  202 bits (513), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 128/183 (69%), Gaps = 1/183 (0%)

Query: 28  DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
           D T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL SSL+
Sbjct: 21  DNTVFGFWVYLMSDCLIFAGLFATYAVLVGATVDGPTAKELFDLKFVLVETFLLLFSSLT 80

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
             FAM+A A KR I     WL+VTA FG+ F+ ME+YEF HLI   A P RSAFLS+FF 
Sbjct: 81  FGFAMIA-AHKRHIPALYGWLMVTALFGLGFLGMELYEFHHLIQEGAGPGRSAFLSAFFT 139

Query: 148 LVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           LVG HGLHV  GL+W+ +LVIQI+K GL   N  RL CLS+FWHFLD+IWI VF+ VYL+
Sbjct: 140 LVGTHGLHVASGLLWMLILVIQIVKNGLTPRNSTRLACLSLFWHFLDVIWIGVFTIVYLL 199

Query: 208 GVV 210
           G +
Sbjct: 200 GAL 202


>gi|15837989|ref|NP_298677.1| cytochrome O ubiquinol oxidase, subunit III [Xylella fastidiosa
           9a5c]
 gi|9106396|gb|AAF84197.1|AE003970_4 cytochrome O ubiquinol oxidase, subunit III [Xylella fastidiosa
           9a5c]
          Length = 202

 Score =  202 bits (513), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 104/183 (56%), Positives = 128/183 (69%), Gaps = 1/183 (0%)

Query: 28  DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
           D T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + + T +LL SSL+
Sbjct: 21  DNTVFGFWVYLMSDCLIFAGLFATYAVLVGATVDGPTAKELFDLKFVLIETFLLLFSSLT 80

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
             FAM+A A KR I     WL+VTA FG+ F+ ME+YEF HLI   A P RSAFLS+FF 
Sbjct: 81  FGFAMIA-AHKRHIPALYGWLMVTALFGLGFLGMELYEFHHLIQEGAGPGRSAFLSAFFT 139

Query: 148 LVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           LVG HGLHV  GL+W+ +LVIQI+K GL   N  RL CLS+FWHFLD+IWI VF+ VYL+
Sbjct: 140 LVGTHGLHVASGLLWMLILVIQIVKNGLTPRNNTRLACLSLFWHFLDVIWIGVFTIVYLL 199

Query: 208 GVV 210
           G +
Sbjct: 200 GAL 202


>gi|76809447|ref|YP_334219.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           pseudomallei 1710b]
 gi|167825087|ref|ZP_02456558.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           pseudomallei 9]
 gi|167911808|ref|ZP_02498899.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           pseudomallei 112]
 gi|226199985|ref|ZP_03795535.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei Pakistan
           9]
 gi|254195719|ref|ZP_04902145.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei S13]
 gi|254262091|ref|ZP_04953145.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 1710a]
 gi|254296928|ref|ZP_04964381.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 406e]
 gi|76578900|gb|ABA48375.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           pseudomallei 1710b]
 gi|157807037|gb|EDO84207.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 406e]
 gi|169652464|gb|EDS85157.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei S13]
 gi|225928041|gb|EEH24078.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei Pakistan
           9]
 gi|254220780|gb|EET10164.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 1710a]
          Length = 201

 Score =  202 bits (513), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 131/188 (69%), Gaps = 4/188 (2%)

Query: 26  DHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLL 83
           DH  ++  LGFW+YLM+DC++FA  F T+AVLG  +A GP   D+FDI G+ + T  LLL
Sbjct: 15  DHPPSHSVLGFWLYLMTDCVLFAALFATFAVLGNQFAGGPTAKDLFDIPGVALETAALLL 74

Query: 84  SSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLS 143
           SS++  FAM+  A +R       WL VT   G  F+ ME+ EF+HL++  A PQRSAFLS
Sbjct: 75  SSITYGFAMIG-AHQRRRGAVFGWLAVTFVLGAAFLAMELREFSHLVAEGAGPQRSAFLS 133

Query: 144 SFFALVGLHGLHVFFGLIWLFVLVIQILKKG-LISGNQRRLICLSMFWHFLDLIWICVFS 202
           SFF LVG HGLHV  GL+W+ VLV Q L++  L   + RRL CLS+FWHFLD++WICVFS
Sbjct: 134 SFFTLVGTHGLHVTAGLVWMAVLVAQALRRPELTERDIRRLTCLSLFWHFLDIVWICVFS 193

Query: 203 FVYLMGVV 210
           FVYL  V+
Sbjct: 194 FVYLASVI 201


>gi|307579656|gb|ADN63625.1| cytochrome O ubiquinol oxidase subunit III [Xylella fastidiosa
           subsp. fastidiosa GB514]
          Length = 194

 Score =  201 bits (512), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 128/183 (69%), Gaps = 1/183 (0%)

Query: 28  DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
           D T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL SSL+
Sbjct: 13  DNTVFGFWVYLMSDCLIFAGLFATYAVLVGATVDGPTAKELFDLKFVLVETFLLLFSSLT 72

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
             FAM+A A KR I     WL+VTA FG+ F+ ME+YEF HLI   A P RSAFLS+FF 
Sbjct: 73  FGFAMIA-AHKRHIPALYGWLMVTALFGLGFLGMELYEFHHLIQEGAGPGRSAFLSAFFT 131

Query: 148 LVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           LVG HGLHV  GL+W+ +LVIQI+K GL   N  RL CLS+FWHFLD+IWI VF+ VYL+
Sbjct: 132 LVGTHGLHVASGLLWMLILVIQIVKNGLTPRNSTRLACLSLFWHFLDVIWIGVFTIVYLL 191

Query: 208 GVV 210
           G +
Sbjct: 192 GAL 194


>gi|170701548|ref|ZP_02892498.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia ambifaria
           IOP40-10]
 gi|170133542|gb|EDT01920.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia ambifaria
           IOP40-10]
          Length = 202

 Score =  201 bits (511), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 136/200 (68%), Gaps = 8/200 (4%)

Query: 18  KDKKESCVDHDG-----TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
           K    + ++HD      +  GFW+YLM+DC++FA  F T+AVLG  +A GP   D+FDI 
Sbjct: 4   KTLSATLLEHDDHPPSHSVFGFWLYLMTDCVIFAALFATFAVLGNQHAGGPTAKDLFDIP 63

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
           G+ V T  LLLSS++  FAMLA+  +R     ++WL VT   G  F+ ME+ EF+HLI+ 
Sbjct: 64  GVAVETAALLLSSITYGFAMLAAYKQRR-GALLAWLAVTFVLGAAFLAMELREFSHLIAD 122

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLICLSMFW 190
            A PQRSAFLS+FF LVG HGLHV  GL+W+ VL  QI+ +G  L   + RRL CLS+FW
Sbjct: 123 GAGPQRSAFLSAFFTLVGTHGLHVTAGLLWMIVLAGQIVLRGGDLTDRDLRRLTCLSLFW 182

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD++WICVFSFVYL  V+
Sbjct: 183 HFLDIVWICVFSFVYLASVI 202


>gi|167589185|ref|ZP_02381573.1| cytochrome c oxidase, subunit III [Burkholderia ubonensis Bu]
          Length = 204

 Score =  201 bits (511), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 131/191 (68%), Gaps = 8/191 (4%)

Query: 26  DHDG----TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVL 81
           DHD     +  GFW+YLM+DC++FA  F T+AVLG  YA GP   D+FDI G+ V T  L
Sbjct: 16  DHDHPPSHSVFGFWLYLMTDCVIFAALFATFAVLGNQYAGGPTAKDLFDIPGVAVETAAL 75

Query: 82  LLSSLSCSFAML-ASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA 140
           LLSS++  FAML A   KR +  T+ WL VT   G  F+ ME+ EFAHLI+  A PQRSA
Sbjct: 76  LLSSITYGFAMLGAHRGKRGV--TLVWLAVTFVLGAAFLAMELREFAHLIAEGAGPQRSA 133

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQI-LKKGLISGNQRRLICLSMFWHFLDLIWIC 199
           FLS+FF LVG HGLHV  GL+W+ VL  Q+   + L   + RRL CLS+FWHFLD++WIC
Sbjct: 134 FLSAFFTLVGTHGLHVSAGLVWMIVLAAQVAFGRELTERDIRRLTCLSLFWHFLDIVWIC 193

Query: 200 VFSFVYLMGVV 210
           VFSFVYL  V+
Sbjct: 194 VFSFVYLASVI 204


>gi|77361152|ref|YP_340727.1| cytochrome o ubiquinol oxidase subunit III (ubiquinol oxidase chain
           C) [Pseudoalteromonas haloplanktis TAC125]
 gi|76876063|emb|CAI87285.1| cytochrome o ubiquinol oxidase subunit III (Ubiquinol oxidase chain
           C) [Pseudoalteromonas haloplanktis TAC125]
          Length = 215

 Score =  201 bits (511), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 103/203 (50%), Positives = 139/203 (68%), Gaps = 4/203 (1%)

Query: 11  NFSLFYVKDKKESCVDHD---GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPID 67
           N ++   K   ++   HD    T  GFW+YLM+DCL+FA FF TYAVL  N A G +  D
Sbjct: 14  NSAIVNTKQDHDAHAHHDTSSNTTFGFWLYLMTDCLLFASFFATYAVLFMNTAGGVSGKD 73

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
           +F++  + V T  LL+SS++  FAM+A+  ++    T+ WL VT   G++FI ME+YEF 
Sbjct: 74  IFELDFVAVETAALLISSITFGFAMIAAQGQKKA-LTLIWLAVTFCLGVVFISMEVYEFN 132

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
           HLI     PQ+SAFL+SFFALVGLHGLHV  GLIW+ V++I++ K+GL      RL CLS
Sbjct: 133 HLIVHGNGPQKSAFLTSFFALVGLHGLHVTAGLIWMSVMMIEVAKRGLGKATVTRLSCLS 192

Query: 188 MFWHFLDLIWICVFSFVYLMGVV 210
           +FWHFLD++WICVF+ VYLMG +
Sbjct: 193 LFWHFLDIVWICVFTLVYLMGAM 215


>gi|167563462|ref|ZP_02356378.1| ubiquinol oxidase, subunit III [Burkholderia oklahomensis EO147]
 gi|167570630|ref|ZP_02363504.1| ubiquinol oxidase, subunit III [Burkholderia oklahomensis C6786]
          Length = 201

 Score =  201 bits (510), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 130/188 (69%), Gaps = 4/188 (2%)

Query: 26  DHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLL 83
           DH  ++   GFW+YLM+DC++FA  F T+AVLG  +A GP   D+FDI G+ + T  LLL
Sbjct: 15  DHPPSHSVFGFWLYLMTDCIVFAALFATFAVLGNQFAGGPTGKDLFDIPGVALETAALLL 74

Query: 84  SSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLS 143
           SS++  FAM+  A KR       WL VT   G  F+ ME+ EF+HLI+  A PQRSAFLS
Sbjct: 75  SSITYGFAMIG-AHKRRRGAVFGWLAVTFVLGAAFLAMELREFSHLIAEGAGPQRSAFLS 133

Query: 144 SFFALVGLHGLHVFFGLIWLFVLVIQILKKG-LISGNQRRLICLSMFWHFLDLIWICVFS 202
           SFF LVG HGLHV  GL+W+ VL +Q L++  L   + RRL CLS+FWHFLD++WICVFS
Sbjct: 134 SFFTLVGTHGLHVTAGLVWMVVLALQALRRPELTERDVRRLTCLSLFWHFLDIVWICVFS 193

Query: 203 FVYLMGVV 210
           FVYL  V+
Sbjct: 194 FVYLASVI 201


>gi|163857710|ref|YP_001632008.1| cytochrome o ubiquinol oxidase subunit III [Bordetella petrii DSM
           12804]
 gi|163261438|emb|CAP43740.1| cytochrome o ubiquinol oxidase subunit III [Bordetella petrii]
          Length = 208

 Score =  200 bits (509), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 141/196 (71%), Gaps = 4/196 (2%)

Query: 15  FYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
           FY+ ++       +GT LGFW+Y+MSDCL+FA  F TY VLG+NY  GP   D+F++  +
Sbjct: 16  FYLTEEHHV---KNGTLLGFWVYVMSDCLIFACLFATYGVLGRNYDGGPTGADLFELPLV 72

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            ++T +LLLSS++  FA+L     R +   + WL VT   G  F+ +EIYEFAHLI+  A
Sbjct: 73  ALNTSLLLLSSITYGFALLQGRKGR-VGSLLGWLAVTGLLGAGFLGLEIYEFAHLIAEGA 131

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            PQRSAFLS+FF LVG HGLHV FGL+WL VL++QI   GLI  N+RRL+CLSMFWHFLD
Sbjct: 132 GPQRSAFLSAFFTLVGTHGLHVTFGLVWLVVLMVQIGMHGLIIPNKRRLMCLSMFWHFLD 191

Query: 195 LIWICVFSFVYLMGVV 210
           ++WI VF+ VYLMGV+
Sbjct: 192 VVWIGVFTVVYLMGVL 207


>gi|83719897|ref|YP_442318.1| cytochrome c oxidase subunit III [Burkholderia thailandensis E264]
 gi|167619298|ref|ZP_02387929.1| Cytochrome c oxidase subunit III [Burkholderia thailandensis Bt4]
 gi|257138515|ref|ZP_05586777.1| cytochrome c oxidase subunit III [Burkholderia thailandensis E264]
 gi|83653722|gb|ABC37785.1| Cytochrome c oxidase subunit III [Burkholderia thailandensis E264]
          Length = 201

 Score =  200 bits (509), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 130/188 (69%), Gaps = 4/188 (2%)

Query: 26  DHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLL 83
           DH  ++   GFW+YLM+DC++FA  F T+AVLG  +A GP   D+FDI G+ + T  LLL
Sbjct: 15  DHPPSHSVFGFWLYLMTDCVLFAALFATFAVLGNQFAGGPTAKDLFDIPGVALETAALLL 74

Query: 84  SSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLS 143
           SS++  FAM+  A KR       WL VT   G  F+ ME+ EF+HLI+  A PQRSAFLS
Sbjct: 75  SSITYGFAMIG-AHKRRRGAVFGWLAVTFVLGAAFLAMELREFSHLIAEGAGPQRSAFLS 133

Query: 144 SFFALVGLHGLHVFFGLIWLFVLVIQILKKG-LISGNQRRLICLSMFWHFLDLIWICVFS 202
           SFF LV  HGLHV  GL+W+ VLV+Q L++  L   + RRL CLS+FWHFLD++WICVFS
Sbjct: 134 SFFTLVATHGLHVTAGLLWMAVLVVQALRRPELTERDIRRLTCLSLFWHFLDIVWICVFS 193

Query: 203 FVYLMGVV 210
           FVYL  V+
Sbjct: 194 FVYLASVI 201


>gi|134296912|ref|YP_001120647.1| cytochrome c oxidase subunit III [Burkholderia vietnamiensis G4]
 gi|134140069|gb|ABO55812.1| cytochrome bo3 quinol oxidase subunit 3 [Burkholderia vietnamiensis
           G4]
          Length = 203

 Score =  200 bits (509), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 100/179 (55%), Positives = 128/179 (71%), Gaps = 2/179 (1%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLM+DC++FA  F T+AVLG  +A GP   D+FDI G+ + T  LLLSS++  FAM
Sbjct: 26  GFWLYLMTDCVIFASLFATFAVLGNQFAGGPTAKDLFDIPGVALETAALLLSSITYGFAM 85

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           L  A +R       WL VT   G  F+ ME+ EF+HLI+  A PQRSAFLS+FFALVG H
Sbjct: 86  LG-AQRRRRGAVFVWLAVTFVLGAAFLAMELREFSHLIADGAGPQRSAFLSAFFALVGTH 144

Query: 153 GLHVFFGLIWLFVLVIQILK-KGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GL+W+ VLV+Q+ +  G+   + RRL CLS+FWHFLD++WICVFSFVYL  V+
Sbjct: 145 GLHVAVGLLWMVVLVVQMARGSGMTERDVRRLTCLSLFWHFLDIVWICVFSFVYLASVI 203


>gi|167720490|ref|ZP_02403726.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           pseudomallei DM98]
 gi|254191301|ref|ZP_04897805.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei Pasteur
           52237]
 gi|157938973|gb|EDO94643.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei Pasteur
           52237]
          Length = 201

 Score =  200 bits (509), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 101/188 (53%), Positives = 130/188 (69%), Gaps = 4/188 (2%)

Query: 26  DHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLL 83
           DH  ++   GFW+YLM+DC++FA  F T+AVLG  +A GP   D+FDI G+ + T  LLL
Sbjct: 15  DHPPSHSVFGFWLYLMTDCVLFAALFATFAVLGNQFAGGPTAKDLFDIPGVALETAALLL 74

Query: 84  SSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLS 143
           SS++  FAM+  A +R       WL VT   G  F+ ME+ EF+HL++  A PQRSAFLS
Sbjct: 75  SSITYGFAMIG-AHQRRRGAVFGWLAVTFVLGAAFLAMELREFSHLVAEGAGPQRSAFLS 133

Query: 144 SFFALVGLHGLHVFFGLIWLFVLVIQILKK-GLISGNQRRLICLSMFWHFLDLIWICVFS 202
           SFF LVG HGLHV  GL+W+ VLV Q L++  L   + RRL CLS+FWHFLD++WICVFS
Sbjct: 134 SFFTLVGTHGLHVTAGLVWMAVLVAQALRRPDLTERDIRRLTCLSLFWHFLDIVWICVFS 193

Query: 203 FVYLMGVV 210
           FVYL  V+
Sbjct: 194 FVYLASVI 201


>gi|260221200|emb|CBA29527.1| Cytochrome o ubiquinol oxidase subunit 3 [Curvibacter putative
           symbiont of Hydra magnipapillata]
          Length = 179

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 133/179 (74%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFW+YLMSDCL+FA  F TY VLG++YAAGP   ++FD++ + ++T  LL SS++  FA
Sbjct: 2   LGFWLYLMSDCLIFAALFATYGVLGRSYAAGPNGAELFDLTLVAINTGFLLFSSITFGFA 61

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           ML       +  T+ WL VT   G+ F+ +E+YEF HLI   A PQRSAFLS+FF LVG 
Sbjct: 62  MLRKQLGD-VKGTLIWLAVTGLLGLCFLGLELYEFHHLIQEGAGPQRSAFLSAFFTLVGT 120

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HGLHV FGLIWL VL++QI + GL   N RRL+CLSMFWHFLD+IWI VF+FVYLMGV+
Sbjct: 121 HGLHVTFGLIWLVVLMLQIKQHGLTPANNRRLMCLSMFWHFLDVIWIGVFTFVYLMGVL 179


>gi|126453691|ref|YP_001067025.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 1106a]
 gi|167846590|ref|ZP_02472098.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei B7210]
 gi|237813134|ref|YP_002897585.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia
           pseudomallei MSHR346]
 gi|242315461|ref|ZP_04814477.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 1106b]
 gi|126227333|gb|ABN90873.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 1106a]
 gi|237505149|gb|ACQ97467.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia
           pseudomallei MSHR346]
 gi|242138700|gb|EES25102.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 1106b]
          Length = 201

 Score =  200 bits (508), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 101/188 (53%), Positives = 130/188 (69%), Gaps = 4/188 (2%)

Query: 26  DHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLL 83
           DH  ++   GFW+YLM+DC++FA  F T+AVLG  +A GP   D+FDI G+ + T  LLL
Sbjct: 15  DHPPSHSVFGFWLYLMTDCVLFAALFATFAVLGNQFAGGPTAKDLFDIPGVALETAALLL 74

Query: 84  SSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLS 143
           SS++  FAM+  A +R       WL VT   G  F+ ME+ EF+HL++  A PQRSAFLS
Sbjct: 75  SSITYGFAMIG-AHQRRRGAVFGWLAVTFVLGAAFLAMELREFSHLVAEGAGPQRSAFLS 133

Query: 144 SFFALVGLHGLHVFFGLIWLFVLVIQILKK-GLISGNQRRLICLSMFWHFLDLIWICVFS 202
           SFF LVG HGLHV  GL+W+ VLV Q L++  L   + RRL CLS+FWHFLD++WICVFS
Sbjct: 134 SFFTLVGTHGLHVTAGLVWMAVLVAQALRRPDLTERDIRRLTCLSLFWHFLDIVWICVFS 193

Query: 203 FVYLMGVV 210
           FVYL  V+
Sbjct: 194 FVYLASVI 201


>gi|53719987|ref|YP_108973.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           pseudomallei K96243]
 gi|167816683|ref|ZP_02448363.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           pseudomallei 91]
 gi|167903560|ref|ZP_02490765.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           pseudomallei NCTC 13177]
 gi|217421180|ref|ZP_03452685.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia
           pseudomallei 576]
 gi|52210401|emb|CAH36382.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           pseudomallei K96243]
 gi|217396592|gb|EEC36609.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia
           pseudomallei 576]
          Length = 201

 Score =  200 bits (508), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 101/188 (53%), Positives = 130/188 (69%), Gaps = 4/188 (2%)

Query: 26  DHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLL 83
           DH  ++   GFW+YLM+DC++FA  F T+AVLG  +A GP   D+FDI G+ + T  LLL
Sbjct: 15  DHPPSHSVFGFWLYLMTDCVLFAALFATFAVLGNQFAGGPTAKDLFDIPGVALETAALLL 74

Query: 84  SSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLS 143
           SS++  FAM+  A +R       WL VT   G  F+ ME+ EF+HL++  A PQRSAFLS
Sbjct: 75  SSITYGFAMIG-AHQRRRGAVFGWLAVTFVLGAAFLAMELREFSHLVAEGAGPQRSAFLS 133

Query: 144 SFFALVGLHGLHVFFGLIWLFVLVIQILKKG-LISGNQRRLICLSMFWHFLDLIWICVFS 202
           SFF LVG HGLHV  GL+W+ VLV Q L++  L   + RRL CLS+FWHFLD++WICVFS
Sbjct: 134 SFFTLVGTHGLHVTAGLVWMAVLVAQALRRPELTERDIRRLTCLSLFWHFLDIVWICVFS 193

Query: 203 FVYLMGVV 210
           FVYL  V+
Sbjct: 194 FVYLASVI 201


>gi|126441942|ref|YP_001059740.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 668]
 gi|134277941|ref|ZP_01764656.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 305]
 gi|167744574|ref|ZP_02417348.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 14]
 gi|167895176|ref|ZP_02482578.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 7894]
 gi|167919810|ref|ZP_02506901.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei BCC215]
 gi|254184266|ref|ZP_04890856.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 1655]
 gi|126221435|gb|ABN84941.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia
           pseudomallei 668]
 gi|134251591|gb|EBA51670.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 305]
 gi|184214797|gb|EDU11840.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 1655]
          Length = 201

 Score =  200 bits (508), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 101/188 (53%), Positives = 130/188 (69%), Gaps = 4/188 (2%)

Query: 26  DHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLL 83
           DH  ++   GFW+YLM+DC++FA  F T+AVLG  +A GP   D+FDI G+ + T  LLL
Sbjct: 15  DHPPSHSVFGFWLYLMTDCVLFAALFATFAVLGNQFAGGPTAKDLFDIPGVALETAALLL 74

Query: 84  SSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLS 143
           SS++  FAM+  A +R       WL VT   G  F+ ME+ EF+HL++  A PQRSAFLS
Sbjct: 75  SSITYGFAMIG-AHQRRRGAVFGWLAVTFVLGAAFLAMELREFSHLVAEGAGPQRSAFLS 133

Query: 144 SFFALVGLHGLHVFFGLIWLFVLVIQILKKG-LISGNQRRLICLSMFWHFLDLIWICVFS 202
           SFF LVG HGLHV  GL+W+ VLV Q L++  L   + RRL CLS+FWHFLD++WICVFS
Sbjct: 134 SFFTLVGTHGLHVTAGLVWMAVLVAQALRRPELTERDIRRLTCLSLFWHFLDIVWICVFS 193

Query: 203 FVYLMGVV 210
           FVYL  V+
Sbjct: 194 FVYLASVI 201


>gi|117617508|ref|YP_857448.1| cytochrome o ubiquinol oxidase subunit III [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|117558915|gb|ABK35863.1| cytochrome o ubiquinol oxidase, subunit III [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 203

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 127/178 (71%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++FA  F TYAVL    A GP+  D+F++  +F  T++LLLSS++  F M
Sbjct: 27  GFWIYLMSDCILFATLFATYAVLVNGTAGGPSGKDIFELPFVFAETMLLLLSSITFGFGM 86

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           LA   K  +    +WL +T  FG  FI MEIYEF HLI+    P RS FLS+FF LVG H
Sbjct: 87  LA-MNKNKVAAVNTWLFITFLFGAGFIAMEIYEFHHLIAEGYGPDRSGFLSAFFTLVGTH 145

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           G+HV  GLIW+ V+++ + KKGL   N+ RL+CLS+FWHFLD++WICVF+ VYLMGV+
Sbjct: 146 GIHVTSGLIWIIVMMVLVAKKGLTDRNRTRLMCLSLFWHFLDVVWICVFTVVYLMGVM 203


>gi|163857013|ref|YP_001631311.1| cytochrome o ubiquinol oxidase subunit III [Bordetella petrii DSM
           12804]
 gi|163260741|emb|CAP43043.1| cytochrome o ubiquinol oxidase subunit III [Bordetella petrii]
          Length = 203

 Score =  199 bits (506), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 130/185 (70%), Gaps = 1/185 (0%)

Query: 26  DHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS 85
           D   T  GFWIYLMSD L+F+V F T+AVL K  A GP   ++FD+S + V T++LL+SS
Sbjct: 20  DGSKTVFGFWIYLMSDLLIFSVLFATFAVLSKATAGGPTGAELFDLSFVLVETMLLLISS 79

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSF 145
            +   AML     R   + + WL VT  FG  FI MEIYEF HLI+  A PQRSA+LS+F
Sbjct: 80  FTFGMAMLNLHAGR-ARRVIGWLCVTFLFGAGFIGMEIYEFHHLITEGAGPQRSAYLSAF 138

Query: 146 FALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
           F L+G HGLHV FGL+W+ V+V  + + GL S N RRL CLS+FWHFLD++WICVF+FVY
Sbjct: 139 FTLIGTHGLHVTFGLVWIAVMVDMVRRHGLDSVNVRRLSCLSLFWHFLDIVWICVFTFVY 198

Query: 206 LMGVV 210
           L+G +
Sbjct: 199 LLGAL 203


>gi|319945342|ref|ZP_08019604.1| cytochrome o ubiquinol oxidase subunit III [Lautropia mirabilis
           ATCC 51599]
 gi|319741912|gb|EFV94337.1| cytochrome o ubiquinol oxidase subunit III [Lautropia mirabilis
           ATCC 51599]
          Length = 210

 Score =  199 bits (506), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 133/188 (70%), Gaps = 1/188 (0%)

Query: 21  KESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIV 80
            E+    +GT LGFW++L+ D L+FA  F  YAVLG++YA G +  D+FD+  + +ST +
Sbjct: 21  TEAHPPENGTMLGFWLFLIGDLLLFACLFAAYAVLGRSYATGFSGADIFDLKLVALSTAL 80

Query: 81  LLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA 140
           LL +S S    ++A       H T+ WL +T  FG+ F+ +EI+ F H+I M A PQRSA
Sbjct: 81  LLCASFSGGHGVVAMQDSE-KHATLGWLALTGLFGLTFLGIEIHAFNHMIGMGATPQRSA 139

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICV 200
           FLS+FFALVG+HGLHV FGL+WL  L++Q+ + GLI  N+RR+ CL++FWHFLD++W+ V
Sbjct: 140 FLSAFFALVGIHGLHVAFGLVWLITLLVQVGQHGLIPANRRRIRCLTLFWHFLDVVWVAV 199

Query: 201 FSFVYLMG 208
           FS VYL+G
Sbjct: 200 FSLVYLIG 207


>gi|107028751|ref|YP_625846.1| cytochrome c oxidase, subunit III [Burkholderia cenocepacia AU
           1054]
 gi|116690090|ref|YP_835713.1| cytochrome c oxidase, subunit III [Burkholderia cenocepacia HI2424]
 gi|170733424|ref|YP_001765371.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           cenocepacia MC0-3]
 gi|105897915|gb|ABF80873.1| cytochrome bo3 quinol oxidase subunit 3 [Burkholderia cenocepacia
           AU 1054]
 gi|116648179|gb|ABK08820.1| cytochrome bo3 quinol oxidase subunit 3 [Burkholderia cenocepacia
           HI2424]
 gi|169816666|gb|ACA91249.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia
           cenocepacia MC0-3]
          Length = 202

 Score =  199 bits (506), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 103/200 (51%), Positives = 135/200 (67%), Gaps = 8/200 (4%)

Query: 18  KDKKESCVDHDG-----TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
           K    + ++HD      +  GFW+YLM+DC++FA  F T+AVLG  YA G    ++FDI 
Sbjct: 4   KTLSATLLEHDDHPPSHSVFGFWLYLMTDCVIFAALFATFAVLGHQYAGGQTAKELFDIP 63

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
           G+ V T  LLLSS++  FAMLA+  +R     ++WL VT   G  F+ ME+ EF+HLI+ 
Sbjct: 64  GVAVETAALLLSSITYGFAMLAAYQQRR-GALLAWLAVTFVLGAAFLTMELREFSHLIAE 122

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLICLSMFW 190
            A PQRSAFLS+FF LVG HGLHV  GL+W+ VL  QI+ +G  L   + RRL CLS+FW
Sbjct: 123 GAGPQRSAFLSAFFTLVGTHGLHVTAGLLWMIVLAAQIVLRGGDLTDRDLRRLTCLSLFW 182

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD++WICVFSFVYL  V+
Sbjct: 183 HFLDIVWICVFSFVYLASVI 202


>gi|134296074|ref|YP_001119809.1| cytochrome c oxidase subunit III [Burkholderia vietnamiensis G4]
 gi|134139231|gb|ABO54974.1| cytochrome bo3 quinol oxidase subunit 3 [Burkholderia vietnamiensis
           G4]
          Length = 202

 Score =  199 bits (506), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 133/200 (66%), Gaps = 8/200 (4%)

Query: 18  KDKKESCVDHDG-----TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
           K    + ++HD      +  GFW+YLM+DC++FA  F T+AVLG   A GP   D+FDI 
Sbjct: 4   KTLSATLLEHDDHPPSHSVFGFWLYLMTDCVIFAALFATFAVLGNQTAGGPTAKDLFDIP 63

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
           G+ V T  LLLSS++  FAMLA   +R     + WL VT   G  F+ ME+ EF+HLI+ 
Sbjct: 64  GVAVETAALLLSSITYGFAMLAGYKQRR-GALLGWLAVTFVLGAAFLAMELREFSHLIAD 122

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLICLSMFW 190
            A PQRSAFLS+FF LVG HGLHV  GL+W+ VL  QI+ +G  L   + RRL CLS+FW
Sbjct: 123 GAGPQRSAFLSAFFTLVGTHGLHVTAGLLWMIVLAGQIVLRGGDLTDRDLRRLTCLSLFW 182

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD++WICVFSFVYL  V+
Sbjct: 183 HFLDIVWICVFSFVYLASVI 202


>gi|71274826|ref|ZP_00651114.1| Cytochrome c oxidase, subunit III [Xylella fastidiosa Dixon]
 gi|71899872|ref|ZP_00682021.1| Cytochrome c oxidase, subunit III [Xylella fastidiosa Ann-1]
 gi|170729929|ref|YP_001775362.1| cytochrome o ubiquinol oxidase subunit III [Xylella fastidiosa M12]
 gi|71164558|gb|EAO14272.1| Cytochrome c oxidase, subunit III [Xylella fastidiosa Dixon]
 gi|71730389|gb|EAO32471.1| Cytochrome c oxidase, subunit III [Xylella fastidiosa Ann-1]
 gi|167964722|gb|ACA11732.1| cytochrome o ubiquinol oxidase subunit III [Xylella fastidiosa M12]
          Length = 202

 Score =  199 bits (505), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 104/183 (56%), Positives = 127/183 (69%), Gaps = 1/183 (0%)

Query: 28  DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
           D T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL SSL+
Sbjct: 21  DNTVFGFWVYLMSDCLIFAGLFATYAVLVGATVDGPTAKELFDLKFVLVETFLLLFSSLT 80

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
             FAM+A A KR I     WL+VTA FG+ F+ ME+YEF HLI   A P RSAFLS+FF 
Sbjct: 81  FGFAMIA-AHKRHIPALYGWLMVTALFGLGFLGMELYEFHHLIQEGAGPGRSAFLSAFFT 139

Query: 148 LVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           LVG HGLHV  GL+W+ +LVIQI+K GL   N  RL CLS+FWHFL +IWI VF+ VYL+
Sbjct: 140 LVGTHGLHVASGLLWMLILVIQIVKNGLTPRNSTRLACLSLFWHFLGVIWIGVFTIVYLL 199

Query: 208 GVV 210
           G +
Sbjct: 200 GAL 202


>gi|254247835|ref|ZP_04941156.1| Cytochrome C oxidase subunit III [Burkholderia cenocepacia PC184]
 gi|124872611|gb|EAY64327.1| Cytochrome C oxidase subunit III [Burkholderia cenocepacia PC184]
          Length = 202

 Score =  199 bits (505), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 135/200 (67%), Gaps = 8/200 (4%)

Query: 18  KDKKESCVDHDG-----TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
           K    + ++HD      +  GFW+YLM+DC++FA  F T+AVLG  YA G    ++FDI 
Sbjct: 4   KTLSATLLEHDDHPPSHSVFGFWLYLMTDCVIFAALFATFAVLGHQYAGGQTAKELFDIP 63

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
           G+ V T  LLLSS++  FAMLA+  +R     ++WL VT   G  F+ ME+ EF+HL++ 
Sbjct: 64  GVAVETAALLLSSITYGFAMLAAYQQRR-GALLAWLAVTFVLGAAFLTMELREFSHLVAE 122

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLICLSMFW 190
            A PQRSAFLS+FF LVG HGLHV  GL+W+ VL  QI+ +G  L   + RRL CLS+FW
Sbjct: 123 GAGPQRSAFLSAFFTLVGTHGLHVTAGLLWMIVLAAQIVLRGGDLTDRDLRRLTCLSLFW 182

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD++WICVFSFVYL  V+
Sbjct: 183 HFLDIVWICVFSFVYLASVI 202


>gi|206560506|ref|YP_002231270.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           cenocepacia J2315]
 gi|198036547|emb|CAR52444.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           cenocepacia J2315]
          Length = 202

 Score =  198 bits (504), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 135/200 (67%), Gaps = 8/200 (4%)

Query: 18  KDKKESCVDHDG-----TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
           K    + ++HD      +  GFW+YLM+DC++FA  F T+AVLG  YA G    ++FDI 
Sbjct: 4   KTLSATLLEHDDHPPSHSVFGFWLYLMTDCVIFAALFATFAVLGHQYAGGQTAKELFDIP 63

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
           G+ V T  LLLSS++  FAMLA A K+     ++WL VT   G  F+ ME+ EF+HLI+ 
Sbjct: 64  GVAVETAALLLSSITYGFAMLA-AYKQQRGALLAWLAVTFVLGAAFLAMELREFSHLIAE 122

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLICLSMFW 190
            A PQRSAFLS+FF LVG HGLHV  GL+W+ VL  QI+ +G  L   + RRL CLS+FW
Sbjct: 123 GAGPQRSAFLSAFFTLVGTHGLHVTAGLLWMLVLAAQIVFRGGDLTDRDLRRLTCLSLFW 182

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD++WICVFSFVYL  V+
Sbjct: 183 HFLDIVWICVFSFVYLASVI 202


>gi|325522319|gb|EGD00931.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia sp. TJI49]
          Length = 202

 Score =  198 bits (503), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 134/200 (67%), Gaps = 8/200 (4%)

Query: 18  KDKKESCVDHDG-----TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
           K    + ++HD      +  GFW+YLM+DC++FA  F T+AVLG  YA G    ++FDI 
Sbjct: 4   KTLSATLLEHDDHPPSHSVFGFWLYLMTDCVIFAALFATFAVLGHQYAGGQTAKELFDIP 63

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
           G+ V T  LLLSS++  FAML++  +R     + WL VT   G  F+ ME+ EF+HLI+ 
Sbjct: 64  GVAVETAALLLSSITYGFAMLSAYQQRR-GALLGWLAVTFVLGAAFLAMELREFSHLIAE 122

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLICLSMFW 190
            A PQRSAFLS+FF LVG HGLHV  GL+W+ VL  QI+ +G  L   + RRL CLS+FW
Sbjct: 123 GAGPQRSAFLSAFFTLVGTHGLHVTAGLLWMVVLAAQIVSRGGDLTDRDLRRLTCLSLFW 182

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD++WICVFSFVYL  V+
Sbjct: 183 HFLDIVWICVFSFVYLASVI 202


>gi|307129920|ref|YP_003881936.1| cytochrome o ubiquinol oxidase subunit III [Dickeya dadantii 3937]
 gi|306527449|gb|ADM97379.1| cytochrome o ubiquinol oxidase subunit III [Dickeya dadantii 3937]
          Length = 204

 Score =  197 bits (502), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 128/178 (71%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++F + F TYAVL    A GP   ++FD+  + V T  LL SS++   AM
Sbjct: 28  GFWIYLMSDCILFGMLFATYAVLVNGTAGGPTGKELFDLKFVLVETFALLFSSITYGMAM 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K    +  +WL +T  FG++FI MEIYEF HLI+  A P RSAFLS+FFALVG H
Sbjct: 88  IA-MNKGNKSQVNAWLGLTFLFGLVFIGMEIYEFHHLIAEGAGPDRSAFLSAFFALVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           G+HV  GLIW+ +++IQ+ K GL S N+ RL+CLS+FWHFLD++WICVF+ VYLMG +
Sbjct: 147 GIHVTSGLIWIAIMMIQVTKYGLTSRNKTRLMCLSLFWHFLDVVWICVFTVVYLMGAM 204


>gi|15596516|ref|NP_250010.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas aeruginosa
           PAO1]
 gi|116049271|ref|YP_791926.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|152989269|ref|YP_001349425.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas aeruginosa
           PA7]
 gi|218892576|ref|YP_002441445.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas aeruginosa
           LESB58]
 gi|296390304|ref|ZP_06879779.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas aeruginosa
           PAb1]
 gi|313106308|ref|ZP_07792552.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas aeruginosa
           39016]
 gi|81783807|sp|Q9I425|CYOC_PSEAE RecName: Full=Cytochrome o ubiquinol oxidase subunit 3; AltName:
           Full=Cytochrome o ubiquinol oxidase subunit III
 gi|9947257|gb|AAG04708.1|AE004561_4 cytochrome o ubiquinol oxidase subunit III [Pseudomonas aeruginosa
           PAO1]
 gi|115584492|gb|ABJ10507.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|150964427|gb|ABR86452.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas aeruginosa
           PA7]
 gi|218772804|emb|CAW28589.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas aeruginosa
           LESB58]
 gi|310879054|gb|EFQ37648.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas aeruginosa
           39016]
          Length = 209

 Score =  197 bits (501), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 134/202 (66%), Gaps = 8/202 (3%)

Query: 16  YVKDKKESCVDHD-------GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDV 68
           ++ D  E   DHD        T  GFW+YLM+DC++FA  F TYAVL  + A GP+  D+
Sbjct: 9   HLADAHEVGHDHDHAHDSGGNTVFGFWLYLMTDCVLFASVFATYAVLVHHTAGGPSGKDI 68

Query: 69  FDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAH 128
           F++  + V T +LL+SS +   AML SA K    + ++WL VT   G  FI MEI EF H
Sbjct: 69  FELPYVLVETAILLVSSCTYGLAML-SAHKGAKGQAIAWLGVTFLLGAAFIGMEINEFHH 127

Query: 129 LISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSM 188
           LI+    P RSAFLSSFF LVG+HGLHV  GL+W+ VL+ QI  +GL + N  R++CLS+
Sbjct: 128 LIAEGFGPSRSAFLSSFFTLVGMHGLHVSAGLLWMLVLMAQIWTRGLTAQNNTRMMCLSL 187

Query: 189 FWHFLDLIWICVFSFVYLMGVV 210
           FWHFLD++WICVF+ VYLMG +
Sbjct: 188 FWHFLDIVWICVFTVVYLMGAL 209


>gi|49079172|gb|AAT49862.1| PA1319 [synthetic construct]
          Length = 210

 Score =  197 bits (501), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 134/202 (66%), Gaps = 8/202 (3%)

Query: 16  YVKDKKESCVDHD-------GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDV 68
           ++ D  E   DHD        T  GFW+YLM+DC++FA  F TYAVL  + A GP+  D+
Sbjct: 9   HLADAHEVGHDHDHAHDSGGNTVFGFWLYLMTDCVLFASVFATYAVLVHHTAGGPSGKDI 68

Query: 69  FDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAH 128
           F++  + V T +LL+SS +   AML SA K    + ++WL VT   G  FI MEI EF H
Sbjct: 69  FELPYVLVETAILLVSSCTYGLAML-SAHKGAKGQAIAWLGVTFLLGAAFIGMEINEFHH 127

Query: 129 LISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSM 188
           LI+    P RSAFLSSFF LVG+HGLHV  GL+W+ VL+ QI  +GL + N  R++CLS+
Sbjct: 128 LIAEGFGPSRSAFLSSFFTLVGMHGLHVSAGLLWMLVLMAQIWTRGLTAQNNTRMMCLSL 187

Query: 189 FWHFLDLIWICVFSFVYLMGVV 210
           FWHFLD++WICVF+ VYLMG +
Sbjct: 188 FWHFLDIVWICVFTVVYLMGAL 209


>gi|107100770|ref|ZP_01364688.1| hypothetical protein PaerPA_01001798 [Pseudomonas aeruginosa PACS2]
          Length = 204

 Score =  197 bits (501), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 134/202 (66%), Gaps = 8/202 (3%)

Query: 16  YVKDKKESCVDHD-------GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDV 68
           ++ D  E   DHD        T  GFW+YLM+DC++FA  F TYAVL  + A GP+  D+
Sbjct: 4   HLADAHEVGHDHDHAHDSGGNTVFGFWLYLMTDCVLFASVFATYAVLVHHTAGGPSGKDI 63

Query: 69  FDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAH 128
           F++  + V T +LL+SS +   AML SA K    + ++WL VT   G  FI MEI EF H
Sbjct: 64  FELPYVLVETAILLVSSCTYGLAML-SAHKGAKGQAIAWLGVTFLLGAAFIGMEINEFHH 122

Query: 129 LISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSM 188
           LI+    P RSAFLSSFF LVG+HGLHV  GL+W+ VL+ QI  +GL + N  R++CLS+
Sbjct: 123 LIAEGFGPSRSAFLSSFFTLVGMHGLHVSAGLLWMLVLMAQIWTRGLTAQNNTRMMCLSL 182

Query: 189 FWHFLDLIWICVFSFVYLMGVV 210
           FWHFLD++WICVF+ VYLMG +
Sbjct: 183 FWHFLDIVWICVFTVVYLMGAL 204


>gi|254234441|ref|ZP_04927764.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas aeruginosa
           C3719]
 gi|126166372|gb|EAZ51883.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas aeruginosa
           C3719]
          Length = 209

 Score =  197 bits (501), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 134/202 (66%), Gaps = 8/202 (3%)

Query: 16  YVKDKKESCVDHD-------GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDV 68
           ++ D  E   DHD        T  GFW+YLM+DC++FA  F TYAVL  + A GP+  D+
Sbjct: 9   HLADAHEVGHDHDHAHDSGGNTVFGFWLYLMTDCVLFASVFATYAVLVHHTAGGPSGKDI 68

Query: 69  FDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAH 128
           F++  + V T +LL+SS +   AML SA K    + ++WL VT   G  FI MEI EF H
Sbjct: 69  FELPYVLVETAILLVSSCTYGLAML-SAHKGAKGQAIAWLGVTFLLGAAFIGMEINEFHH 127

Query: 129 LISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSM 188
           LI+    P RSAFLSSFF LVG+HGLHV  GL+W+ VL+ QI  +GL + N  R++CLS+
Sbjct: 128 LIAEGFGPSRSAFLSSFFTLVGMHGLHVSAGLLWMLVLMAQIWTRGLTAQNNTRMMCLSL 187

Query: 189 FWHFLDLIWICVFSFVYLMGVV 210
           FWHFLD++WICVF+ VY+MG +
Sbjct: 188 FWHFLDMVWICVFTVVYMMGAL 209


>gi|251790655|ref|YP_003005376.1| cytochrome o ubiquinol oxidase subunit III [Dickeya zeae Ech1591]
 gi|247539276|gb|ACT07897.1| cytochrome o ubiquinol oxidase, subunit III [Dickeya zeae Ech1591]
          Length = 204

 Score =  197 bits (501), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 99/178 (55%), Positives = 128/178 (71%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++F + F TYAVL    A GP   ++FD+  + V T  LL SS++   AM
Sbjct: 28  GFWIYLMSDCILFGMLFATYAVLVNGTAGGPTGKELFDLKFVLVETFALLFSSITYGMAM 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K    +  +WL +T  FG++FI MEIYEF HLI+  A P RSAFLS+FFALVG H
Sbjct: 88  IA-MNKGNKSQVNAWLGLTFLFGLVFIGMEIYEFHHLIAEGAGPDRSAFLSAFFALVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           G+HV  GLIW+ V++IQ+ K GL S N+ RL+CLS+FWHFLD++WICVF+ VYLMG +
Sbjct: 147 GIHVTSGLIWIAVMMIQVSKFGLTSTNKTRLMCLSLFWHFLDVVWICVFTVVYLMGAM 204


>gi|188534642|ref|YP_001908439.1| Cytochrome o ubiquinol oxidase subunit III [Erwinia tasmaniensis
           Et1/99]
 gi|188029684|emb|CAO97563.1| Cytochrome o ubiquinol oxidase subunit III [Erwinia tasmaniensis
           Et1/99]
          Length = 204

 Score =  197 bits (500), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 127/178 (71%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++FA  F TY V+  N A GPA  D+F++  + V T +LLLSS++  FA+
Sbjct: 28  GFWIYLMSDCIIFATLFATYGVMVNNTAGGPAGKDIFELPFVLVETALLLLSSITYGFAV 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           + +  K      + WL +T  FG+ FI MEIYEF HLI+    P RS FLS+FF LVG H
Sbjct: 88  I-NMNKGQKGAVIGWLAMTFLFGLGFIGMEIYEFHHLIAEGFGPDRSGFLSAFFTLVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+ VL+ Q+ K+GL   N+ R++CLS+FWHFLD++WICVF+ VYLMGV+
Sbjct: 147 GLHVTSGLIWMLVLMYQVAKRGLSDSNRTRIMCLSLFWHFLDVVWICVFTIVYLMGVM 204


>gi|317492922|ref|ZP_07951346.1| cytochrome o ubiquinol oxidase [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316919044|gb|EFV40379.1| cytochrome o ubiquinol oxidase [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 206

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 101/196 (51%), Positives = 134/196 (68%), Gaps = 7/196 (3%)

Query: 21  KESCVDH------DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
           +E+  +H      D    GFW+YLMSDC++FA  F TYAVL    A GP+  D+F++  +
Sbjct: 12  QEAHAEHGHHDAGDTKVFGFWVYLMSDCILFASLFATYAVLVNGTADGPSGKDIFELPFV 71

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            V T +LL SS++  FAMLA   K  +    +WL +T  FG  FI MEIYEF HLI+   
Sbjct: 72  LVETFLLLFSSITYGFAMLA-MNKGKVASVNTWLGLTFLFGAGFIAMEIYEFHHLIAEGF 130

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            P +SAFLS+FF LVG HG+HV  GLIW+ V++IQ+ KKGL + N+ RL+CLS+FWHFLD
Sbjct: 131 GPDKSAFLSAFFTLVGTHGIHVTSGLIWIIVMMIQVGKKGLTARNRTRLMCLSLFWHFLD 190

Query: 195 LIWICVFSFVYLMGVV 210
           ++WICVF+ VYLMG +
Sbjct: 191 VVWICVFTVVYLMGAM 206


>gi|293392552|ref|ZP_06636872.1| quinol oxidase subunit III [Serratia odorifera DSM 4582]
 gi|291424954|gb|EFE98163.1| quinol oxidase subunit III [Serratia odorifera DSM 4582]
          Length = 204

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 127/178 (71%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++FA  F TYAVL    A GP+  D+FD+  + V T +LL SS++   AM
Sbjct: 28  GFWIYLMSDCILFASLFATYAVLVNGTAGGPSGKDIFDLKFVLVETFLLLFSSITYGMAM 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +    K  +    +WL +T  FG+ F+ MEIYEF HLI+    P  SAFLSSFFALVG H
Sbjct: 88  IG-MNKGKVGSVNTWLFLTFLFGLGFVAMEIYEFHHLIAEGFGPDHSAFLSSFFALVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GL+W+ +++IQ+ K GL S N+ RL+CLS+FWHFLD++WICVF+ VYL+GV+
Sbjct: 147 GLHVSAGLVWIIIMMIQVSKHGLTSTNKTRLMCLSLFWHFLDVVWICVFTVVYLLGVM 204


>gi|167585491|ref|ZP_02377879.1| cytochrome c oxidase, subunit III [Burkholderia ubonensis Bu]
          Length = 203

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 100/179 (55%), Positives = 127/179 (70%), Gaps = 2/179 (1%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLM+DC++FA  F T+AVLG  +A GP   D+FDI G+ + T  LLLSS++  FAM
Sbjct: 26  GFWLYLMTDCVIFASLFATFAVLGNQFAGGPTAKDLFDIPGVALETAALLLSSITYGFAM 85

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           L  A +R       WL VT   G+ F+ ME+ EF+HLI+  A P RSAFLS+FFALVG H
Sbjct: 86  LG-AQRRRRGAVFVWLAVTFVLGVAFLAMELREFSHLIAEGAGPGRSAFLSAFFALVGTH 144

Query: 153 GLHVFFGLIWLFVLVIQIL-KKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GL+W+ VLV+QI    G+   + RRL CLS+FWHFLD++WICVFSFVYL  V+
Sbjct: 145 GLHVAVGLLWMVVLVVQIACGPGMTERDFRRLTCLSLFWHFLDIVWICVFSFVYLASVI 203


>gi|304395492|ref|ZP_07377375.1| cytochrome o ubiquinol oxidase, subunit III [Pantoea sp. aB]
 gi|304356786|gb|EFM21150.1| cytochrome o ubiquinol oxidase, subunit III [Pantoea sp. aB]
          Length = 204

 Score =  196 bits (499), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 132/201 (65%), Gaps = 4/201 (1%)

Query: 13  SLFYVKDKKESCVDHD---GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVF 69
           +L +  D       HD       GFWIYLMSDC++FA  F TYAV+  N A GPA  D+F
Sbjct: 5   TLKHHHDAHAEHGHHDAGANKVFGFWIYLMSDCIIFATLFATYAVMVNNTAGGPAGKDIF 64

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++  + V T +LLLSS++   A++ S  K      + WL +T  FG+ FI MEIYEF HL
Sbjct: 65  ELPFVLVETALLLLSSITYGMAVI-SMNKEQKGAVIGWLALTFLFGLGFIGMEIYEFHHL 123

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
           I+    P RS FLS FF LVG HGLHV  GLIW+ VL+ Q+ K+GL + N+ R++CLS+F
Sbjct: 124 IAEGFGPDRSGFLSGFFTLVGTHGLHVTSGLIWMLVLMFQVSKRGLNATNRTRIMCLSLF 183

Query: 190 WHFLDLIWICVFSFVYLMGVV 210
           WHFLD++WICVF+ VYLMG +
Sbjct: 184 WHFLDVVWICVFTVVYLMGAM 204


>gi|259909262|ref|YP_002649618.1| Cytochrome o ubiquinol oxidase subunit III [Erwinia pyrifoliae
           Ep1/96]
 gi|224964884|emb|CAX56406.1| Cytochrome o ubiquinol oxidase subunit III [Erwinia pyrifoliae
           Ep1/96]
 gi|283479314|emb|CAY75230.1| cytochrome o ubiquinol oxidase subunit III [Erwinia pyrifoliae DSM
           12163]
 gi|310766835|gb|ADP11785.1| Cytochrome o ubiquinol oxidase subunit III [Erwinia sp. Ejp617]
          Length = 204

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 126/178 (70%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++FA  F TY V+  N A GPA  D+F++  + V T +LLLSS++  FA+
Sbjct: 28  GFWIYLMSDCIIFATLFATYGVMVNNTAGGPAGKDIFELPFVLVETALLLLSSITYGFAV 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           + +  K      + WL +T  FG+ FI MEIYEF HLI+    P RS FLS FF LVG H
Sbjct: 88  I-NMNKGQKGAVIGWLALTFLFGLGFIGMEIYEFHHLIAEGFGPDRSGFLSGFFTLVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+ VL+ Q+ K+GL   N+ R++CLS+FWHFLD++WICVF+ VYLMGV+
Sbjct: 147 GLHVTSGLIWMLVLMYQVAKRGLNDTNRTRIMCLSLFWHFLDVVWICVFTIVYLMGVM 204


>gi|325914850|ref|ZP_08177185.1| cytochrome bo3 quinol oxidase subunit 3 [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325538941|gb|EGD10602.1| cytochrome bo3 quinol oxidase subunit 3 [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 210

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 103/181 (56%), Positives = 126/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL+SSLS  
Sbjct: 31  TVFGFWVYLMSDCLLFAGLFATYAVLSGATVDGPTAKELFDLKFVLVETFLLLISSLSFG 90

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAM+A A KR +     WL VTA  G+ F+ ME++EF HLI   A P RSAFLS+FF LV
Sbjct: 91  FAMIA-AHKRKMGGLYGWLAVTALLGIGFLCMEVWEFNHLIHEGAGPGRSAFLSAFFTLV 149

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GL+W+ VLVIQI K GL + N  RL CLS+FWHFLD+IWI VF+ VYL+G 
Sbjct: 150 GTHGLHVASGLLWMAVLVIQISKNGLTARNSTRLACLSLFWHFLDIIWIGVFTVVYLLGA 209

Query: 210 V 210
           +
Sbjct: 210 L 210


>gi|193068624|ref|ZP_03049585.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           E110019]
 gi|192957987|gb|EDV88429.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           E110019]
          Length = 204

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 100/186 (53%), Positives = 131/186 (70%), Gaps = 2/186 (1%)

Query: 26  DHDGTYL-GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLS 84
           D  GT + GFWIYLMSDC++F++ F TYAVL    A GP   D+F++  + V T +LL S
Sbjct: 20  DAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFS 79

Query: 85  SLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSS 144
           S++   A +A   K    + +SWL +T  FG  FI MEIYEF HLI     P+RS FLS+
Sbjct: 80  SITYGMAAIA-MYKNNKSQVISWLALTWLFGAGFIGMEIYEFHHLIVNGMGPERSGFLSA 138

Query: 145 FFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFV 204
           FFALVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CLS+FWHFLD++WICVF+ V
Sbjct: 139 FFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVV 198

Query: 205 YLMGVV 210
           YLMG +
Sbjct: 199 YLMGAM 204


>gi|82542918|ref|YP_406865.1| cytochrome o ubiquinol oxidase subunit III [Shigella boydii Sb227]
 gi|187731346|ref|YP_001879140.1| cytochrome o ubiquinol oxidase subunit III [Shigella boydii CDC
           3083-94]
 gi|81244329|gb|ABB65037.1| cytochrome o ubiquinol oxidase subunit III [Shigella boydii Sb227]
 gi|187428338|gb|ACD07612.1| cytochrome o ubiquinol oxidase, subunit III [Shigella boydii CDC
           3083-94]
 gi|320186059|gb|EFW60804.1| Cytochrome O ubiquinol oxidase subunit III [Shigella flexneri CDC
           796-83]
          Length = 204

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 100/186 (53%), Positives = 130/186 (69%), Gaps = 2/186 (1%)

Query: 26  DHDGTYL-GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLS 84
           D  GT + GFWIYLMSDC++F++ F TYAVL    A GP   D+F++  + V T +LL S
Sbjct: 20  DAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFS 79

Query: 85  SLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSS 144
           S++   A +A   K    + +SWL +T  FG  FI MEIYEF HLI     P RS FLS+
Sbjct: 80  SITYGMAAIA-MYKNNKSQVISWLALTCLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSA 138

Query: 145 FFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFV 204
           FFALVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CLS+FWHFLD++WICVF+ V
Sbjct: 139 FFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVV 198

Query: 205 YLMGVV 210
           YLMG +
Sbjct: 199 YLMGAM 204


>gi|271499590|ref|YP_003332615.1| cytochrome o ubiquinol oxidase subunit III [Dickeya dadantii
           Ech586]
 gi|270343145|gb|ACZ75910.1| cytochrome o ubiquinol oxidase, subunit III [Dickeya dadantii
           Ech586]
          Length = 204

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 127/178 (71%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++F + F TY+VL    A GP   ++FD+  + V T  LL SS++   AM
Sbjct: 28  GFWIYLMSDCILFGMLFATYSVLVNGTAGGPTGKELFDLKFVLVETFALLFSSITYGMAM 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K    +  +WL +T  FG++FI ME+YEF HLI   A P RSAFLSSFFALVG H
Sbjct: 88  IA-MNKGNKSQVNAWLGLTFLFGLVFIGMEVYEFHHLIVEGAGPDRSAFLSSFFALVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           G+HV  GLIW+ +++IQ+ K GL S N+ RL+CLS+FWHFLD++WICVF+ VYLMG +
Sbjct: 147 GIHVTSGLIWIAIMMIQVTKYGLTSTNKTRLMCLSLFWHFLDVVWICVFTVVYLMGAM 204


>gi|292487460|ref|YP_003530332.1| cytochrome o ubiquinol oxidase subunit III [Erwinia amylovora
           CFBP1430]
 gi|292898702|ref|YP_003538071.1| cytochrome O ubiquinol oxidase subunit III [Erwinia amylovora ATCC
           49946]
 gi|291198550|emb|CBJ45658.1| cytochrome O ubiquinol oxidase subunit III [Erwinia amylovora ATCC
           49946]
 gi|291552879|emb|CBA19924.1| cytochrome o ubiquinol oxidase subunit III [Erwinia amylovora
           CFBP1430]
 gi|312171564|emb|CBX79822.1| cytochrome o ubiquinol oxidase subunit III [Erwinia amylovora ATCC
           BAA-2158]
          Length = 204

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 126/178 (70%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++FA  F TY V+  N A GPA  D+F++  + V T +LLLSS++  FA+
Sbjct: 28  GFWIYLMSDCIIFATLFATYGVMVNNTAGGPAGKDIFELPFVLVETALLLLSSITYGFAV 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           + +  K      + WL +T  FG+ FI MEIYEF HLI+    P RS FLS FF LVG H
Sbjct: 88  I-NMNKGHKGAVIGWLALTFLFGLGFIGMEIYEFHHLIAEGFGPDRSGFLSGFFTLVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+ VL+ Q+ K+GL   N+ R++CLS+FWHFLD++WICVF+ VYLMGV+
Sbjct: 147 GLHVTSGLIWMLVLMYQVAKRGLNDTNRTRIMCLSLFWHFLDVVWICVFTIVYLMGVM 204


>gi|311280673|ref|YP_003942904.1| cytochrome o ubiquinol oxidase, subunit III [Enterobacter cloacae
           SCF1]
 gi|308749868|gb|ADO49620.1| cytochrome o ubiquinol oxidase, subunit III [Enterobacter cloacae
           SCF1]
          Length = 204

 Score =  196 bits (497), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 127/178 (71%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++F++ F TYAVL  N A GP+  D+F++  + V T +LL SS++   A 
Sbjct: 28  GFWIYLMSDCILFSILFATYAVLVNNTAGGPSGKDIFELPFVLVETALLLFSSITYGLAA 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K    + +SWL +T  FG  FI ME+YEF HLI     P RS FLS+FFALVG H
Sbjct: 88  IA-MYKNNKSQVISWLALTWLFGAGFIGMELYEFHHLIVEGMGPDRSGFLSAFFALVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+ VL+ QI ++GL S N+ R++CLS+FWHFLD++WICVFS VYLMG +
Sbjct: 147 GLHVTSGLIWMAVLMFQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFSVVYLMGAM 204


>gi|157369331|ref|YP_001477320.1| cytochrome o ubiquinol oxidase subunit III [Serratia proteamaculans
           568]
 gi|157321095|gb|ABV40192.1| Cytochrome o ubiquinol oxidase subunit III [Serratia proteamaculans
           568]
          Length = 205

 Score =  196 bits (497), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 96/178 (53%), Positives = 126/178 (70%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++FA  F TYAVL    A GP+  D+FD+  + V T +LL SS++   AM
Sbjct: 28  GFWIYLMSDCILFASLFATYAVLVNGTAGGPSGKDIFDLKFVLVETFLLLFSSITYGMAM 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +    K  +    +WL +T  FG+ F+ MEIYEF HLI     P RSAFLS FFALV  H
Sbjct: 88  IG-MNKGKVGSVNTWLFLTFLFGLGFVAMEIYEFHHLIVEGYGPDRSAFLSGFFALVATH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GL+W+ +++IQ+ K+GL S N+ RL+CLS+FWHFLD++WICVF+ VYL+GV+
Sbjct: 147 GLHVTTGLVWIVIMMIQVSKRGLTSTNKTRLMCLSLFWHFLDVVWICVFTVVYLLGVM 204


>gi|308185900|ref|YP_003930031.1| cytochrome o ubiquinol oxidase subunit III [Pantoea vagans C9-1]
 gi|308056410|gb|ADO08582.1| cytochrome o ubiquinol oxidase subunit III [Pantoea vagans C9-1]
          Length = 205

 Score =  196 bits (497), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 126/178 (70%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++FA  F TYAV+  N A GPA  D+F++  + V T +LLLSS++   A+
Sbjct: 29  GFWIYLMSDCIIFATLFATYAVMVNNTAGGPAGKDIFELPFVLVETALLLLSSITYGMAV 88

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           + S  K      + WL +T  FG+ FI MEIYEF HLI+    P RS FLS FF LVG H
Sbjct: 89  I-SMNKEQKGAVIGWLALTFLFGLGFIGMEIYEFHHLIAEGFGPDRSGFLSGFFTLVGTH 147

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+ VL+ Q+ K+GL + N+ R++CLS+FWHFLD++WICVF+ VYLMG +
Sbjct: 148 GLHVTSGLIWMLVLMFQVSKRGLNATNRTRIMCLSLFWHFLDVVWICVFTVVYLMGAM 205


>gi|123443351|ref|YP_001007325.1| cytochrome o ubiquinol oxidase subunit III [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|332160741|ref|YP_004297318.1| cytochrome o ubiquinol oxidase subunit III [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|122090312|emb|CAL13178.1| cytochrome O ubiquinol oxidase subunit III [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|318604620|emb|CBY26118.1| cytochrome O ubiquinol oxidase subunit III [Yersinia enterocolitica
           subsp. palearctica Y11]
 gi|325664971|gb|ADZ41615.1| cytochrome o ubiquinol oxidase subunit III [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
          Length = 204

 Score =  196 bits (497), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 128/178 (71%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++FA  F TYAVL    A GP+  D+FD++ + V T +LL SS++   AM
Sbjct: 28  GFWIYLMSDCILFATLFATYAVLVNGTAGGPSGRDIFDLNFVLVETFLLLFSSITYGIAM 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           L    K   ++  +WL +T  FG+ F+ MEIYEF HLI+    P RSAFLSSFFALV  H
Sbjct: 88  LG-MNKGHKNQVNTWLGLTFLFGLGFVAMEIYEFHHLIAEGYGPDRSAFLSSFFALVATH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           G+HV  GL+W+ +++IQ+ K+GL   N+ RL+CLS+FWHFLD++WICVF+ VYL+G +
Sbjct: 147 GIHVTAGLVWIIIMMIQVAKRGLNETNRTRLMCLSLFWHFLDVVWICVFTVVYLLGAM 204


>gi|315125954|ref|YP_004067957.1| cytochrome o ubiquinol oxidase subunit III (ubiquinol oxidase chain
           C) [Pseudoalteromonas sp. SM9913]
 gi|315014468|gb|ADT67806.1| cytochrome o ubiquinol oxidase subunit III (ubiquinol oxidase chain
           C) [Pseudoalteromonas sp. SM9913]
          Length = 210

 Score =  196 bits (497), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 143/209 (68%), Gaps = 5/209 (2%)

Query: 2   SRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAA 61
           ++  +   P+ S+ +  +  ++  D   T  GFW+YLM+DCL+FA FF TYAVL  N A 
Sbjct: 7   TQGHVNLEPH-SVSHTHEHHDTSGD---TIFGFWLYLMTDCLLFASFFATYAVLYMNTAG 62

Query: 62  GPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIM 121
           G +  D+F++  + V T  LL+SS++  FAM+A+  ++    T+ WL VT   G +FI M
Sbjct: 63  GVSGKDIFELDFVAVETAALLISSITFGFAMIAAQGQKKA-LTLGWLAVTFCLGAVFIGM 121

Query: 122 EIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQR 181
           EIYEF HLI     PQ+SAFL+SFF+LVGLHGLHV  GLIW+ +++I+++K+GL      
Sbjct: 122 EIYEFHHLIVHGNGPQQSAFLTSFFSLVGLHGLHVTAGLIWMSIMMIEVIKRGLGKQTVT 181

Query: 182 RLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RL CLS+FWHFLD++WICVF+ VYLMG +
Sbjct: 182 RLSCLSLFWHFLDIVWICVFTVVYLMGAM 210


>gi|15800160|ref|NP_286172.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O157:H7 EDL933]
 gi|15829738|ref|NP_308511.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O157:H7 str. Sakai]
 gi|168749892|ref|ZP_02774914.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4113]
 gi|168756972|ref|ZP_02781979.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4401]
 gi|168761636|ref|ZP_02786643.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4501]
 gi|168768381|ref|ZP_02793388.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4486]
 gi|168776264|ref|ZP_02801271.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4196]
 gi|168783296|ref|ZP_02808303.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4076]
 gi|168786277|ref|ZP_02811284.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC869]
 gi|168800313|ref|ZP_02825320.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC508]
 gi|195938503|ref|ZP_03083885.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O157:H7 str. EC4024]
 gi|208807579|ref|ZP_03249916.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4206]
 gi|208816111|ref|ZP_03257290.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4045]
 gi|208822882|ref|ZP_03263200.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4042]
 gi|209396662|ref|YP_002269076.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4115]
 gi|217325930|ref|ZP_03442014.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. TW14588]
 gi|254791614|ref|YP_003076451.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O157:H7 str. TW14359]
 gi|261223911|ref|ZP_05938192.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261256375|ref|ZP_05948908.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291281337|ref|YP_003498155.1| Cytochrome o ubiquinol oxidase subunit 3 [Escherichia coli O55:H7
           str. CB9615]
 gi|12513289|gb|AAG54780.1|AE005222_5 cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O157:H7 str. EDL933]
 gi|13359941|dbj|BAB33907.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O157:H7 str. Sakai]
 gi|187768299|gb|EDU32143.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4196]
 gi|188015926|gb|EDU54048.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4113]
 gi|188999391|gb|EDU68377.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4076]
 gi|189355966|gb|EDU74385.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4401]
 gi|189362389|gb|EDU80808.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4486]
 gi|189367976|gb|EDU86392.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4501]
 gi|189373539|gb|EDU91955.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC869]
 gi|189377389|gb|EDU95805.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC508]
 gi|208727380|gb|EDZ76981.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4206]
 gi|208732759|gb|EDZ81447.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4045]
 gi|208737075|gb|EDZ84759.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4042]
 gi|209158062|gb|ACI35495.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4115]
 gi|209743924|gb|ACI70269.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli]
 gi|209743926|gb|ACI70270.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli]
 gi|209743928|gb|ACI70271.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli]
 gi|209743930|gb|ACI70272.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli]
 gi|209743932|gb|ACI70273.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli]
 gi|217322151|gb|EEC30575.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. TW14588]
 gi|254591014|gb|ACT70375.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O157:H7 str. TW14359]
 gi|290761210|gb|ADD55171.1| Cytochrome o ubiquinol oxidase subunit 3 [Escherichia coli O55:H7
           str. CB9615]
 gi|320638424|gb|EFX08138.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O157:H7 str. G5101]
 gi|320643804|gb|EFX12927.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O157:H- str. 493-89]
 gi|320649155|gb|EFX17733.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O157:H- str. H 2687]
 gi|320656048|gb|EFX23964.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli O55:H7
           str. 3256-97 TW 07815]
 gi|320661198|gb|EFX28629.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli O55:H7
           str. USDA 5905]
 gi|320665174|gb|EFX32267.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O157:H7 str. LSU-61]
          Length = 204

 Score =  196 bits (497), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 101/195 (51%), Positives = 132/195 (67%), Gaps = 2/195 (1%)

Query: 17  VKDKKESCVDHDGTYL-GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF 75
           V   +    D  GT + GFWIYLMSDC++F++ F TYAVL    A GP   D+F++  + 
Sbjct: 11  VHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVL 70

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           V T +LL SS++   A +A   K    + +SWL +T  FG  FI MEIYEF HLI     
Sbjct: 71  VETFLLLFSSITYGMAAIA-MYKNNKSQVISWLALTWLFGAGFIGMEIYEFHHLIVNGMG 129

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           P RS FLS+FFALVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CLS+FWHFLD+
Sbjct: 130 PDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDV 189

Query: 196 IWICVFSFVYLMGVV 210
           +WICVF+ VYLMG +
Sbjct: 190 VWICVFTVVYLMGAM 204


>gi|329296775|ref|ZP_08254111.1| CyoC [Plautia stali symbiont]
          Length = 204

 Score =  196 bits (497), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 101/200 (50%), Positives = 131/200 (65%), Gaps = 7/200 (3%)

Query: 17  VKDKKESCVDHD------GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFD 70
           VK   ++  +H           GFWIYLMSDC++FA  F TYAV+  N A GPA  D+F+
Sbjct: 6   VKHHHDAHAEHGHHDAGANKVFGFWIYLMSDCIIFATLFATYAVMVNNTAGGPAGKDIFE 65

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
           +  + V T +LLLSS++   A++A   +      +SWL +T  FG  FI MEIYEF HLI
Sbjct: 66  LPFVLVETALLLLSSITYGMAVIAMNNQNK-GSVISWLALTFLFGAGFIGMEIYEFHHLI 124

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                P RS FLS FF LVG HGLHV  GLIW+ VL+ QI K+GL + N+ R++CLS+FW
Sbjct: 125 KEGFGPDRSGFLSGFFTLVGTHGLHVSSGLIWMAVLMFQIAKRGLSATNRTRIMCLSLFW 184

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD++WICVF+ VYLMG +
Sbjct: 185 HFLDVVWICVFTVVYLMGAM 204


>gi|333010887|gb|EGK30313.1| cytochrome o ubiquinol oxidase, subunit III [Shigella flexneri
           K-272]
 gi|333021385|gb|EGK40638.1| cytochrome o ubiquinol oxidase, subunit III [Shigella flexneri
           K-227]
          Length = 204

 Score =  196 bits (497), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 100/186 (53%), Positives = 130/186 (69%), Gaps = 2/186 (1%)

Query: 26  DHDGTYL-GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLS 84
           D  GT + GFWIYLMSDC++F++ F TYAVL    A GP   D+F++  + V T +LL S
Sbjct: 20  DAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFS 79

Query: 85  SLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSS 144
           S++   A +A   K    + +SWL +T  FG  FI MEIYEF HLI     P RS FLS+
Sbjct: 80  SITYGMAAIA-MYKNNKSQVISWLALTWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSA 138

Query: 145 FFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFV 204
           FFALVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CLS+FWHFLD++WICVF+ V
Sbjct: 139 FFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDMVWICVFTVV 198

Query: 205 YLMGVV 210
           YLMG +
Sbjct: 199 YLMGAM 204


>gi|91209500|ref|YP_539486.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli UTI89]
 gi|117622690|ref|YP_851603.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli APEC
           O1]
 gi|215485511|ref|YP_002327942.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O127:H6 str. E2348/69]
 gi|218557339|ref|YP_002390252.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli S88]
 gi|237707576|ref|ZP_04538057.1| cytochrome o ubiquinol oxidase subunit III [Escherichia sp.
           3_2_53FAA]
 gi|91071074|gb|ABE05955.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli UTI89]
 gi|115511814|gb|ABI99888.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli APEC
           O1]
 gi|215263583|emb|CAS07913.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O127:H6 str. E2348/69]
 gi|218364108|emb|CAR01773.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli S88]
 gi|222032225|emb|CAP74964.1| Cytochrome o ubiquinol oxidase subunit 3 [Escherichia coli LF82]
 gi|226898786|gb|EEH85045.1| cytochrome o ubiquinol oxidase subunit III [Escherichia sp.
           3_2_53FAA]
 gi|294489594|gb|ADE88350.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           IHE3034]
 gi|312945007|gb|ADR25834.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli O83:H1
           str. NRG 857C]
 gi|315289855|gb|EFU49245.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           110-3]
 gi|323952958|gb|EGB48826.1| cytochrome o ubiquinol oxidase [Escherichia coli H252]
 gi|323958623|gb|EGB54326.1| cytochrome o ubiquinol oxidase [Escherichia coli H263]
          Length = 204

 Score =  196 bits (497), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 130/186 (69%), Gaps = 2/186 (1%)

Query: 26  DHDGTYL-GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLS 84
           D  GT + GFWIYLMSDC++F++ F TYAVL    A GP   D+F++  + V T +LL S
Sbjct: 20  DAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFS 79

Query: 85  SLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSS 144
           S++   A +A   K    + VSWL +T  FG  FI MEIYEF HLI     P RS FLS+
Sbjct: 80  SITYGMAAIA-MYKNNKSQVVSWLALTWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSA 138

Query: 145 FFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFV 204
           FFALVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CLS+FWHFLD++WICVF+ V
Sbjct: 139 FFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVV 198

Query: 205 YLMGVV 210
           YLMG +
Sbjct: 199 YLMGAM 204


>gi|320540329|ref|ZP_08039981.1| cytochrome o ubiquinol oxidase subunit III [Serratia symbiotica
           str. Tucson]
 gi|320029649|gb|EFW11676.1| cytochrome o ubiquinol oxidase subunit III [Serratia symbiotica
           str. Tucson]
          Length = 205

 Score =  195 bits (495), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 128/178 (71%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++FA  F TYAVL    A GPA  D+F++  + V T +LL SS++   AM
Sbjct: 28  GFWIYLMSDCILFACLFATYAVLANGTAGGPAGKDIFELKFVLVETFLLLFSSITYGMAM 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A    ++    + WL +T  FG+ F+ MEIYEF HLI     P RSAFLSSFFALV  H
Sbjct: 88  IAMKKGKVGGVNI-WLFLTFLFGLGFVAMEIYEFHHLIVEGFGPDRSAFLSSFFALVATH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+ +++IQ+ ++GL S N+ RL+CLS+FWHFLD+IWICVF+ VYL+GV+
Sbjct: 147 GLHVSIGLIWITIMMIQVSQRGLTSINKTRLMCLSLFWHFLDVIWICVFTVVYLLGVM 204


>gi|114327938|ref|YP_745095.1| cytochrome O ubiquinol oxidase subunit III [Granulibacter
           bethesdensis CGDNIH1]
 gi|114316112|gb|ABI62172.1| cytochrome O ubiquinol oxidase subunit III [Granulibacter
           bethesdensis CGDNIH1]
          Length = 207

 Score =  195 bits (495), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 130/187 (69%), Gaps = 3/187 (1%)

Query: 26  DHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS 85
           +H  T  GFW+YLM+DC++F+  F  +AV    +A GP   ++FD+  + + T +LL SS
Sbjct: 22  EHGKTVFGFWLYLMTDCILFSGLFAAFAVARSQFAGGPTGQEIFDLKDVAIETALLLFSS 81

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSF 145
           ++  FAML +   RL   T+ WL VT  FG+ F++ME+ EF+HLI+  A P RSAFLS+F
Sbjct: 82  ITYGFAMLQAHKHRL-GGTLQWLGVTFLFGLGFLLMEVKEFSHLIAEGAGPDRSAFLSAF 140

Query: 146 FALVGLHGLHVFFGLIWLFVLVIQ--ILKKGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           F LVG HGLHV  GL+W+ VLV Q  +LKKGL      RL CLS+FWHFLD++WICVFSF
Sbjct: 141 FTLVGTHGLHVTCGLLWMAVLVFQLGVLKKGLTPAYMSRLTCLSLFWHFLDIVWICVFSF 200

Query: 204 VYLMGVV 210
           VYL GV+
Sbjct: 201 VYLAGVL 207


>gi|145299869|ref|YP_001142710.1| cytochrome o ubiquinol oxidase subunit III [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142852641|gb|ABO90962.1| cytochrome o ubiquinol oxidase subunit III [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 204

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 129/200 (64%), Gaps = 4/200 (2%)

Query: 14  LFYVKDKKESCVDHD---GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFD 70
           L +  +       HD       GFWIYLMSDC++FA  F TYAVL    A GP+  D+F+
Sbjct: 6   LHHTHEGAHDHGHHDAGANKVFGFWIYLMSDCILFACLFATYAVLVNGTAGGPSGKDIFE 65

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
           +  +F  T++LL SS++  FAMLA    R       WLLVT   G  FI MEIYEF HLI
Sbjct: 66  LPFVFAETMLLLFSSITFGFAMLAMNKGRAA-AVNGWLLVTFVLGAGFIAMEIYEFHHLI 124

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
           +    P RSAFLS+FF LVG HG+HV  GLIWL V+++ + KKGL    + RL+CLS+FW
Sbjct: 125 AEGYGPDRSAFLSAFFTLVGTHGIHVTSGLIWLIVMMVLVAKKGLTDRTRSRLMCLSLFW 184

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD++WICVF+ VYLMG +
Sbjct: 185 HFLDVVWICVFTVVYLMGAM 204


>gi|16128415|ref|NP_414964.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli str.
           K-12 substr. MG1655]
 gi|24111812|ref|NP_706322.1| cytochrome o ubiquinol oxidase subunit III [Shigella flexneri 2a
           str. 301]
 gi|26246436|ref|NP_752475.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           CFT073]
 gi|30061929|ref|NP_836100.1| cytochrome o ubiquinol oxidase subunit III [Shigella flexneri 2a
           str. 2457T]
 gi|74311005|ref|YP_309424.1| cytochrome o ubiquinol oxidase subunit III [Shigella sonnei Ss046]
 gi|89107300|ref|AP_001080.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli str.
           K-12 substr. W3110]
 gi|110804457|ref|YP_687977.1| cytochrome o ubiquinol oxidase subunit III [Shigella flexneri 5
           str. 8401]
 gi|157157815|ref|YP_001461616.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           E24377A]
 gi|157159955|ref|YP_001457273.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli HS]
 gi|170021198|ref|YP_001726152.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli ATCC
           8739]
 gi|170080016|ref|YP_001729336.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli str.
           K-12 substr. DH10B]
 gi|170680623|ref|YP_001742571.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           SMS-3-5]
 gi|188495693|ref|ZP_03002963.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           53638]
 gi|191166709|ref|ZP_03028536.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli B7A]
 gi|193065155|ref|ZP_03046228.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli E22]
 gi|194428821|ref|ZP_03061356.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli B171]
 gi|194432598|ref|ZP_03064884.1| cytochrome o ubiquinol oxidase, subunit III [Shigella dysenteriae
           1012]
 gi|194438854|ref|ZP_03070939.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           101-1]
 gi|209917646|ref|YP_002291730.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli SE11]
 gi|218552996|ref|YP_002385909.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli IAI1]
 gi|218688293|ref|YP_002396505.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli ED1a]
 gi|218693893|ref|YP_002401560.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli 55989]
 gi|218698658|ref|YP_002406287.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli IAI39]
 gi|218703713|ref|YP_002411232.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           UMN026]
 gi|227884561|ref|ZP_04002366.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli 83972]
 gi|238899718|ref|YP_002925514.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           BW2952]
 gi|253774582|ref|YP_003037413.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254160499|ref|YP_003043607.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli B str.
           REL606]
 gi|256020400|ref|ZP_05434265.1| cytochrome o ubiquinol oxidase subunit III [Shigella sp. D9]
 gi|256023953|ref|ZP_05437818.1| cytochrome o ubiquinol oxidase subunit III [Escherichia sp.
           4_1_40B]
 gi|260842631|ref|YP_003220409.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O103:H2 str. 12009]
 gi|260853653|ref|YP_003227544.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O26:H11 str. 11368]
 gi|260866591|ref|YP_003232993.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O111:H- str. 11128]
 gi|293403550|ref|ZP_06647641.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           FVEC1412]
 gi|293408579|ref|ZP_06652418.1| cytochrome o ubiquinol oxidase [Escherichia coli B354]
 gi|293413685|ref|ZP_06656334.1| cytochrome o ubiquinol oxidase [Escherichia coli B185]
 gi|293418500|ref|ZP_06660935.1| cytochrome o ubiquinol oxidase [Escherichia coli B088]
 gi|298379162|ref|ZP_06989043.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           FVEC1302]
 gi|300818241|ref|ZP_07098452.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           107-1]
 gi|300820327|ref|ZP_07100479.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           119-7]
 gi|300900498|ref|ZP_07118665.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           198-1]
 gi|300903305|ref|ZP_07121233.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           84-1]
 gi|300918189|ref|ZP_07134796.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           115-1]
 gi|300924155|ref|ZP_07140147.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           182-1]
 gi|300930270|ref|ZP_07145683.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           187-1]
 gi|300937044|ref|ZP_07151910.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           21-1]
 gi|300947919|ref|ZP_07162067.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           116-1]
 gi|300957995|ref|ZP_07170160.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           175-1]
 gi|300988017|ref|ZP_07178497.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           45-1]
 gi|301022579|ref|ZP_07186451.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           69-1]
 gi|301025683|ref|ZP_07189199.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           196-1]
 gi|301049631|ref|ZP_07196582.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           185-1]
 gi|301301578|ref|ZP_07207713.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           124-1]
 gi|301330704|ref|ZP_07223306.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           78-1]
 gi|301647353|ref|ZP_07247165.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           146-1]
 gi|307312192|ref|ZP_07591828.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli W]
 gi|331640948|ref|ZP_08342083.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli H736]
 gi|331645604|ref|ZP_08346708.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli M605]
 gi|331651366|ref|ZP_08352391.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli M718]
 gi|331661809|ref|ZP_08362732.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           TA143]
 gi|331666784|ref|ZP_08367658.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           TA271]
 gi|331671976|ref|ZP_08372772.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           TA280]
 gi|331676101|ref|ZP_08376813.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli H591]
 gi|331681824|ref|ZP_08382457.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli H299]
 gi|332281580|ref|ZP_08393993.1| cytochrome o ubiquinol oxidase subunit III [Shigella sp. D9]
 gi|78099994|sp|P0ABJ4|CYOC_ECOL6 RecName: Full=Cytochrome o ubiquinol oxidase subunit 3; AltName:
           Full=Cytochrome o ubiquinol oxidase subunit III;
           AltName: Full=Ubiquinol oxidase chain C
 gi|78099995|sp|P0ABJ3|CYOC_ECOLI RecName: Full=Cytochrome o ubiquinol oxidase subunit 3; AltName:
           Full=Cytochrome o ubiquinol oxidase subunit III;
           AltName: Full=Ubiquinol oxidase chain C
 gi|78099996|sp|P0ABJ5|CYOC_SHIFL RecName: Full=Cytochrome o ubiquinol oxidase subunit 3; AltName:
           Full=Cytochrome o ubiquinol oxidase subunit III;
           AltName: Full=Ubiquinol oxidase chain C
 gi|11514519|pdb|1FFT|C Chain C, The Structure Of Ubiquinol Oxidase From Escherichia Coli
 gi|11514523|pdb|1FFT|H Chain H, The Structure Of Ubiquinol Oxidase From Escherichia Coli
 gi|26106834|gb|AAN79019.1|AE016756_202 Cytochrome O ubiquinol oxidase subunit III [Escherichia coli
           CFT073]
 gi|145654|gb|AAA23633.1| cytochrome o ubiquinol oxidase C subunit [Escherichia coli]
 gi|1773114|gb|AAB40186.1| cytochrome o ubiquinol oxidase [Escherichia coli]
 gi|1786633|gb|AAC73533.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli str.
           K-12 substr. MG1655]
 gi|24050602|gb|AAN42029.1| cytochrome o ubiquinol oxidase subunit III [Shigella flexneri 2a
           str. 301]
 gi|30040173|gb|AAP15906.1| cytochrome o ubiquinol oxidase subunit III [Shigella flexneri 2a
           str. 2457T]
 gi|73854482|gb|AAZ87189.1| cytochrome o ubiquinol oxidase subunit III [Shigella sonnei Ss046]
 gi|85674570|dbj|BAE76210.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli str.
           K12 substr. W3110]
 gi|110614005|gb|ABF02672.1| cytochrome o ubiquinol oxidase subunit III [Shigella flexneri 5
           str. 8401]
 gi|157065635|gb|ABV04890.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli HS]
 gi|157079845|gb|ABV19553.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           E24377A]
 gi|169756126|gb|ACA78825.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli ATCC
           8739]
 gi|169887851|gb|ACB01558.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli str.
           K-12 substr. DH10B]
 gi|170518341|gb|ACB16519.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           SMS-3-5]
 gi|188490892|gb|EDU65995.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           53638]
 gi|190903220|gb|EDV62942.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli B7A]
 gi|192927129|gb|EDV81750.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli E22]
 gi|194413124|gb|EDX29411.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli B171]
 gi|194419159|gb|EDX35242.1| cytochrome o ubiquinol oxidase, subunit III [Shigella dysenteriae
           1012]
 gi|194422148|gb|EDX38150.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           101-1]
 gi|209910905|dbj|BAG75979.1| cytochrome O ubiquinol oxidase subunit III [Escherichia coli SE11]
 gi|218350625|emb|CAU96317.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli 55989]
 gi|218359764|emb|CAQ97305.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli IAI1]
 gi|218368644|emb|CAR16383.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli IAI39]
 gi|218425857|emb|CAR06663.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli ED1a]
 gi|218430810|emb|CAR11684.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           UMN026]
 gi|227838647|gb|EEJ49113.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli 83972]
 gi|238860709|gb|ACR62707.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           BW2952]
 gi|242376211|emb|CAQ30902.1| cytochrome bo terminal oxidase subunit III, subunit of cytochrome
           bo terminal oxidase [Escherichia coli BL21(DE3)]
 gi|253325626|gb|ACT30228.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253972400|gb|ACT38071.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli B str.
           REL606]
 gi|253976610|gb|ACT42280.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           BL21(DE3)]
 gi|257752302|dbj|BAI23804.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O26:H11 str. 11368]
 gi|257757778|dbj|BAI29275.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O103:H2 str. 12009]
 gi|257762947|dbj|BAI34442.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O111:H- str. 11128]
 gi|260450383|gb|ACX40805.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli DH1]
 gi|281177600|dbj|BAI53930.1| cytochrome O ubiquinol oxidase subunit III [Escherichia coli SE15]
 gi|281599766|gb|ADA72750.1| Cytochrome o ubiquinol oxidase subunit 3 [Shigella flexneri
           2002017]
 gi|284920240|emb|CBG33299.1| cytochrome o ubiquinol oxidase subunit 3 [Escherichia coli 042]
 gi|291325028|gb|EFE64443.1| cytochrome o ubiquinol oxidase [Escherichia coli B088]
 gi|291429403|gb|EFF02423.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           FVEC1412]
 gi|291433743|gb|EFF06716.1| cytochrome o ubiquinol oxidase [Escherichia coli B185]
 gi|291471757|gb|EFF14240.1| cytochrome o ubiquinol oxidase [Escherichia coli B354]
 gi|298280275|gb|EFI21779.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           FVEC1302]
 gi|299879995|gb|EFI88206.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           196-1]
 gi|300298624|gb|EFJ55009.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           185-1]
 gi|300315331|gb|EFJ65115.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           175-1]
 gi|300355979|gb|EFJ71849.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           198-1]
 gi|300397460|gb|EFJ80998.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           69-1]
 gi|300404600|gb|EFJ88138.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           84-1]
 gi|300407569|gb|EFJ91107.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           45-1]
 gi|300414640|gb|EFJ97950.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           115-1]
 gi|300419608|gb|EFK02919.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           182-1]
 gi|300452519|gb|EFK16139.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           116-1]
 gi|300457875|gb|EFK21368.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           21-1]
 gi|300461842|gb|EFK25335.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           187-1]
 gi|300527112|gb|EFK48181.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           119-7]
 gi|300529132|gb|EFK50194.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           107-1]
 gi|300843075|gb|EFK70835.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           124-1]
 gi|300843365|gb|EFK71125.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           78-1]
 gi|301074498|gb|EFK89304.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           146-1]
 gi|306907694|gb|EFN38196.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli W]
 gi|307552336|gb|ADN45111.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli ABU
           83972]
 gi|309700691|emb|CBI99987.1| cytochrome o ubiquinol oxidase subunit 3 [Escherichia coli ETEC
           H10407]
 gi|315059710|gb|ADT74037.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli W]
 gi|315135112|dbj|BAJ42271.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli DH1]
 gi|315256255|gb|EFU36223.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           85-1]
 gi|315294191|gb|EFU53542.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           153-1]
 gi|315299552|gb|EFU58800.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           16-3]
 gi|320201674|gb|EFW76250.1| Cytochrome O ubiquinol oxidase subunit III [Escherichia coli
           EC4100B]
 gi|323170515|gb|EFZ56165.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           LT-68]
 gi|323379725|gb|ADX51993.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli KO11]
 gi|323938615|gb|EGB34864.1| cytochrome o ubiquinol oxidase [Escherichia coli E1520]
 gi|323943236|gb|EGB39392.1| cytochrome o ubiquinol oxidase [Escherichia coli E482]
 gi|323945334|gb|EGB41390.1| cytochrome o ubiquinol oxidase [Escherichia coli H120]
 gi|323963419|gb|EGB58981.1| cytochrome o ubiquinol oxidase [Escherichia coli H489]
 gi|323972283|gb|EGB67493.1| cytochrome o ubiquinol oxidase [Escherichia coli TA007]
 gi|324010060|gb|EGB79279.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           57-2]
 gi|324016710|gb|EGB85929.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           117-3]
 gi|324114657|gb|EGC08625.1| cytochrome o ubiquinol oxidase [Escherichia fergusonii B253]
 gi|324116917|gb|EGC10830.1| cytochrome o ubiquinol oxidase [Escherichia coli E1167]
 gi|325498279|gb|EGC96138.1| cytochrome o ubiquinol oxidase subunit III [Escherichia fergusonii
           ECD227]
 gi|330910222|gb|EGH38732.1| cytochrome O ubiquinol oxidase subunit 3 [Escherichia coli AA86]
 gi|331037746|gb|EGI09966.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli H736]
 gi|331045766|gb|EGI17892.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli M605]
 gi|331051107|gb|EGI23159.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli M718]
 gi|331060231|gb|EGI32195.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           TA143]
 gi|331066008|gb|EGI37892.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           TA271]
 gi|331070965|gb|EGI42324.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           TA280]
 gi|331076159|gb|EGI47441.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli H591]
 gi|331081026|gb|EGI52191.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli H299]
 gi|332094585|gb|EGI99631.1| cytochrome o ubiquinol oxidase, subunit III [Shigella boydii
           5216-82]
 gi|332103932|gb|EGJ07278.1| cytochrome o ubiquinol oxidase subunit III [Shigella sp. D9]
 gi|332341793|gb|AEE55127.1| cytochrome O ubiquinol oxidase subunit III CyoC [Escherichia coli
           UMNK88]
 gi|332761785|gb|EGJ92064.1| cytochrome o ubiquinol oxidase, subunit III [Shigella flexneri
           2747-71]
 gi|333007961|gb|EGK27437.1| cytochrome o ubiquinol oxidase, subunit III [Shigella flexneri
           K-218]
 gi|333021982|gb|EGK41228.1| cytochrome o ubiquinol oxidase, subunit III [Shigella flexneri
           K-304]
          Length = 204

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 100/186 (53%), Positives = 130/186 (69%), Gaps = 2/186 (1%)

Query: 26  DHDGTYL-GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLS 84
           D  GT + GFWIYLMSDC++F++ F TYAVL    A GP   D+F++  + V T +LL S
Sbjct: 20  DAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFS 79

Query: 85  SLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSS 144
           S++   A +A   K    + +SWL +T  FG  FI MEIYEF HLI     P RS FLS+
Sbjct: 80  SITYGMAAIA-MYKNNKSQVISWLALTWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSA 138

Query: 145 FFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFV 204
           FFALVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CLS+FWHFLD++WICVF+ V
Sbjct: 139 FFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVV 198

Query: 205 YLMGVV 210
           YLMG +
Sbjct: 199 YLMGAM 204


>gi|317047168|ref|YP_004114816.1| cytochrome o ubiquinol oxidase subunit III [Pantoea sp. At-9b]
 gi|316948785|gb|ADU68260.1| cytochrome o ubiquinol oxidase, subunit III [Pantoea sp. At-9b]
          Length = 205

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 101/196 (51%), Positives = 128/196 (65%), Gaps = 4/196 (2%)

Query: 18  KDKKESCVDHD---GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
            D       HD       GFWIYLMSDC++FA  F TYAV+  N A GPA  D+F++  +
Sbjct: 11  HDAHAEHGHHDAGANKIFGFWIYLMSDCIIFATLFATYAVMVNNTAGGPAGKDIFELPFV 70

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            V T +LLLSS++   A++A   +      +SWL +T  FG  FI MEIYEF HLI    
Sbjct: 71  LVETALLLLSSITYGMAVIAMNNQNK-GAVISWLALTFLFGAGFIGMEIYEFHHLIMEGF 129

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            P RS FLS FF LVG HGLHV  GLIW+ VL+ QI K+GL + N+ R++CLS+FWHFLD
Sbjct: 130 GPNRSGFLSGFFTLVGTHGLHVTSGLIWMAVLMFQISKRGLSATNRTRIMCLSLFWHFLD 189

Query: 195 LIWICVFSFVYLMGVV 210
           ++WICVF+ VYLMG +
Sbjct: 190 VVWICVFTIVYLMGAM 205


>gi|283784256|ref|YP_003364121.1| cytochrome o ubiquinol oxidase subunit 3 [Citrobacter rodentium
           ICC168]
 gi|282947710|emb|CBG87265.1| cytochrome o ubiquinol oxidase subunit 3 [Citrobacter rodentium
           ICC168]
          Length = 204

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 126/178 (70%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++F++ F TYAVL    A GP   D+F++  + V T +LL SS++   A 
Sbjct: 28  GFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAA 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K    + VSWL +T  FG  FI MEIYEF HLI     P RS FLS+FFALVG H
Sbjct: 88  IA-MHKNNKSQVVSWLALTFLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+ VL++QI ++GL S N+ R++CLS+FWHFLD++WICVF+ VYLMG +
Sbjct: 147 GLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMGAM 204


>gi|323184740|gb|EFZ70111.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli 1357]
          Length = 199

 Score =  194 bits (494), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 100/186 (53%), Positives = 130/186 (69%), Gaps = 2/186 (1%)

Query: 26  DHDGTYL-GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLS 84
           D  GT + GFWIYLMSDC++F++ F TYAVL    A GP   D+F++  + V T +LL S
Sbjct: 15  DAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFS 74

Query: 85  SLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSS 144
           S++   A +A   K    + +SWL +T  FG  FI MEIYEF HLI     P RS FLS+
Sbjct: 75  SITYGMAAIA-MYKNNKSQVISWLALTWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSA 133

Query: 145 FFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFV 204
           FFALVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CLS+FWHFLD++WICVF+ V
Sbjct: 134 FFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVV 193

Query: 205 YLMGVV 210
           YLMG +
Sbjct: 194 YLMGAM 199


>gi|157146954|ref|YP_001454273.1| cytochrome o ubiquinol oxidase subunit III [Citrobacter koseri ATCC
           BAA-895]
 gi|157084159|gb|ABV13837.1| hypothetical protein CKO_02731 [Citrobacter koseri ATCC BAA-895]
          Length = 206

 Score =  194 bits (494), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 126/178 (70%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++F++ F TYAVL    A GP   D+F++  + V T +LL SS++   A 
Sbjct: 30  GFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAA 89

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K    + VSWL +T  FG  FI MEIYEF HLI     P RS FLS+FFALVG H
Sbjct: 90  IA-MHKDNKSQVVSWLALTFLFGAGFIGMEIYEFHHLIVEGMGPDRSGFLSAFFALVGTH 148

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+ VL++QI ++GL S N+ R++CLS+FWHFLD++WICVF+ VYLMG +
Sbjct: 149 GLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMGAM 206


>gi|306813104|ref|ZP_07447297.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli NC101]
 gi|331656485|ref|ZP_08357447.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           TA206]
 gi|305853867|gb|EFM54306.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli NC101]
 gi|320197132|gb|EFW71749.1| Cytochrome O ubiquinol oxidase subunit III [Escherichia coli
           WV_060327]
 gi|331054733|gb|EGI26742.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           TA206]
          Length = 204

 Score =  194 bits (494), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 100/186 (53%), Positives = 130/186 (69%), Gaps = 2/186 (1%)

Query: 26  DHDGTYL-GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLS 84
           D  GT + GFWIYLMSDC++F++ F TYAVL    A GP   D+F++  + V T +LL S
Sbjct: 20  DAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFS 79

Query: 85  SLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSS 144
           S++   A +A   K    + VSWL +T  FG  FI ME+YEF HLI     P RS FLS+
Sbjct: 80  SITYGMAAIA-MYKNNKSQVVSWLALTWLFGAGFIGMELYEFHHLIVNGMGPDRSGFLSA 138

Query: 145 FFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFV 204
           FFALVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CLS+FWHFLD++WICVF+ V
Sbjct: 139 FFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVV 198

Query: 205 YLMGVV 210
           YLMG +
Sbjct: 199 YLMGAM 204


>gi|161504382|ref|YP_001571494.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865729|gb|ABX22352.1| hypothetical protein SARI_02493 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 204

 Score =  194 bits (493), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 126/178 (70%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++F++ F TYAVL    A GP   D+F++  + V T +LL SS++   A 
Sbjct: 28  GFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAA 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K    + +SWL +T  FG  FI MEIYEF HLI     P RS FLS+FFALVG H
Sbjct: 88  IA-MHKNNQSQVISWLALTFLFGAGFIGMEIYEFHHLIVEGMGPDRSGFLSAFFALVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+ VL++Q+ ++GL S N+ R++CLS+FWHFLD+IWICVF+ VYLMG +
Sbjct: 147 GLHVTSGLIWMAVLMVQVARRGLTSTNRTRIMCLSLFWHFLDVIWICVFTVVYLMGAM 204


>gi|110640690|ref|YP_668418.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli 536]
 gi|191173519|ref|ZP_03035046.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli F11]
 gi|300997383|ref|ZP_07181723.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           200-1]
 gi|110342282|gb|ABG68519.1| cytochrome O ubiquinol oxidase subunit III [Escherichia coli 536]
 gi|190906228|gb|EDV65840.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli F11]
 gi|300304202|gb|EFJ58722.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           200-1]
 gi|324010690|gb|EGB79909.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           60-1]
          Length = 204

 Score =  194 bits (493), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 100/186 (53%), Positives = 129/186 (69%), Gaps = 2/186 (1%)

Query: 26  DHDGTYL-GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLS 84
           D  GT + GFWIYLMSDC++F++ F TYAVL    A GP   D+F++  + V T  LL S
Sbjct: 20  DAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFFLLFS 79

Query: 85  SLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSS 144
           S++   A +A   K    + +SWL +T  FG  FI MEIYEF HLI     P RS FLS+
Sbjct: 80  SITYGMAAIA-MYKNNKSQVISWLALTWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSA 138

Query: 145 FFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFV 204
           FFALVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CLS+FWHFLD++WICVF+ V
Sbjct: 139 FFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVV 198

Query: 205 YLMGVV 210
           YLMG +
Sbjct: 199 YLMGAM 204


>gi|218549902|ref|YP_002383693.1| cytochrome o ubiquinol oxidase subunit III [Escherichia fergusonii
           ATCC 35469]
 gi|218357443|emb|CAQ90082.1| cytochrome o ubiquinol oxidase subunit III [Escherichia fergusonii
           ATCC 35469]
 gi|323965116|gb|EGB60575.1| cytochrome o ubiquinol oxidase [Escherichia coli M863]
 gi|323976086|gb|EGB71179.1| cytochrome o ubiquinol oxidase [Escherichia coli TW10509]
          Length = 204

 Score =  194 bits (493), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 126/178 (70%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++F++ F TYAVL    A GP   D+F++  + V T +LL SS++   A 
Sbjct: 28  GFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAA 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K    + +SWL +T  FG  FI MEIYEF HLI     P RS FLS+FFALVG H
Sbjct: 88  IA-MYKNNKSQVISWLALTWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+ VL++QI ++GL S N+ R++CLS+FWHFLD++WICVF+ VYLMG +
Sbjct: 147 GLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMGAM 204


>gi|323529724|ref|YP_004231876.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia sp.
           CCGE1001]
 gi|323386726|gb|ADX58816.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia sp.
           CCGE1001]
          Length = 202

 Score =  194 bits (492), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 99/188 (52%), Positives = 130/188 (69%), Gaps = 4/188 (2%)

Query: 26  DH--DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLL 83
           DH    T  GFW+YLM+DC++FA  F  +AV+   +A GP+  D+FDI G+ V T VLLL
Sbjct: 16  DHGSSDTVFGFWLYLMTDCVLFASLFAVFAVMSNQFAGGPSGKDLFDIGGVAVETAVLLL 75

Query: 84  SSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLS 143
           SS++  FAMLA A +R     + WL VT   G+ F+++E+ EF+HLI   A P RSAFLS
Sbjct: 76  SSITYGFAMLA-ARRRKSAAVLGWLAVTFALGLAFLVLEMREFSHLIGEGAGPGRSAFLS 134

Query: 144 SFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ-RRLICLSMFWHFLDLIWICVFS 202
           SFF LV  HGLHV  GL+W+ VL +Q+++   +S  Q  RL CLS+FWHFLD++WICVFS
Sbjct: 135 SFFTLVATHGLHVTVGLVWMAVLAVQVVRAPELSERQITRLTCLSLFWHFLDIVWICVFS 194

Query: 203 FVYLMGVV 210
           FVYL  V+
Sbjct: 195 FVYLGSVL 202


>gi|91775646|ref|YP_545402.1| cytochrome c oxidase, subunit III [Methylobacillus flagellatus KT]
 gi|91709633|gb|ABE49561.1| cytochrome bo3 quinol oxidase subunit 3 [Methylobacillus
           flagellatus KT]
          Length = 205

 Score =  194 bits (492), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 96/178 (53%), Positives = 125/178 (70%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLM+D ++FA  F TYAVL  ++A GP   D+F++  + + T +LL SS++  FAM
Sbjct: 29  GFWIYLMTDLILFATLFATYAVLSTSFAGGPTGKDIFELDYVLIETFLLLFSSITYGFAM 88

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K      ++WL +T  FG+ FI+ME+ EF HLI     P RSAFLS+FF LVG H
Sbjct: 89  IAQH-KGNKQAVLNWLAITFLFGLGFIVMEVNEFHHLIHQGFGPDRSAFLSAFFTLVGTH 147

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+ VL+ QI  KGL   N  RL+CLS+FWHFLD++WICVF+ VYLMGV+
Sbjct: 148 GLHVTCGLIWMAVLMAQIWTKGLTETNNTRLMCLSLFWHFLDIVWICVFTVVYLMGVL 205


>gi|16759421|ref|NP_455038.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|29142807|ref|NP_806149.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|56414403|ref|YP_151478.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|167551746|ref|ZP_02345499.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|213052104|ref|ZP_03344982.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhi str. E00-7866]
 gi|213425864|ref|ZP_03358614.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
 gi|213584682|ref|ZP_03366508.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-0664]
 gi|213621012|ref|ZP_03373795.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-2068]
 gi|25285521|pir||AD0557 cytochrome o ubiquinol oxidase chain III [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16501712|emb|CAD08900.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhi]
 gi|29138439|gb|AAO70009.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|56128660|gb|AAV78166.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|205323470|gb|EDZ11309.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
          Length = 204

 Score =  194 bits (492), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 96/178 (53%), Positives = 126/178 (70%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSDC++F++ F TYAVL    A GP   D+F++  + V T +LL SS++   A 
Sbjct: 28  GFWVYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAA 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K    + +SWL +T  FG  FI MEIYEF HLI     P RS FLS+FFALVG H
Sbjct: 88  IA-MHKNNKSQVISWLALTFLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+ VL++Q+ ++GL S N+ R++CLS+FWHFLD+IWICVF+ VYLMG +
Sbjct: 147 GLHVTSGLIWMAVLMVQVARRGLTSTNRTRIMCLSLFWHFLDVIWICVFTVVYLMGAM 204


>gi|170767661|ref|ZP_02902114.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia albertii
           TW07627]
 gi|170123149|gb|EDS92080.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia albertii
           TW07627]
          Length = 204

 Score =  194 bits (492), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 98/186 (52%), Positives = 130/186 (69%), Gaps = 2/186 (1%)

Query: 26  DHDGTYL-GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLS 84
           D  GT + GFWIYLMSDC++F++ F TYAVL    A GP   D+F++  + V T +LL S
Sbjct: 20  DAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFS 79

Query: 85  SLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSS 144
           S++   A +A   K    + +SWL++T  FG  FI ME+YEF HLI     P RS FLS+
Sbjct: 80  SITYGMAAIA-MYKNNKSQVISWLMLTWLFGAGFIGMELYEFHHLIVNGMGPDRSGFLSA 138

Query: 145 FFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFV 204
           FFALVG HGLHV  GLIW+ VL++QI ++GL   N+ R++CLS+FWHFLD++WICVF+ V
Sbjct: 139 FFALVGTHGLHVTSGLIWMAVLMVQIARRGLTGTNRTRIMCLSLFWHFLDVVWICVFTVV 198

Query: 205 YLMGVV 210
           YLMG +
Sbjct: 199 YLMGAM 204


>gi|300721999|ref|YP_003711279.1| cytochrome o ubiquinol oxidase subunit III [Xenorhabdus nematophila
           ATCC 19061]
 gi|297628496|emb|CBJ89063.1| cytochrome o ubiquinol oxidase, subunit III [Xenorhabdus
           nematophila ATCC 19061]
          Length = 203

 Score =  194 bits (492), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 99/178 (55%), Positives = 125/178 (70%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSD ++FA  F TYAVL    A GP   D+F++  + V T +LL SS++  FAM
Sbjct: 27  GFWIYLMSDLVLFASLFATYAVLVNGTAGGPTGKDIFELDFVLVETFLLLFSSITYGFAM 86

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           L S  K  + +   WL +T  FG+ FI ME+YEF  LIS    P RSAFLSSFFALV  H
Sbjct: 87  L-SMNKGKVAQVNLWLFITFLFGLGFISMEVYEFHKLISEGFGPDRSAFLSSFFALVATH 145

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV FGLIW+ VL++Q+ ++GL   N+ RL CLS+FWHFLD++WICVF+ VYLMG +
Sbjct: 146 GLHVTFGLIWIIVLMVQVSRRGLTEVNRTRLNCLSLFWHFLDVVWICVFTIVYLMGAM 203


>gi|323257871|gb|EGA41550.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008283]
          Length = 276

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 95/177 (53%), Positives = 125/177 (70%), Gaps = 1/177 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSDC++F++ F TYAVL    A GP   D+F++  + V T +LL SS++   A 
Sbjct: 28  GFWVYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAA 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K    + +SWL +T  FG  FI ME+YEF HLI     P RS FLS+FFALVG H
Sbjct: 88  IA-MHKNNKSQVISWLALTFLFGAGFIGMELYEFHHLIVNGMGPDRSGFLSAFFALVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           GLHV  GLIW+ VL++Q+ ++GL S N+ R++CLS+FWHFLD+IWICVF+ VYLMG 
Sbjct: 147 GLHVTSGLIWMAVLMVQVARRGLTSTNRTRIMCLSLFWHFLDVIWICVFTVVYLMGA 203


>gi|109897617|ref|YP_660872.1| cytochrome c oxidase, subunit III [Pseudoalteromonas atlantica T6c]
 gi|109699898|gb|ABG39818.1| cytochrome bo3 quinol oxidase subunit 3 [Pseudoalteromonas
           atlantica T6c]
          Length = 214

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 97/181 (53%), Positives = 130/181 (71%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLM+DC++FA  F TYAVL  N   G +  D+FD++ + V T  LL+SS++  
Sbjct: 35  TLFGFWLYLMTDCILFASVFATYAVLYMNTDGGVSGKDIFDLNFVLVETAALLVSSITYG 94

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FA+L  A K+    T+ WLLVT   G +FI ME+YEF HLI     P RSAFLSSFFALV
Sbjct: 95  FALLC-AHKQQRAGTLLWLLVTMALGCVFIAMEVYEFHHLIVEGNGPDRSAFLSSFFALV 153

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G+HGLHV  GL+W+ V+V+++LK+GL +    RL CLS+FWHFLD++W+CVF+ VYL+G 
Sbjct: 154 GMHGLHVTAGLVWMLVMVLEVLKRGLGAQTVTRLGCLSLFWHFLDIVWVCVFTVVYLLGA 213

Query: 210 V 210
           +
Sbjct: 214 M 214


>gi|332532048|ref|ZP_08407931.1| cytochrome O ubiquinol oxidase, subunit III [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332038389|gb|EGI74833.1| cytochrome O ubiquinol oxidase, subunit III [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 208

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 97/181 (53%), Positives = 131/181 (72%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLM+DCL+FA FF TYAVL  N A G +  D+F++  + V T  LL+SS++  
Sbjct: 29  TVFGFWLYLMTDCLLFASFFATYAVLFMNTAGGVSGKDIFELDFVAVETAALLISSITFG 88

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAM+A+  ++    T++WL VT   G +FI ME+YEF HLI     PQ+SAFL+SFF+LV
Sbjct: 89  FAMIAAQGQKKA-LTLTWLFVTFCLGAVFIGMEVYEFHHLIVHGNGPQQSAFLTSFFSLV 147

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           GLHGLHV  GLIW+ +++I++ K+GL      RL CLS+FWHFLD++WICVF+ VYLMG 
Sbjct: 148 GLHGLHVTAGLIWMTIMMIEVAKRGLGKATVTRLSCLSLFWHFLDIVWICVFTVVYLMGA 207

Query: 210 V 210
           +
Sbjct: 208 M 208


>gi|213023463|ref|ZP_03337910.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhi str. 404ty]
          Length = 186

 Score =  193 bits (490), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 96/178 (53%), Positives = 126/178 (70%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSDC++F++ F TYAVL    A GP   D+F++  + V T +LL SS++   A 
Sbjct: 10  GFWVYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAA 69

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K    + +SWL +T  FG  FI MEIYEF HLI     P RS FLS+FFALVG H
Sbjct: 70  IA-MHKNNKSQVISWLALTFLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTH 128

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+ VL++Q+ ++GL S N+ R++CLS+FWHFLD+IWICVF+ VYLMG +
Sbjct: 129 GLHVTSGLIWMAVLMVQVARRGLTSTNRTRIMCLSLFWHFLDVIWICVFTVVYLMGAM 186


>gi|307545743|ref|YP_003898222.1| cytochrome O ubiquinol oxidase subunit III [Halomonas elongata DSM
           2581]
 gi|307217767|emb|CBV43037.1| cytochrome o ubiquinol oxidase subunit III [Halomonas elongata DSM
           2581]
          Length = 204

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 133/200 (66%), Gaps = 7/200 (3%)

Query: 17  VKDKKESCVDHD-----GTYL-GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFD 70
           + + +    +HD     GT + GFW+YLMSD ++F   F TYAVL +  A GP P +VF+
Sbjct: 6   LSNHEGHAHEHDHHDTAGTKVFGFWVYLMSDLVIFGSLFATYAVLLRGTAGGPTPGEVFE 65

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
           +  I V T +LL SS +   A+LA    R + +  +WL +T   G  F+ ME+YEF HLI
Sbjct: 66  LPFILVETFLLLFSSFTYGMAVLAMNANR-VGQIKAWLAITFLLGAAFVGMEVYEFQHLI 124

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                P RSAFLS+FF LVG HGLHV FGLIW+ V++IQ+  KGL    + R++CLS+FW
Sbjct: 125 HEGFGPDRSAFLSAFFTLVGTHGLHVTFGLIWILVMLIQLQTKGLTDMTRPRIMCLSLFW 184

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD++WICVFSFVYLMGV+
Sbjct: 185 HFLDIVWICVFSFVYLMGVL 204


>gi|16763822|ref|NP_459437.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|62179053|ref|YP_215470.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|161615369|ref|YP_001589334.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Paratyphi B str. SPB7]
 gi|167992293|ref|ZP_02573391.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168232416|ref|ZP_02657474.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|168237553|ref|ZP_02662611.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|168240265|ref|ZP_02665197.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|168261125|ref|ZP_02683098.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|168465532|ref|ZP_02699414.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|168818950|ref|ZP_02830950.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|194446076|ref|YP_002039683.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194450685|ref|YP_002044476.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194470084|ref|ZP_03076068.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194736872|ref|YP_002113472.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|197251191|ref|YP_002145422.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197265057|ref|ZP_03165131.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|198243166|ref|YP_002214395.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|200390434|ref|ZP_03217045.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204927033|ref|ZP_03218235.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|238911427|ref|ZP_04655264.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Tennessee str. CDC07-0191]
 gi|16418948|gb|AAL19396.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|62126686|gb|AAX64389.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|161364733|gb|ABX68501.1| hypothetical protein SPAB_03140 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194404739|gb|ACF64961.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194408989|gb|ACF69208.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194456448|gb|EDX45287.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194712374|gb|ACF91595.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|195631945|gb|EDX50465.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|197214894|gb|ACH52291.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197243312|gb|EDY25932.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|197289515|gb|EDY28878.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|197937682|gb|ACH75015.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|199602879|gb|EDZ01425.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204323698|gb|EDZ08893.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205329523|gb|EDZ16287.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205333348|gb|EDZ20112.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|205339947|gb|EDZ26711.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|205344157|gb|EDZ30921.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|205349684|gb|EDZ36315.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|267992154|gb|ACY87039.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|312911474|dbj|BAJ35448.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhimurium str. T000240]
 gi|320084714|emb|CBY94505.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321226017|gb|EFX51068.1| Cytochrome O ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhimurium str. TN061786]
 gi|322642058|gb|EFY38668.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. 531954]
 gi|322647877|gb|EFY44352.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322652555|gb|EFY48909.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. OH_2009072675]
 gi|322653283|gb|EFY49616.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322660568|gb|EFY56804.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. 19N]
 gi|322713514|gb|EFZ05085.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. A50]
 gi|323128760|gb|ADX16190.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
 gi|326622143|gb|EGE28488.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Dublin str. 3246]
 gi|332987390|gb|AEF06373.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 204

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 126/178 (70%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSDC++F++ F TYAVL    A GP   D+F++  + V T +LL SS++   A 
Sbjct: 28  GFWVYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAA 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K    + +SWL +T  FG  FI ME+YEF HLI     P RS FLS+FFALVG H
Sbjct: 88  IA-MHKNNKSQVISWLALTFLFGAGFIGMELYEFHHLIVNGMGPDRSGFLSAFFALVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+ VL++Q+ ++GL S N+ R++CLS+FWHFLD+IWICVF+ VYLMG +
Sbjct: 147 GLHVTSGLIWMAVLMVQVARRGLTSTNRTRIMCLSLFWHFLDVIWICVFTVVYLMGAM 204


>gi|156935021|ref|YP_001438937.1| cytochrome o ubiquinol oxidase subunit III [Cronobacter sakazakii
           ATCC BAA-894]
 gi|156533275|gb|ABU78101.1| hypothetical protein ESA_02872 [Cronobacter sakazakii ATCC BAA-894]
          Length = 205

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 94/178 (52%), Positives = 124/178 (69%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++FA  F TYAVL    A GP   D+F++  + V T +LL SS++   AM
Sbjct: 29  GFWIYLMSDCILFACLFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAM 88

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A    +   + +SWL +T  FG  F+ MEIYEF HLI+    P +S FLS+FF LVG H
Sbjct: 89  IAMNNNKQ-SQVMSWLALTFLFGAGFVAMEIYEFHHLIAEGFGPDKSGFLSAFFTLVGTH 147

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           G+HV  GLIW+ V++I + ++GL   N+ RL+CLSMFWHFLD++WICVFS VYLMG +
Sbjct: 148 GIHVTSGLIWMVVMMIHVSRRGLTHNNRARLMCLSMFWHFLDVVWICVFSVVYLMGAM 205


>gi|242240300|ref|YP_002988481.1| cytochrome o ubiquinol oxidase subunit III [Dickeya dadantii
           Ech703]
 gi|242132357|gb|ACS86659.1| cytochrome o ubiquinol oxidase, subunit III [Dickeya dadantii
           Ech703]
          Length = 203

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 94/178 (52%), Positives = 125/178 (70%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++F + F TYAVL    A GP+  D+FD+  + V T  LL SS++   AM
Sbjct: 27  GFWIYLMSDCILFGMLFATYAVLVNGTAGGPSGKDIFDLKFVLVETFALLFSSITYGMAM 86

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K    +  +WL +T  FG++FI MEIYEF  LI     P RSAFLS+FFALVG H
Sbjct: 87  IA-MNKNSKSQVNTWLALTFLFGLVFIGMEIYEFHKLIEEGFGPDRSAFLSAFFALVGTH 145

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           G+HV  GLIW+ +++ Q+  +GL + N+ RL+CLS+FWHFLD++WICVF+ VYLMG +
Sbjct: 146 GIHVTSGLIWIAIMMTQVAGRGLTATNRTRLMCLSLFWHFLDVVWICVFTVVYLMGAM 203


>gi|309794840|ref|ZP_07689261.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           145-7]
 gi|308121493|gb|EFO58755.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           145-7]
          Length = 204

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 129/186 (69%), Gaps = 2/186 (1%)

Query: 26  DHDGTYL-GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLS 84
           D  GT + GFWIYLMSDC++F++ F TYAVL    A GP   D+F++  + V T +LL S
Sbjct: 20  DAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFS 79

Query: 85  SLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSS 144
           S++   A +A   K    + +SWL +T  FG  FI MEIYEF HLI     P  S FLS+
Sbjct: 80  SITYGMAAIA-MYKNNKSQVISWLALTWLFGAGFIGMEIYEFHHLIVNGMGPDHSGFLSA 138

Query: 145 FFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFV 204
           FFALVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CLS+FWHFLD++WICVF+ V
Sbjct: 139 FFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVV 198

Query: 205 YLMGVV 210
           YLMG +
Sbjct: 199 YLMGAM 204


>gi|300715584|ref|YP_003740387.1| cytochrome o ubiquinol oxidase subunit III [Erwinia billingiae
           Eb661]
 gi|299061420|emb|CAX58532.1| Cytochrome o ubiquinol oxidase subunit III [Erwinia billingiae
           Eb661]
          Length = 204

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 99/196 (50%), Positives = 129/196 (65%), Gaps = 4/196 (2%)

Query: 18  KDKKESCVDHD---GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
            D       HD       GFWIYLMSDC++FA  F T+ V+  + A GPA  D+F++  +
Sbjct: 10  HDAHAEHGHHDAGANKVFGFWIYLMSDCIIFATLFATFGVMVNSTAGGPAGKDIFELPFV 69

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
              T +LLLSS++  FA++ S  K      +SWL++T  FG  FI MEIYEF HLI    
Sbjct: 70  LGETALLLLSSITYGFAVI-SMNKGSKGSVISWLMLTFLFGAGFIAMEIYEFHHLIMEGF 128

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            PQRS FLS+FF LVG HGLHV  GLIW+ VL+ Q+ K+GL   N+ R++CLS+FWHFLD
Sbjct: 129 GPQRSGFLSAFFTLVGTHGLHVTSGLIWMAVLMYQVSKRGLTPTNRTRILCLSLFWHFLD 188

Query: 195 LIWICVFSFVYLMGVV 210
           ++WICVF+ VYLMG +
Sbjct: 189 VVWICVFTIVYLMGAM 204


>gi|260596798|ref|YP_003209369.1| cytochrome o ubiquinol oxidase subunit III [Cronobacter turicensis
           z3032]
 gi|260215975|emb|CBA28616.1| Cytochrome o ubiquinol oxidase subunit 3 [Cronobacter turicensis
           z3032]
          Length = 205

 Score =  192 bits (488), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 124/178 (69%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++FA  F TYAVL    A GP   D+F++  + V T +LL SS++   AM
Sbjct: 29  GFWIYLMSDCILFACLFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAM 88

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K    + +SWL +T  FG  F+ MEIYEF HLI+    P +S FLS+FF LVG H
Sbjct: 89  IA-MNKDKQSQVMSWLALTFLFGAGFVAMEIYEFHHLIAEGFGPDKSGFLSAFFTLVGTH 147

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           G+HV  GLIW+ V++I + ++GL   N+ RL+CLSMFWHFLD++WICVFS VYLMG +
Sbjct: 148 GIHVTSGLIWMVVMMIHVSRRGLTHNNRARLMCLSMFWHFLDVVWICVFSVVYLMGAM 205


>gi|152968965|ref|YP_001334074.1| cytochrome o ubiquinol oxidase subunit III [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|206577207|ref|YP_002240091.1| cytochrome o ubiquinol oxidase, subunit III [Klebsiella pneumoniae
           342]
 gi|238893377|ref|YP_002918111.1| cytochrome o ubiquinol oxidase subunit III [Klebsiella pneumoniae
           NTUH-K2044]
 gi|288936841|ref|YP_003440900.1| cytochrome o ubiquinol oxidase subunit III [Klebsiella variicola
           At-22]
 gi|290510103|ref|ZP_06549473.1| cytochrome o ubiquinol oxidase, subunit III [Klebsiella sp. 1_1_55]
 gi|150953814|gb|ABR75844.1| cytochrome o ubiquinol oxidase subunit III [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|206566265|gb|ACI08041.1| cytochrome o ubiquinol oxidase, subunit III [Klebsiella pneumoniae
           342]
 gi|238545693|dbj|BAH62044.1| cytochrome o ubiquinol oxidase subunit III [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
 gi|288891550|gb|ADC59868.1| cytochrome o ubiquinol oxidase, subunit III [Klebsiella variicola
           At-22]
 gi|289776819|gb|EFD84817.1| cytochrome o ubiquinol oxidase, subunit III [Klebsiella sp. 1_1_55]
          Length = 203

 Score =  192 bits (488), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 99/178 (55%), Positives = 124/178 (69%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++FA  F TYAVL    A GP   D+F++  + V T +LL SS++   A 
Sbjct: 27  GFWIYLMSDCIIFATLFATYAVLVNGTAGGPTGKDIFELPFVLVETALLLFSSITYGMAA 86

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K    + VSWL +T  FG  FI MEIYEF HLI     P RS FLS+FFALVG H
Sbjct: 87  IA-MYKNNKSQVVSWLALTWLFGAGFIGMEIYEFHHLIMEGFGPDRSGFLSAFFALVGTH 145

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+ VL+ Q+ ++GL S N+ R++CLS+FWHFLD++WICVFS VYLMG +
Sbjct: 146 GLHVTSGLIWMAVLMFQVSRRGLTSTNRTRILCLSLFWHFLDVVWICVFSVVYLMGAM 203


>gi|237730407|ref|ZP_04560888.1| cytochrome o ubiquinol oxidase subunit III [Citrobacter sp. 30_2]
 gi|283834251|ref|ZP_06353992.1| cytochrome o ubiquinol oxidase, subunit III [Citrobacter youngae
           ATCC 29220]
 gi|226905946|gb|EEH91864.1| cytochrome o ubiquinol oxidase subunit III [Citrobacter sp. 30_2]
 gi|291069773|gb|EFE07882.1| cytochrome o ubiquinol oxidase, subunit III [Citrobacter youngae
           ATCC 29220]
          Length = 204

 Score =  192 bits (488), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 94/178 (52%), Positives = 126/178 (70%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSDC++F++ F TYAVL    A GP   D+F++  + V T +LL SS++   A 
Sbjct: 28  GFWVYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAA 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K    + +SWL +T  FG  FI ME+YEF HLI     P RS FLS+FFALVG H
Sbjct: 88  IA-MYKNNKSQVISWLALTFLFGAGFIGMELYEFHHLIVNGMGPDRSGFLSAFFALVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+ VL++Q+ ++GL S N+ R++CLS+FWHFLD++WICVF+ VYLMG +
Sbjct: 147 GLHVTSGLIWMAVLMVQVARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMGAM 204


>gi|153007395|ref|YP_001368610.1| cytochrome o ubiquinol oxidase subunit III [Ochrobactrum anthropi
           ATCC 49188]
 gi|151559283|gb|ABS12781.1| Cytochrome o ubiquinol oxidase subunit III [Ochrobactrum anthropi
           ATCC 49188]
          Length = 209

 Score =  192 bits (488), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 134/200 (67%), Gaps = 5/200 (2%)

Query: 15  FYVKDKKESCVDHDG----TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFD 70
           F   ++  +  DH      T +GFWIYLMSDC++F+  F TYAVL   +A GP   ++FD
Sbjct: 11  FTGGNEHPAHEDHHDAGSTTLVGFWIYLMSDCVLFSGLFATYAVLAHQFAGGPTGRELFD 70

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
           ++ + + T++LL+SSL+   A L S  K+     + WL VT   G  F+ ME+YEF HLI
Sbjct: 71  LNFVLIETMLLLVSSLTYGLATL-SMFKKNRAGLLFWLGVTFLLGAAFLAMEVYEFNHLI 129

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
              A P RSAFLS+FFALVG HGLH+  GLIW+ VL  Q+L+ GL   NQ R++CLS+FW
Sbjct: 130 HEGAGPGRSAFLSAFFALVGTHGLHITSGLIWILVLSAQLLRDGLTEKNQTRVMCLSLFW 189

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD+IWI VF+ VYL+GV+
Sbjct: 190 HFLDIIWIGVFTLVYLLGVL 209


>gi|92113084|ref|YP_573012.1| cytochrome c oxidase, subunit III [Chromohalobacter salexigens DSM
           3043]
 gi|91796174|gb|ABE58313.1| cytochrome bo3 quinol oxidase subunit 3 [Chromohalobacter
           salexigens DSM 3043]
          Length = 205

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 98/195 (50%), Positives = 129/195 (66%), Gaps = 1/195 (0%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF 75
           +  D  E          GFW+YLMSD ++F   F TYAVL    A GP+  D+F++  I 
Sbjct: 12  HAHDGHEHHDAGGMKVFGFWVYLMSDLVIFGSLFATYAVLMNGTAGGPSGADIFELPLIL 71

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           +ST +LL SS +   A+LA    R + +   WL++T F G  FI +EIYEF HLI+    
Sbjct: 72  ISTFLLLFSSFTYGMAVLAMNADR-VSQVRGWLILTFFLGAGFIGLEIYEFHHLIAEGFG 130

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           P RSAFLSSFF LVG HGLHV FGLIW+ V+++Q+  KGL    + R++CLS+FWHFLD+
Sbjct: 131 PDRSAFLSSFFTLVGTHGLHVTFGLIWMLVMIVQLSTKGLNDMTRPRIMCLSLFWHFLDI 190

Query: 196 IWICVFSFVYLMGVV 210
           +WICVF+FVYLMGV+
Sbjct: 191 VWICVFTFVYLMGVL 205


>gi|50120080|ref|YP_049247.1| cytochrome o ubiquinol oxidase subunit III [Pectobacterium
           atrosepticum SCRI1043]
 gi|49610606|emb|CAG74051.1| cytochrome o ubiquinol oxidase subunit III [Pectobacterium
           atrosepticum SCRI1043]
          Length = 204

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 96/178 (53%), Positives = 125/178 (70%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSD ++F   F TYAVL    A GP+  D+F +  + V T  LL SS++   AM
Sbjct: 28  GFWVYLMSDLIIFGSLFATYAVLVNGTAGGPSGKDIFQLPFVLVETFALLFSSITYGMAM 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K    +  +WL VT  FG++FI MEIYEF HLI     P RSAFLS+FFALVG H
Sbjct: 88  IA-MNKGNKSQVNTWLGVTFLFGLVFIGMEIYEFHHLIVEGYGPDRSAFLSAFFALVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIWL +++IQ+ K+GL + N+ RL+CLS+FWHFLD++WICVF+ VYL+G +
Sbjct: 147 GLHVTGGLIWLVIMMIQVSKRGLTATNKTRLMCLSLFWHFLDVVWICVFTVVYLLGAI 204


>gi|261822514|ref|YP_003260620.1| cytochrome o ubiquinol oxidase subunit III [Pectobacterium wasabiae
           WPP163]
 gi|261606527|gb|ACX89013.1| cytochrome o ubiquinol oxidase, subunit III [Pectobacterium
           wasabiae WPP163]
          Length = 204

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 96/178 (53%), Positives = 125/178 (70%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSD ++F   F TYAVL    A GP+  D+F +  + V T  LL SS++   AM
Sbjct: 28  GFWVYLMSDLIIFGSLFATYAVLVNGTAGGPSGKDIFQLPFVLVETFALLFSSITYGMAM 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K    +  +WL VT  FG++FI MEIYEF HLI     P RSAFLS+FFALVG H
Sbjct: 88  IA-MNKGNKSQVNTWLGVTFLFGLVFIGMEIYEFHHLIVEGYGPDRSAFLSAFFALVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIWL +++IQ+ K+GL + N+ RL+CLS+FWHFLD++WICVF+ VYL+G +
Sbjct: 147 GLHVTGGLIWLVIMMIQVSKRGLTATNKTRLMCLSLFWHFLDVVWICVFTVVYLLGAI 204


>gi|253687436|ref|YP_003016626.1| cytochrome o ubiquinol oxidase, subunit III [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|251754014|gb|ACT12090.1| cytochrome o ubiquinol oxidase, subunit III [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 204

 Score =  191 bits (486), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 96/178 (53%), Positives = 125/178 (70%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSD ++F   F TYAVL    A GP+  D+F +  + V T  LL SS++   AM
Sbjct: 28  GFWVYLMSDLIIFGSLFATYAVLVNGTAGGPSGKDIFQLPFVLVETFALLFSSITYGMAM 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K    +  +WL VT  FG++FI MEIYEF HLI     P RSAFLS+FFALVG H
Sbjct: 88  IA-MNKGNKSQVNAWLGVTFLFGLVFIGMEIYEFHHLIVEGYGPDRSAFLSAFFALVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIWL +++IQ+ K+GL + N+ RL+CLS+FWHFLD++WICVF+ VYL+G +
Sbjct: 147 GLHVTGGLIWLVIMMIQVSKRGLTATNKTRLMCLSLFWHFLDVVWICVFTVVYLLGAI 204


>gi|212634273|ref|YP_002310798.1| cytochrome c oxidase subunit III [Shewanella piezotolerans WP3]
 gi|212555757|gb|ACJ28211.1| Cytochrome c oxidase, subunit III [Shewanella piezotolerans WP3]
          Length = 223

 Score =  191 bits (486), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 128/181 (70%), Gaps = 1/181 (0%)

Query: 28  DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
             T  GFW+YLM+DC++FA  F TYAVL  N   G +  D+F+++ + + T+ LLLSS++
Sbjct: 30  QNTLFGFWLYLMTDCILFASVFATYAVLYMNTDGGVSGKDIFELNFVLIETVALLLSSIT 89

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
              A++  A +     TV WLL+T   G +FI MEIYEF HLI     PQRSAFLSSFFA
Sbjct: 90  FGMALIF-AKRHNRRATVIWLLITLALGCVFIGMEIYEFHHLIEQGNGPQRSAFLSSFFA 148

Query: 148 LVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           LVG+HGLHV  GLIW+ +++I++LK GL   +  RL CLS+FWHFLD++WICVF+ VYL+
Sbjct: 149 LVGMHGLHVTAGLIWMVIMMIEVLKTGLNHRSITRLGCLSLFWHFLDIVWICVFTVVYLL 208

Query: 208 G 208
           G
Sbjct: 209 G 209


>gi|239830889|ref|ZP_04679218.1| cytochrome o ubiquinol oxidase, subunit III [Ochrobactrum
           intermedium LMG 3301]
 gi|239823156|gb|EEQ94724.1| cytochrome o ubiquinol oxidase, subunit III [Ochrobactrum
           intermedium LMG 3301]
          Length = 209

 Score =  191 bits (486), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 99/200 (49%), Positives = 134/200 (67%), Gaps = 5/200 (2%)

Query: 15  FYVKDKKESCVDHDG----TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFD 70
           F   ++  +  DH      T +GFWIYLMSDC++F+  F TYAVL   +A GP   ++FD
Sbjct: 11  FLGGNEHPAHEDHHDAGSTTLVGFWIYLMSDCVLFSGLFATYAVLAHQFAGGPTGRELFD 70

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
           ++ + + T++LL+SSL+   A L S  K+     + WL +T   G  F+ ME+YEF HLI
Sbjct: 71  LNFVLIETMLLLVSSLTYGLATL-SMFKKNRAGLLFWLGITFLLGAAFLAMEVYEFNHLI 129

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
              A P RSAFLS+FFALVG HGLH+  GLIW+ VL  Q+L+ GL   NQ R++CLS+FW
Sbjct: 130 HEGAGPGRSAFLSAFFALVGTHGLHITSGLIWILVLSAQLLRDGLTEKNQTRVMCLSLFW 189

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD+IWI VF+ VYL+GV+
Sbjct: 190 HFLDIIWIGVFTLVYLLGVL 209


>gi|330011526|ref|ZP_08307112.1| cytochrome o ubiquinol oxidase, subunit III [Klebsiella sp. MS
           92-3]
 gi|328534143|gb|EGF60778.1| cytochrome o ubiquinol oxidase, subunit III [Klebsiella sp. MS
           92-3]
          Length = 181

 Score =  191 bits (486), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 99/178 (55%), Positives = 124/178 (69%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++FA  F TYAVL    A GP   D+F++  + V T +LL SS++   A 
Sbjct: 5   GFWIYLMSDCIIFATLFATYAVLVNGTAGGPTGKDIFELPFVLVETALLLFSSITYGMAA 64

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K    + VSWL +T  FG  FI MEIYEF HLI     P RS FLS+FFALVG H
Sbjct: 65  IA-MYKNNKSQVVSWLALTWLFGAGFIGMEIYEFHHLIMEGFGPDRSGFLSAFFALVGTH 123

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+ VL+ Q+ ++GL S N+ R++CLS+FWHFLD++WICVFS VYLMG +
Sbjct: 124 GLHVTSGLIWMAVLMFQVSRRGLTSTNRTRILCLSLFWHFLDVVWICVFSVVYLMGAM 181


>gi|291616542|ref|YP_003519284.1| CyoC [Pantoea ananatis LMG 20103]
 gi|291151572|gb|ADD76156.1| CyoC [Pantoea ananatis LMG 20103]
 gi|327392973|dbj|BAK10395.1| cytochrome o ubiquinol oxidase subunit III CyoC [Pantoea ananatis
           AJ13355]
          Length = 204

 Score =  191 bits (486), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 130/200 (65%), Gaps = 7/200 (3%)

Query: 17  VKDKKESCVDHD------GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFD 70
           VK   ++  +H           GFWIYLMSDC++FA  F TYAV+  + A GPA  D+F+
Sbjct: 6   VKHHHDAHAEHGHHDAGANKVFGFWIYLMSDCIIFATLFATYAVMVNSTAGGPAGKDIFE 65

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
           +  + V T +LLLSS++   A++A   K      + WL +T  FG  FI MEIYEF HLI
Sbjct: 66  LPFVLVETALLLLSSITYGMAVIA-MNKENKGAVIGWLALTFLFGAGFIGMEIYEFHHLI 124

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                P RS FLS FF LVG HGLHV  GLIW+ VL+ QI K+GL + N+ R++CLS+FW
Sbjct: 125 VEGFGPDRSGFLSGFFTLVGTHGLHVTSGLIWMAVLMFQIAKRGLNATNRTRIMCLSLFW 184

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD++WICVF+ VYLMG +
Sbjct: 185 HFLDVVWICVFTVVYLMGAM 204


>gi|311108451|ref|YP_003981304.1| cytochrome O ubiquinol oxidase subunit III 1 [Achromobacter
           xylosoxidans A8]
 gi|310763140|gb|ADP18589.1| cytochrome O ubiquinol oxidase, subunit III 1 [Achromobacter
           xylosoxidans A8]
          Length = 204

 Score =  191 bits (485), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 97/181 (53%), Positives = 125/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLMSD L+F+V F T+AVL    A GP   ++FD+  + V T++LL SS +  
Sbjct: 25  TVFGFWVYLMSDLLIFSVLFATFAVLSNATAGGPTGKELFDLKFVLVETLLLLFSSFTFG 84

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
            A L         + + WL+VT  FG  FI ME+YEF HLI+  A P RSA+LS+FF L+
Sbjct: 85  MANLNVHANN-KSRAMGWLMVTFLFGAGFIAMEVYEFHHLITEGAGPGRSAYLSAFFTLI 143

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV FGLIW+ VL+  I + GL S N+RRL CLS+FWHFLD++WICVF+FVYLMG 
Sbjct: 144 GTHGLHVTFGLIWIIVLLDMIRRHGLDSINKRRLACLSLFWHFLDIVWICVFTFVYLMGA 203

Query: 210 V 210
           +
Sbjct: 204 L 204


>gi|170692896|ref|ZP_02884058.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia graminis
           C4D1M]
 gi|170142552|gb|EDT10718.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia graminis
           C4D1M]
          Length = 202

 Score =  191 bits (485), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 132/201 (65%), Gaps = 2/201 (0%)

Query: 11  NFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFD 70
           N +L    D          T  GFW+YLM+DC++FA  F  +AV+   +A GP+  D+FD
Sbjct: 3   NNTLSVSLDGGHGNHGSSDTVFGFWLYLMTDCVLFASLFAVFAVMSNQFAGGPSGKDLFD 62

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
           I G+ V T  LLLSS++  FAMLA A +      ++WL VT   G+ F+ +E+ EF+HLI
Sbjct: 63  IGGVAVETAALLLSSITYGFAMLA-ARRGKSTAVLAWLAVTFVLGLAFLALEMREFSHLI 121

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ-RRLICLSMF 189
           +  A P RSAFLS+FF LVG HGLHV  GL+W+ VL +QI++   +S  Q  RL CLS+F
Sbjct: 122 AEGAGPARSAFLSAFFTLVGTHGLHVTVGLVWMAVLAVQIVRGPGLSERQLTRLACLSLF 181

Query: 190 WHFLDLIWICVFSFVYLMGVV 210
           WHFLD++WICVFSFVYL  V+
Sbjct: 182 WHFLDIVWICVFSFVYLGSVL 202


>gi|238897314|ref|YP_002922991.1| cytochrome o ubiquinol oxidase, subunit III [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
 gi|229465069|gb|ACQ66843.1| cytochrome o ubiquinol oxidase, subunit III [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
          Length = 204

 Score =  191 bits (484), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 133/202 (65%), Gaps = 10/202 (4%)

Query: 17  VKDKKESCVDHDGTY-------LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVF 69
           V  +  S   HD  +        GFWIYLMSDC++FA  F TY VL    A GP   D+F
Sbjct: 5   VSQETMSTQKHDEHHENGSTKIFGFWIYLMSDCILFAALFATYVVLVNGTAGGPMGKDIF 64

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVS-WLLVTAFFGMIFIIMEIYEFAH 128
           ++  + V T +LL SS++  FA+LA    +   K+V+ WL +T   G+ F+ MEI+EF  
Sbjct: 65  NLPFVLVETFLLLFSSMTYGFAILAMNQGQ--KKSVNIWLGLTFLLGLSFVGMEIFEFHE 122

Query: 129 LISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSM 188
           LI   A P RSAFLSSFFALVG HGLHV  GLIW+ V+++QI ++GL   NQ RL+CLS+
Sbjct: 123 LIGEGAGPDRSAFLSSFFALVGTHGLHVALGLIWIVVMMVQISQRGLNPINQTRLMCLSL 182

Query: 189 FWHFLDLIWICVFSFVYLMGVV 210
           FWHFLD+IWICVF+ VYL+G +
Sbjct: 183 FWHFLDVIWICVFTIVYLLGAM 204


>gi|285017725|ref|YP_003375436.1| cytochrome o ubiquinol oxidase subunit III protein [Xanthomonas
           albilineans GPE PC73]
 gi|283472943|emb|CBA15448.1| probable cytochrome o ubiquinol oxidase subunit III protein
           [Xanthomonas albilineans]
          Length = 206

 Score =  191 bits (484), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 123/181 (67%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL SSL   
Sbjct: 27  TVFGFWVYLMSDCLIFAGLFATYAVLAGATVDGPTAKELFDLKFVLVETFLLLFSSLGFG 86

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
            AM+A A +R +    +WL VTA  G+ F+ ME+YEF HLI   A P RSAFLS+FF LV
Sbjct: 87  LAMIA-AHRRSMGGLYAWLAVTAALGLGFLGMELYEFHHLIHEGAGPGRSAFLSAFFTLV 145

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GL+W+ VLVIQI + GL   N  RL CLS+FWHFLD+IWI VF+ VYL+G 
Sbjct: 146 GTHGLHVASGLLWMTVLVIQIARNGLTPRNSTRLACLSLFWHFLDVIWIGVFTIVYLLGA 205

Query: 210 V 210
           +
Sbjct: 206 L 206


>gi|114561410|ref|YP_748923.1| cytochrome c oxidase, subunit III [Shewanella frigidimarina NCIMB
           400]
 gi|114332703|gb|ABI70085.1| cytochrome c oxidase, subunit III [Shewanella frigidimarina NCIMB
           400]
          Length = 211

 Score =  191 bits (484), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 92/182 (50%), Positives = 130/182 (71%), Gaps = 1/182 (0%)

Query: 29  GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSC 88
            T  GFWIYLM+DC++FA  F TYAVL  N   G +  D+F++  + + T  LL+SS++ 
Sbjct: 31  NTLFGFWIYLMTDCILFASVFATYAVLFMNTDGGVSGKDIFELDFVLIETAALLVSSITY 90

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            FAM+ +  ++    T+ WLL+T   G +FI ME+YEF HLI     P RSAFLS+FFAL
Sbjct: 91  GFAMICARHQKKA-ATLGWLLITFALGCVFIAMEVYEFHHLIEHGNGPDRSAFLSAFFAL 149

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           VG+HGLHV  GLIW+ ++++++LK GL + +  RL CLS+FWHFLD++W+CVF+ VYL+G
Sbjct: 150 VGMHGLHVTAGLIWMLIMMVEVLKTGLTNRSITRLSCLSLFWHFLDIVWVCVFTVVYLLG 209

Query: 209 VV 210
           V+
Sbjct: 210 VL 211


>gi|209808984|ref|YP_002264522.1| cytochrome o ubiquinol oxidase subunit III [Aliivibrio salmonicida
           LFI1238]
 gi|208010546|emb|CAQ80915.1| cytochrome o ubiquinol oxidase subunit III [Aliivibrio salmonicida
           LFI1238]
          Length = 202

 Score =  190 bits (483), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 124/178 (69%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++F   F TYAVL    A GP+  D+F++  +FV T++LLLSS++  F +
Sbjct: 26  GFWIYLMSDCILFGSLFATYAVLVNATAGGPSGKDIFELPFVFVETMLLLLSSITFGFGI 85

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   + L      WLL+TA  G+ FI ME+YEF HLI     PQRSAFLS+FF LVG H
Sbjct: 86  IAMKREDLA-GLKRWLLITALLGLGFISMEVYEFNHLIGEGFGPQRSAFLSAFFTLVGTH 144

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV FGLIWL V   Q+  KGL    + R  CLS+FWHFLD++WICVF+ VYL+GV+
Sbjct: 145 GLHVTFGLIWLSVCYFQLNTKGLNDLMKGRFYCLSLFWHFLDIVWICVFTIVYLLGVI 202


>gi|317403854|gb|EFV84328.1| cytochrome o ubiquinol oxidase subunit III [Achromobacter
           xylosoxidans C54]
          Length = 204

 Score =  190 bits (483), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 125/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLMSD L+F+V F T+AVL    A GP   ++FD+  + V T++LL SS +  
Sbjct: 25  TVFGFWVYLMSDLLIFSVLFATFAVLANATAGGPTGKELFDLKFVLVETLLLLFSSFTFG 84

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
            A L         + + WL+VT  FG  FI ME+YEF HLI+  A P RSA+LS+FF L+
Sbjct: 85  MANLNVHANNK-SRAIGWLMVTFLFGAGFIAMEVYEFHHLITEGAGPGRSAYLSAFFTLI 143

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV FGLIW+ V++  I + GL S N+RRL CLS+FWHFLD++WICVF+FVYL+G 
Sbjct: 144 GTHGLHVTFGLIWIVVMIDMIRRHGLDSINKRRLACLSLFWHFLDIVWICVFTFVYLLGA 203

Query: 210 V 210
           +
Sbjct: 204 L 204


>gi|322834053|ref|YP_004214080.1| cytochrome o ubiquinol oxidase, subunit III [Rahnella sp. Y9602]
 gi|321169254|gb|ADW74953.1| cytochrome o ubiquinol oxidase, subunit III [Rahnella sp. Y9602]
          Length = 204

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 122/178 (68%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++FA  F TYAVL    A GP+  D+F++  + V T  LL SS++  FAM
Sbjct: 28  GFWIYLMSDCILFASLFATYAVLVNGTAGGPSGKDIFELPFVLVETFCLLFSSITYGFAM 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           L    K        WL +T  FG+ FI ME+YEF HLI+    PQRS FLS FFALV  H
Sbjct: 88  LG-MNKGNKAAVNGWLFLTFLFGLGFIGMELYEFHHLIAEGYGPQRSGFLSGFFALVATH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+  +++Q+ ++GL   N+ RL+CLS+FWHFLD++WICVF+ VYLMG +
Sbjct: 147 GLHVTCGLIWILTMMVQVSRRGLTEVNKTRLMCLSLFWHFLDVVWICVFTVVYLMGAM 204


>gi|26987550|ref|NP_742975.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas putida
           KT2440]
 gi|24982223|gb|AAN66439.1|AE016273_8 cytochrome o ubiquinol oxidase, subunit III [Pseudomonas putida
           KT2440]
 gi|18149143|dbj|BAB83595.1| cytochrome o oxidase C [Pseudomonas putida]
          Length = 207

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 126/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T LGFW+YLM+DC++FA  F TYAVL  ++A GP+  D+F +  + V T+ LLLSS++  
Sbjct: 28  TVLGFWLYLMTDCILFASLFATYAVLSGSFAGGPSGHDIFQLDFVAVETLFLLLSSITFG 87

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAML     +     + WL VT  FG  FI MEIYEF HLIS    PQRS FLS FFALV
Sbjct: 88  FAMLKMFDGKKA-GVLGWLAVTFLFGAGFIAMEIYEFHHLISEGFGPQRSGFLSGFFALV 146

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GLIW+ +++ QI K G+    + R+ CLS+FWHFLD++WICVF+ VYL+GV
Sbjct: 147 GTHGLHVTAGLIWMAIMMYQINKHGITPTAKTRMSCLSLFWHFLDVVWICVFTVVYLLGV 206

Query: 210 V 210
           +
Sbjct: 207 L 207


>gi|148546081|ref|YP_001266183.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas putida F1]
 gi|167031866|ref|YP_001667097.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas putida
           GB-1]
 gi|148510139|gb|ABQ76999.1| Cytochrome o ubiquinol oxidase, subunit III [Pseudomonas putida F1]
 gi|166858354|gb|ABY96761.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas putida
           GB-1]
          Length = 208

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 126/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T LGFW+YLM+DC++FA  F TYAVL  ++A GP+  D+F +  + V T+ LLLSS++  
Sbjct: 29  TVLGFWLYLMTDCILFASLFATYAVLSGSFAGGPSGHDIFQLDFVAVETLFLLLSSITFG 88

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAML     +     + WL VT  FG  FI MEIYEF HLIS    PQRS FLS FFALV
Sbjct: 89  FAMLKMFDGKKA-GVLGWLAVTFLFGAGFIAMEIYEFHHLISEGFGPQRSGFLSGFFALV 147

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GLIW+ +++ QI K G+    + R+ CLS+FWHFLD++WICVF+ VYL+GV
Sbjct: 148 GTHGLHVTAGLIWMAIMMYQINKHGITPTAKTRMSCLSLFWHFLDVVWICVFTVVYLLGV 207

Query: 210 V 210
           +
Sbjct: 208 L 208


>gi|289662731|ref|ZP_06484312.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas campestris
           pv. vasculorum NCPPB702]
          Length = 210

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 106/198 (53%), Positives = 130/198 (65%), Gaps = 4/198 (2%)

Query: 16  YVKDKKESCVDHDG---TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
           +   +      HDG   T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+ 
Sbjct: 14  HAGGQDHDHEHHDGGGNTVFGFWVYLMSDCLLFAGLFATYAVLSGATVDGPTAKELFDLK 73

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + V T +LL SSLS  FAM+A A KR +     WL VTA  G+ F+ ME++EF HLI  
Sbjct: 74  FVLVETFLLLFSSLSFGFAMIA-AHKRKMGGLYGWLAVTALLGIGFLCMEVWEFNHLIHE 132

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
            A P RSAFLS+FF LVG HGLHV  GL+W+ VLVIQI K GL + N  RL CLS+FWHF
Sbjct: 133 GAGPSRSAFLSAFFTLVGTHGLHVASGLLWMAVLVIQISKNGLTARNSTRLACLSLFWHF 192

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD+IWI VF+ VYL+G +
Sbjct: 193 LDIIWIGVFTVVYLLGAL 210


>gi|295096782|emb|CBK85872.1| cytochrome bo3 quinol oxidase subunit 3 [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 204

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 99/178 (55%), Positives = 123/178 (69%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++F   F TYAVL    A GP   D+F++  + V T +LL SS++   A 
Sbjct: 28  GFWIYLMSDCILFCCLFATYAVLVNGTAGGPTGKDIFELPFVLVETALLLFSSITYGMAA 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K    + VSWL +T  FG  FI MEIYEF HLI     P RS FLS+FFALVG H
Sbjct: 88  IA-MYKNNKSQVVSWLALTWLFGAGFIGMEIYEFHHLIMEGFGPDRSGFLSAFFALVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+ VL+ QI ++GL S N+ R++CLS+FWHFLD++WICVFS VYLMG +
Sbjct: 147 GLHVTSGLIWMAVLMFQISRRGLTSTNRTRIMCLSLFWHFLDVVWICVFSVVYLMGAM 204


>gi|170723535|ref|YP_001751223.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas putida
           W619]
 gi|169761538|gb|ACA74854.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas putida
           W619]
          Length = 207

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 97/181 (53%), Positives = 126/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T LGFW+YLM+DC++FA  F TYAVL  ++A GP+  D+F +  + V T+ LLLSS++  
Sbjct: 28  TVLGFWLYLMTDCILFASLFATYAVLSGSFAGGPSGHDIFQLDFVAVETLFLLLSSITFG 87

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAML     +     + WL VT  FG  FI MEIYEF HLI+    PQRS FLS FFALV
Sbjct: 88  FAMLKMFDGKKA-GVLGWLAVTFLFGAAFIAMEIYEFHHLIAEGYGPQRSGFLSGFFALV 146

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GLIW+ +++ QI K G+    + R+ CLS+FWHFLD++WICVF+ VYL+GV
Sbjct: 147 GTHGLHVTAGLIWMAIMMYQINKHGITPTAKTRMSCLSLFWHFLDVVWICVFTVVYLLGV 206

Query: 210 V 210
           +
Sbjct: 207 L 207


>gi|332307457|ref|YP_004435308.1| cytochrome o ubiquinol oxidase, subunit III [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332174786|gb|AEE24040.1| cytochrome o ubiquinol oxidase, subunit III [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 215

 Score =  190 bits (482), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 98/179 (54%), Positives = 127/179 (70%), Gaps = 1/179 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLM+DC++FA  F TYAVL  N   G +  D+FD++ + V T  LL+SS++  
Sbjct: 36  TLFGFWLYLMTDCILFASVFATYAVLYMNTDGGVSGKDIFDLNFVLVETAALLVSSITYG 95

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FA+L  A K+    T+ WLLVT   G +FI ME+YEF HLI     P  SAFLSSFFALV
Sbjct: 96  FALLC-AHKQQKAGTLLWLLVTMALGCVFIAMEVYEFHHLIVEGNGPDGSAFLSSFFALV 154

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           G+HGLHV  GLIW+ V+V ++LK+GL +    RL CLS+FWHFLD++W+CVFS VYL+G
Sbjct: 155 GMHGLHVTAGLIWMLVMVFEVLKRGLGAQTVTRLGCLSLFWHFLDIVWVCVFSVVYLLG 213


>gi|261341031|ref|ZP_05968889.1| cytochrome o ubiquinol oxidase, subunit III [Enterobacter
           cancerogenus ATCC 35316]
 gi|288316896|gb|EFC55834.1| cytochrome o ubiquinol oxidase, subunit III [Enterobacter
           cancerogenus ATCC 35316]
          Length = 204

 Score =  189 bits (481), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 123/178 (69%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++F   F TYAVL    A GP   D+F++  + V T +LL SS++   A 
Sbjct: 28  GFWIYLMSDCILFCCLFATYAVLVNGTAGGPTGKDIFELPFVLVETALLLFSSITYGMAA 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K    + VSWL +T  FG  FI MEIYEF HLI     P RS FLS+FFALVG H
Sbjct: 88  IA-MYKNNKSQVVSWLALTWLFGAGFIGMEIYEFHHLIMEGFGPDRSGFLSAFFALVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+ VL+ Q+ ++GL S N+ R++CLS+FWHFLD++WICVFS VYLMG +
Sbjct: 147 GLHVTSGLIWMAVLMFQVSRRGLTSTNRTRIMCLSLFWHFLDVVWICVFSVVYLMGAM 204


>gi|170724798|ref|YP_001758824.1| cytochrome o ubiquinol oxidase subunit III [Shewanella woodyi ATCC
           51908]
 gi|169810145|gb|ACA84729.1| cytochrome o ubiquinol oxidase, subunit III [Shewanella woodyi ATCC
           51908]
          Length = 215

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 138/211 (65%), Gaps = 4/211 (1%)

Query: 3   RQKIG---KSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY 59
           R  +G    + ++ + +     E     + T  GFW+YLM+DC++FA  F TYAVL  N 
Sbjct: 6   RANLGVADANKHYDVSHATSHDEHHDTSENTLFGFWLYLMTDCILFASVFATYAVLYMNT 65

Query: 60  AAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFI 119
             G +  D+F+++ + + T  LL+SS++  FA++ +  ++    T+ WLL+T   G  FI
Sbjct: 66  DGGVSGKDIFELNFVLIETAALLVSSITFGFALICAKHQKKA-ATLGWLLITFALGCAFI 124

Query: 120 IMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGN 179
            MEIYEF HLI     PQRSAFLSSFFALVG+HGLHV  GL+W+ +++ ++LK GL   +
Sbjct: 125 GMEIYEFHHLIEHGNGPQRSAFLSSFFALVGMHGLHVTAGLVWMAIMMFEVLKTGLNKRS 184

Query: 180 QRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
             RL CLS+FWHFLD++WICVF+ VYL+G +
Sbjct: 185 ITRLGCLSLFWHFLDIVWICVFTVVYLLGAM 215


>gi|253990903|ref|YP_003042259.1| cytochrome o ubiquinol oxidase subunit III [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253782353|emb|CAQ85517.1| cyoC; Cytochrome O ubiquinol oxidase subunit III (Ubiquinol oxidase
           chain C) [Photorhabdus asymbiotica]
          Length = 206

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 126/178 (70%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++FA  F TYAVL    A GP+  ++F +S + V T +LL SS++  FAM
Sbjct: 30  GFWIYLMSDCILFACLFATYAVLVNGTAGGPSGKEIFGLSFVLVETFLLLFSSITYGFAM 89

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           L    K  I +  +WL +T  FG+ F+ ME+YEF HLI+    P RSAFLS FFALV  H
Sbjct: 90  LG-MNKGKIGQVNAWLGMTFLFGLGFVAMELYEFHHLIAEGHGPDRSAFLSGFFALVATH 148

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           G+HV  GL+W+ +++IQ+ ++GL   N+ RL CLS+FWHFLD++WICVF+ VYL+G +
Sbjct: 149 GIHVTCGLVWIIIMMIQVTRRGLTDVNKTRLNCLSLFWHFLDVVWICVFTVVYLLGAM 206


>gi|104780179|ref|YP_606677.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas entomophila
           L48]
 gi|95109166|emb|CAK13863.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas entomophila
           L48]
          Length = 207

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 97/181 (53%), Positives = 126/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T LGFW+YLM+DC++FA  F TYAVL  ++A GP+  D+F +  + V T  LLLSS++  
Sbjct: 28  TVLGFWLYLMTDCILFASLFATYAVLSGSFAGGPSGHDIFQLDFVLVETAFLLLSSITFG 87

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAML     +     + WL VT  FG  FI MEIYEF HLI+    PQRS FLS+FFALV
Sbjct: 88  FAMLKMFDGKKA-GVLGWLAVTFLFGAGFIAMEIYEFHHLIAEGFGPQRSGFLSAFFALV 146

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GLIW+ +++ QI K G+    + R+ CLS+FWHFLD++WICVF+ VYL+GV
Sbjct: 147 GTHGLHVTAGLIWMAIMMYQINKHGITPTAKTRMSCLSLFWHFLDVVWICVFTVVYLLGV 206

Query: 210 V 210
           +
Sbjct: 207 L 207


>gi|85058643|ref|YP_454345.1| cytochrome o ubiquinol oxidase subunit III [Sodalis glossinidius
           str. 'morsitans']
 gi|84779163|dbj|BAE73940.1| cytochrome o ubiquinol oxidase subunit III [Sodalis glossinidius
           str. 'morsitans']
          Length = 204

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 123/178 (69%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++FA  F TYAVL  + A GP   D+F++  + V T  LL SS++   A+
Sbjct: 28  GFWIYLMSDCILFATLFATYAVLSNSVAGGPTGKDIFELPFVLVETFFLLFSSITYGMAI 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           LA   +    +   WL +T  FG+ FI ME+YEF HLI+    P RSAFLS FF LVG H
Sbjct: 88  LA-MYRGYKSRVNVWLGMTFLFGLGFICMELYEFHHLIAEGYGPDRSAFLSGFFTLVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+ V+++Q+ ++GL   NQ RL CLS+FWHFLD++WICVF+ VYLMG +
Sbjct: 147 GLHVTSGLIWILVMMVQVSRRGLTPVNQTRLQCLSLFWHFLDVVWICVFTVVYLMGAL 204


>gi|17988182|ref|NP_540816.1| cytochrome O ubiquinol oxidase subunit III [Brucella melitensis bv.
           1 str. 16M]
 gi|256045834|ref|ZP_05448710.1| cytochrome O ubiquinol oxidase subunit III [Brucella melitensis bv.
           1 str. Rev.1]
 gi|260563125|ref|ZP_05833611.1| cytochrome c oxidase [Brucella melitensis bv. 1 str. 16M]
 gi|265992248|ref|ZP_06104805.1| cytochrome o ubiquinol oxidase subunit III [Brucella melitensis bv.
           1 str. Rev.1]
 gi|17983943|gb|AAL53080.1| cytochrome o ubiquinol oxidase subunit iii [Brucella melitensis bv.
           1 str. 16M]
 gi|260153141|gb|EEW88233.1| cytochrome c oxidase [Brucella melitensis bv. 1 str. 16M]
 gi|263003314|gb|EEZ15607.1| cytochrome o ubiquinol oxidase subunit III [Brucella melitensis bv.
           1 str. Rev.1]
          Length = 209

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 128/196 (65%), Gaps = 4/196 (2%)

Query: 18  KDKKESCVDHDG---TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
            D       HD    T +GFWIYLMSDC++F+  F TYAVL   +A GP   ++FD+  +
Sbjct: 15  NDHPAHEDHHDAGSTTLVGFWIYLMSDCILFSGLFATYAVLAHQFAGGPTGRELFDLQFV 74

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            V T++LL+SSL+   A L S  K      + WL VT   G  F++MEIYEF HLI   A
Sbjct: 75  LVETMLLLVSSLTHGLATL-SMYKNNRSGVLGWLGVTFLLGAAFLVMEIYEFHHLIVEGA 133

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            P RS+FLS+FF LVG HGLH+  GLIW+ VL   +L+ GL   N+ R++CLS+FWHFLD
Sbjct: 134 GPDRSSFLSAFFTLVGTHGLHITSGLIWILVLSAMLLRDGLTERNRTRVMCLSLFWHFLD 193

Query: 195 LIWICVFSFVYLMGVV 210
           +IWI VF+ VYL+GV+
Sbjct: 194 IIWIGVFTLVYLLGVL 209


>gi|8134388|sp|Q9WWR3|CYOC_PSEPU RecName: Full=Cytochrome o ubiquinol oxidase subunit 3; AltName:
           Full=Cytochrome o ubiquinol oxidase subunit III
 gi|4586339|dbj|BAA76358.1| cytochrome o ubiquinol oxidase C [Pseudomonas putida]
          Length = 207

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 97/181 (53%), Positives = 126/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T LGFW+YLM+DC++FA  F TYAVL  ++A GP+  D+F +  + V T+ LLLSS++  
Sbjct: 28  TVLGFWLYLMTDCILFASLFATYAVLSGSFAGGPSGHDIFQLDFVAVETLFLLLSSITFG 87

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAML     +     + WL VT  FG  FI MEIYEF HLI+    PQRS FLS FFALV
Sbjct: 88  FAMLKMFDGKKA-GVLGWLAVTFLFGAGFIAMEIYEFHHLIAEGFGPQRSGFLSGFFALV 146

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GLIW+ +++ QI K G+    + R+ CLS+FWHFLD++WICVF+ VYL+GV
Sbjct: 147 GTHGLHVTAGLIWMAIMMYQINKHGITPTAKTRMSCLSLFWHFLDVVWICVFTVVYLLGV 206

Query: 210 V 210
           +
Sbjct: 207 L 207


>gi|330859962|emb|CBX70291.1| cytochrome o ubiquinol oxidase subunit 3 [Yersinia enterocolitica
           W22703]
          Length = 198

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 123/172 (71%), Gaps = 1/172 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++FA  F TYAVL    A GP+  D+FD++ + V T +LL SS++   AM
Sbjct: 28  GFWIYLMSDCILFATLFATYAVLVNGTAGGPSGRDIFDLNFVLVETFLLLFSSITYGIAM 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           L    K   ++  +WL +T  FG+ F+ MEIYEF HLI+    P RSAFLSSFFALV  H
Sbjct: 88  LG-MNKGHKNQVNTWLGLTFLFGLGFVAMEIYEFHHLIAEGYGPDRSAFLSSFFALVATH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFV 204
           G+HV  GL+W+ +++IQ+ K+GL   N+ RL+CLS+FWHFLD++WICVF+ V
Sbjct: 147 GIHVTAGLVWIIIMMIQVAKRGLNETNRTRLMCLSLFWHFLDVVWICVFTVV 198


>gi|90409891|ref|ZP_01217908.1| cytochrome o ubiquinol oxidase, subunit III [Photobacterium
           profundum 3TCK]
 gi|90329244|gb|EAS45501.1| cytochrome o ubiquinol oxidase, subunit III [Photobacterium
           profundum 3TCK]
          Length = 211

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 123/178 (69%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++FA  F TYAVL    A GP+  D+FD+  +F  T++LL SS++  F +
Sbjct: 35  GFWIYLMSDCILFASLFATYAVLVNGIAGGPSGKDIFDLPFVFTETMLLLFSSITFGFGI 94

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   +  +     WL +T  FG+ FI ME++EF HLI+    PQRSAFLS+FF LVG H
Sbjct: 95  IA-MKRNDVAGLKRWLAITFLFGLSFIAMELWEFHHLINEGFGPQRSAFLSAFFTLVGTH 153

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIWL V   Q+  KGL S  Q R  CLS+FWHFLD++WICVF+ VYL+GVV
Sbjct: 154 GLHVTAGLIWLSVCYYQVSTKGLTSMMQTRFYCLSLFWHFLDIVWICVFTIVYLLGVV 211


>gi|146310558|ref|YP_001175632.1| cytochrome o ubiquinol oxidase subunit III [Enterobacter sp. 638]
 gi|145317434|gb|ABP59581.1| cytochrome bo3 quinol oxidase subunit 3 [Enterobacter sp. 638]
          Length = 204

 Score =  189 bits (479), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 96/178 (53%), Positives = 124/178 (69%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++F   F TYAVL    A GP   D+F++  + V T +LL SS++   A 
Sbjct: 28  GFWIYLMSDCILFCCLFATYAVLVNGTAGGPTGKDIFELPFVLVETGLLLFSSITYGMAA 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K    + +SWL +T  FG  FI MEIYEF HLI+    P RS FLS+FFALVG H
Sbjct: 88  IA-MYKNNKSQVISWLALTWLFGAGFIGMEIYEFHHLIAEGFGPDRSGFLSAFFALVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+ VL+ Q+ ++GL + N+ R++CLS+FWHFLD++WICVFS VYLMG +
Sbjct: 147 GLHVTSGLIWMAVLMFQVYRRGLTNTNRTRIMCLSLFWHFLDVVWICVFSVVYLMGAM 204


>gi|307725995|ref|YP_003909208.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia sp.
           CCGE1003]
 gi|307586520|gb|ADN59917.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia sp.
           CCGE1003]
          Length = 202

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 130/193 (67%), Gaps = 2/193 (1%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           D          T  GFW+YLM+DC++FA  F  +AV+   +A GP+  ++FDISG+ V T
Sbjct: 11  DGGHGNHGSSDTVFGFWLYLMTDCVLFASLFAVFAVMSNQFAGGPSGKELFDISGVAVET 70

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
             LLLSS++  FAMLA A +      + WL VT   G+ F+++E+ EF+HLI+  A P R
Sbjct: 71  AALLLSSITYGFAMLA-ARRGKSAAVLGWLAVTFALGLAFLVLEMREFSHLIAEGAGPGR 129

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ-RRLICLSMFWHFLDLIW 197
           SAFLS+FF LVG HGLHV  GL+W+ VL +Q+++   +S  +  RL CLS+FWHFLD++W
Sbjct: 130 SAFLSAFFTLVGTHGLHVTVGLVWMAVLAVQVVRAPKLSERELTRLACLSLFWHFLDIVW 189

Query: 198 ICVFSFVYLMGVV 210
           ICVFSFVYL  V+
Sbjct: 190 ICVFSFVYLGSVL 202


>gi|22124926|ref|NP_668349.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis KIM 10]
 gi|45440614|ref|NP_992153.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51595300|ref|YP_069491.1| cytochrome o ubiquinol oxidase subunit III [Yersinia
           pseudotuberculosis IP 32953]
 gi|108808651|ref|YP_652567.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis
           Antiqua]
 gi|108811090|ref|YP_646857.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis
           Nepal516]
 gi|145600060|ref|YP_001164136.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis
           Pestoides F]
 gi|149364988|ref|ZP_01887023.1| cytochrome O ubiquinol oxidase subunit III [Yersinia pestis
           CA88-4125]
 gi|153950151|ref|YP_001402060.1| cytochrome O ubiquinol oxidase subunit III [Yersinia
           pseudotuberculosis IP 31758]
 gi|162418305|ref|YP_001607428.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis Angola]
 gi|165926547|ref|ZP_02222379.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165935983|ref|ZP_02224553.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166010997|ref|ZP_02231895.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166213115|ref|ZP_02239150.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167398830|ref|ZP_02304354.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167421497|ref|ZP_02313250.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167423092|ref|ZP_02314845.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167469783|ref|ZP_02334487.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis FV-1]
 gi|170025460|ref|YP_001721965.1| cytochrome o ubiquinol oxidase subunit III [Yersinia
           pseudotuberculosis YPIII]
 gi|186894317|ref|YP_001871429.1| cytochrome o ubiquinol oxidase subunit III [Yersinia
           pseudotuberculosis PB1/+]
 gi|218930196|ref|YP_002348071.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis CO92]
 gi|229838771|ref|ZP_04458930.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229896075|ref|ZP_04511245.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis
           Pestoides A]
 gi|229899339|ref|ZP_04514482.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229901317|ref|ZP_04516439.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis
           Nepal516]
 gi|270489505|ref|ZP_06206579.1| putative quinol oxidase, subunit 3 [Yersinia pestis KIM D27]
 gi|21957764|gb|AAM84600.1|AE013705_3 cytochrome o ubiquinol oxidase subunit III [Yersinia pestis KIM 10]
 gi|45435471|gb|AAS61030.1| cytochrome O ubiquinol oxidase subunit III [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51588582|emb|CAH20190.1| cytochrome o ubiquinol oxidase subunit III [Yersinia
           pseudotuberculosis IP 32953]
 gi|108774738|gb|ABG17257.1| cytochrome O ubiquinol oxidase subunit III [Yersinia pestis
           Nepal516]
 gi|108780564|gb|ABG14622.1| cytochrome O ubiquinol oxidase subunit III [Yersinia pestis
           Antiqua]
 gi|115348807|emb|CAL21761.1| cytochrome O ubiquinol oxidase subunit III [Yersinia pestis CO92]
 gi|145211756|gb|ABP41163.1| cytochrome O ubiquinol oxidase subunit III [Yersinia pestis
           Pestoides F]
 gi|149291401|gb|EDM41475.1| cytochrome O ubiquinol oxidase subunit III [Yersinia pestis
           CA88-4125]
 gi|152961646|gb|ABS49107.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia
           pseudotuberculosis IP 31758]
 gi|162351120|gb|ABX85068.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis
           Angola]
 gi|165916128|gb|EDR34735.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165921475|gb|EDR38672.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165989997|gb|EDR42298.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166205902|gb|EDR50382.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166960416|gb|EDR56437.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167051334|gb|EDR62742.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167057262|gb|EDR67008.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169751994|gb|ACA69512.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia
           pseudotuberculosis YPIII]
 gi|186697343|gb|ACC87972.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia
           pseudotuberculosis PB1/+]
 gi|229681246|gb|EEO77340.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis
           Nepal516]
 gi|229687741|gb|EEO79814.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229695137|gb|EEO85184.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229700998|gb|EEO89027.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis
           Pestoides A]
 gi|270338009|gb|EFA48786.1| putative quinol oxidase, subunit 3 [Yersinia pestis KIM D27]
 gi|320016353|gb|ADV99924.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 204

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 126/178 (70%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSDC++FA  F TYAVL    A GP+  ++FD++ + V T +LL SS++   AM
Sbjct: 28  GFWVYLMSDCILFATLFATYAVLVNGTAGGPSGKELFDLNFVLVETFLLLFSSITYGVAM 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           L   +K  + +  +WL  T  FG+ FI ME+YEF  LI     P RS FLS++FALVG H
Sbjct: 88  LG-MSKGSVKQVNTWLGFTFLFGLGFIAMELYEFHKLIEEGYGPARSGFLSAYFALVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GL W+ +++IQ+ ++GL S N+ RL+CLS+FWHFLD++WICVF+ VYL+G +
Sbjct: 147 GLHVTAGLAWIIIMMIQVARRGLNSTNRTRLMCLSLFWHFLDVVWICVFTVVYLLGAI 204


>gi|186472797|ref|YP_001860139.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia phymatum
           STM815]
 gi|184195129|gb|ACC73093.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia phymatum
           STM815]
          Length = 201

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 130/188 (69%), Gaps = 4/188 (2%)

Query: 26  DH--DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLL 83
           DH    +  GFW+YLM+DC++FA  F T+AV+   +A GP+  D+F+I G+ + T +LL 
Sbjct: 15  DHAPSNSVFGFWLYLMTDCILFAALFATFAVMSHQFAGGPSGKDLFEIEGVAIETAILLF 74

Query: 84  SSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLS 143
           SS++  FAML  A K     T+ WL VT   G  F+++EI EF+HLI+  A P RSAFLS
Sbjct: 75  SSITYGFAMLG-AHKNNKSSTLFWLAVTFVLGASFVVLEIREFSHLIAEGAGPDRSAFLS 133

Query: 144 SFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ-RRLICLSMFWHFLDLIWICVFS 202
           +FF LVG HGLHV  GL+W+ V++IQ+++   +   + RRL CLS+FWHFLD++WI VFS
Sbjct: 134 AFFTLVGTHGLHVTSGLVWMIVMMIQVVRAPALGERELRRLTCLSLFWHFLDIVWIGVFS 193

Query: 203 FVYLMGVV 210
           FVYL  V+
Sbjct: 194 FVYLASVI 201


>gi|187477293|ref|YP_785317.1| cytochrome O ubiquinol oxidase subunit III [Bordetella avium 197N]
 gi|115421879|emb|CAJ48398.1| cytochrome O ubiquinol oxidase subunit III [Bordetella avium 197N]
          Length = 204

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 129/181 (71%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLMSD L+F+V F T+AVL    A GP   D+FD++ + V T++LL+SS +  
Sbjct: 25  TVFGFWVYLMSDLLIFSVLFATFAVLSGATAGGPTGRDLFDLNFVLVETMLLLISSFTFG 84

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
            AML     +  +K ++WL++T   G  FI ME+YEF HLI   A P RSA+LSSFF LV
Sbjct: 85  VAMLNMYAGK-TNKVIAWLVITFILGAGFIAMELYEFQHLIHQGAGPDRSAYLSSFFFLV 143

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GL+W+ +++I + + GL + N+RRL CLS+FWHFLD++WICVF+FVYLMG 
Sbjct: 144 GTHGLHVTAGLLWIIIMIIMVCRHGLDATNKRRLACLSLFWHFLDIVWICVFTFVYLMGA 203

Query: 210 V 210
           +
Sbjct: 204 I 204


>gi|167566668|ref|ZP_02359584.1| ubiquinol oxidase, subunit III [Burkholderia oklahomensis EO147]
          Length = 202

 Score =  188 bits (478), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 130/194 (67%), Gaps = 4/194 (2%)

Query: 20  KKESCVDHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
             ++  DH  ++   GFW+YLM+DC++FA  F  +AV+   +A GP  +D+FDI G+ + 
Sbjct: 10  HHQAAHDHPPSHSVFGFWLYLMTDCVIFAALFAVFAVMAHQFAGGPTAVDLFDIPGVAIE 69

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T +LL+SS++  FAM+ +   R     + WL VT   G  F+ +E+ EF+H+I+  A PQ
Sbjct: 70  TALLLVSSITYGFAMIGAQRGRR-SALLGWLAVTFVLGAAFLGLELREFSHMIAEGAGPQ 128

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKK-GLISGNQRRLICLSMFWHFLDLI 196
           RSAFLSSFF LVG HGLHV  GL+W+ VL  Q  ++  L   + RRL CLS+FWHFLD++
Sbjct: 129 RSAFLSSFFTLVGTHGLHVAIGLLWMAVLAFQATRRPALTERDIRRLSCLSLFWHFLDIV 188

Query: 197 WICVFSFVYLMGVV 210
           WICVF+FVYL  V+
Sbjct: 189 WICVFTFVYLASVI 202


>gi|315646200|ref|ZP_07899320.1| quinol oxidase polypeptide III [Paenibacillus vortex V453]
 gi|315278399|gb|EFU41715.1| quinol oxidase polypeptide III [Paenibacillus vortex V453]
          Length = 208

 Score =  188 bits (478), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 93/177 (52%), Positives = 120/177 (67%), Gaps = 1/177 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLM+D ++F   F TY VL +N   GP P D+F + GI  ST +LL SS +C  A+
Sbjct: 32  GFWIYLMTDVIIFGTLFATYIVLQQNTDGGPGPADLFQMGGIITSTFILLASSYTCGLAL 91

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           L S  K  +   +SWL VTA  G IFI MEI EF HL+   A    SAFLS+FF LVG H
Sbjct: 92  L-SMHKHNVKGLISWLAVTAGLGAIFIGMEIAEFNHLVHEGATIGTSAFLSAFFTLVGTH 150

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           GLHV FGL+W+  L+IQ+ K+G+    +R++  +S+FWHFLD++WI VF+ VYLMGV
Sbjct: 151 GLHVLFGLVWMIALIIQLAKRGITPVTKRKVNVISLFWHFLDVVWIFVFTVVYLMGV 207


>gi|34499449|ref|NP_903664.1| cytochrome o ubiquinol oxidase subunit III [Chromobacterium
           violaceum ATCC 12472]
 gi|34105301|gb|AAQ61656.1| cytochrome o ubiquinol oxidase, subunit III [Chromobacterium
           violaceum ATCC 12472]
          Length = 203

 Score =  188 bits (478), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 123/181 (67%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T LGFW YLM+DC++FA  F TYAVL +N A G +  D+FD+  + V T  LLLSS++  
Sbjct: 24  TVLGFWFYLMTDCILFATAFATYAVLFRNVAEGVSGKDIFDLQYVLVETAALLLSSITYG 83

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAM+A   K      + WL VT  FG  FI MEI EF HLIS    PQ+SAFLS+FF LV
Sbjct: 84  FAMIA-GHKGNKSAVLGWLAVTFLFGAAFIGMEINEFHHLISEGHGPQKSAFLSAFFGLV 142

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           GLHGLHV  GL+W+ V++ ++ K GL      RL CLS+FWHFLD++WICVF+ VYL G 
Sbjct: 143 GLHGLHVTAGLLWMGVMMAEVAKTGLTGRAMTRLNCLSLFWHFLDIVWICVFTVVYLKGA 202

Query: 210 V 210
           +
Sbjct: 203 M 203


>gi|37527737|ref|NP_931082.1| cytochrome o ubiquinol oxidase subunit III [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|36787173|emb|CAE16249.1| cytochrome O ubiquinol oxidase subunit III (ubiquinol oxidase chain
           C) [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 204

 Score =  188 bits (478), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 93/176 (52%), Positives = 124/176 (70%), Gaps = 1/176 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++FA  F TYAVL    A GP+  ++F +S + V T +LL SS++  FAM
Sbjct: 28  GFWIYLMSDCILFACLFATYAVLVNGTAGGPSGKEIFGLSFVLVETFLLLFSSITYGFAM 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           L    K  I +  +WL +T  FG+ F+ ME+YEF HLI     P RSAFLS FFALV  H
Sbjct: 88  LG-MNKGKIGQVNAWLGMTFLFGLGFVAMELYEFHHLIVDGHGPDRSAFLSGFFALVATH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           G+HV  GL+W+ +++IQ+ ++GL   N+ RL CLS+FWHFLD++WICVF+ VYL+G
Sbjct: 147 GIHVTCGLVWIIIMIIQVTRRGLTDVNKTRLNCLSLFWHFLDVVWICVFTVVYLLG 202


>gi|167743746|ref|ZP_02416520.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 14]
          Length = 202

 Score =  188 bits (477), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 93/194 (47%), Positives = 129/194 (66%), Gaps = 4/194 (2%)

Query: 20  KKESCVDHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            + +  DH  ++   GFW+YLM+DC++FA  F  +AV+   +A GP  +D+FDI G+ + 
Sbjct: 10  PRHAAHDHPPSHSVFGFWLYLMTDCVIFAALFAVFAVMAHQFAGGPTAVDLFDIPGVALE 69

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T +LL+SS++  FAM+ +   R       WL VT   G  F+ +E+ EF+ +I+  A PQ
Sbjct: 70  TALLLVSSITYGFAMIGAQRGRR-GALFGWLAVTFVLGAAFLSLELREFSQMIAEGAGPQ 128

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKK-GLISGNQRRLICLSMFWHFLDLI 196
           RSAFLSSFF LVG HGLHV  GL+W+ VL  Q L++  L   + RRL CLS+FWHFLD++
Sbjct: 129 RSAFLSSFFTLVGTHGLHVAIGLLWMAVLACQALRRPALTERDIRRLTCLSLFWHFLDIV 188

Query: 197 WICVFSFVYLMGVV 210
           WICVFSFVYL  V+
Sbjct: 189 WICVFSFVYLASVI 202


>gi|290474674|ref|YP_003467554.1| cytochrome o ubiquinol oxidase subunit III [Xenorhabdus bovienii
           SS-2004]
 gi|289173987|emb|CBJ80774.1| cytochrome o ubiquinol oxidase, subunit III [Xenorhabdus bovienii
           SS-2004]
          Length = 203

 Score =  188 bits (477), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 124/178 (69%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSD ++FA  F TYAVL    A GP+  D+F++  + V T +LL SS++  FAM
Sbjct: 27  GFWIYLMSDLVLFASLFATYAVLANGTAGGPSGKDIFELPFVLVETFLLLFSSITYGFAM 86

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           L S  K    +   WL +T  FG+ F+ MEIYEF  LIS    P RSAFLSSFFALV  H
Sbjct: 87  L-SMNKGKTGQVNLWLFITFLFGLGFVSMEIYEFHKLISEGFGPDRSAFLSSFFALVATH 145

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           G+HV  GLIW+ ++++Q+ ++GL   N+ RL CLS+FWHFLD++WICVF+ VYLMG +
Sbjct: 146 GIHVTCGLIWIIIMMVQVARRGLTEVNRTRLSCLSLFWHFLDVVWICVFTVVYLMGAM 203


>gi|23500959|ref|NP_697086.1| ubiquinol oxidase subunit III [Brucella suis 1330]
 gi|161618034|ref|YP_001591921.1| cytochrome o ubiquinol oxidase, subunit III [Brucella canis ATCC
           23365]
 gi|163842320|ref|YP_001626724.1| cytochrome o ubiquinol oxidase, subunit III [Brucella suis ATCC
           23445]
 gi|225851587|ref|YP_002731820.1| cytochrome o ubiquinol oxidase subunit III [Brucella melitensis
           ATCC 23457]
 gi|254690356|ref|ZP_05153610.1| cytochrome o ubiquinol oxidase, subunit III [Brucella abortus bv. 6
           str. 870]
 gi|254694845|ref|ZP_05156673.1| cytochrome o ubiquinol oxidase, subunit III [Brucella abortus bv. 3
           str. Tulya]
 gi|254700859|ref|ZP_05162687.1| cytochrome o ubiquinol oxidase, subunit III [Brucella suis bv. 5
           str. 513]
 gi|254705225|ref|ZP_05167053.1| cytochrome o ubiquinol oxidase, subunit III [Brucella suis bv. 3
           str. 686]
 gi|254707256|ref|ZP_05169084.1| cytochrome o ubiquinol oxidase, subunit III [Brucella pinnipedialis
           M163/99/10]
 gi|254709203|ref|ZP_05171014.1| cytochrome o ubiquinol oxidase, subunit III [Brucella pinnipedialis
           B2/94]
 gi|254713372|ref|ZP_05175183.1| cytochrome o ubiquinol oxidase, subunit III [Brucella ceti
           M644/93/1]
 gi|254716270|ref|ZP_05178081.1| cytochrome o ubiquinol oxidase, subunit III [Brucella ceti
           M13/05/1]
 gi|254718264|ref|ZP_05180075.1| cytochrome o ubiquinol oxidase, subunit III [Brucella sp. 83/13]
 gi|256030727|ref|ZP_05444341.1| cytochrome o ubiquinol oxidase, subunit III [Brucella pinnipedialis
           M292/94/1]
 gi|256060187|ref|ZP_05450367.1| cytochrome o ubiquinol oxidase, subunit III [Brucella neotomae
           5K33]
 gi|256112551|ref|ZP_05453472.1| cytochrome o ubiquinol oxidase, subunit III [Brucella melitensis
           bv. 3 str. Ether]
 gi|256158734|ref|ZP_05456609.1| cytochrome o ubiquinol oxidase, subunit III [Brucella ceti
           M490/95/1]
 gi|256254131|ref|ZP_05459667.1| cytochrome o ubiquinol oxidase, subunit III [Brucella ceti B1/94]
 gi|256258610|ref|ZP_05464146.1| cytochrome o ubiquinol oxidase, subunit III [Brucella abortus bv. 9
           str. C68]
 gi|256264902|ref|ZP_05467434.1| cytochrome c oxidase [Brucella melitensis bv. 2 str. 63/9]
 gi|256368510|ref|YP_003106016.1| cytochrome o ubiquinol oxidase subunit III [Brucella microti CCM
           4915]
 gi|260169630|ref|ZP_05756441.1| cytochrome o ubiquinol oxidase subunit III [Brucella sp. F5/99]
 gi|260567308|ref|ZP_05837778.1| cytochrome c oxidase [Brucella suis bv. 4 str. 40]
 gi|260755900|ref|ZP_05868248.1| cytochrome o ubiquinol oxidase subunit III [Brucella abortus bv. 6
           str. 870]
 gi|260884924|ref|ZP_05896538.1| cytochrome o ubiquinol oxidase subunit III [Brucella abortus bv. 9
           str. C68]
 gi|261215175|ref|ZP_05929456.1| cytochrome o ubiquinol oxidase subunit III [Brucella abortus bv. 3
           str. Tulya]
 gi|261218047|ref|ZP_05932328.1| cytochrome o ubiquinol oxidase subunit III [Brucella ceti M13/05/1]
 gi|261221274|ref|ZP_05935555.1| cytochrome o ubiquinol oxidase subunit III [Brucella ceti B1/94]
 gi|261314738|ref|ZP_05953935.1| cytochrome o ubiquinol oxidase subunit III [Brucella pinnipedialis
           M163/99/10]
 gi|261316704|ref|ZP_05955901.1| cytochrome o ubiquinol oxidase subunit III [Brucella pinnipedialis
           B2/94]
 gi|261321103|ref|ZP_05960300.1| cytochrome o ubiquinol oxidase subunit III [Brucella ceti
           M644/93/1]
 gi|261324164|ref|ZP_05963361.1| cytochrome o ubiquinol oxidase subunit III [Brucella neotomae 5K33]
 gi|261751369|ref|ZP_05995078.1| cytochrome o ubiquinol oxidase subunit III [Brucella suis bv. 5
           str. 513]
 gi|261755934|ref|ZP_05999643.1| cytochrome o ubiquinol oxidase subunit III [Brucella suis bv. 3
           str. 686]
 gi|261759160|ref|ZP_06002869.1| cytochrome o ubiquinol oxidase subunit III [Brucella sp. F5/99]
 gi|265983225|ref|ZP_06095960.1| cytochrome o ubiquinol oxidase subunit III [Brucella sp. 83/13]
 gi|265987774|ref|ZP_06100331.1| cytochrome o ubiquinol oxidase subunit III [Brucella pinnipedialis
           M292/94/1]
 gi|265993991|ref|ZP_06106548.1| cytochrome o ubiquinol oxidase subunit III [Brucella melitensis bv.
           3 str. Ether]
 gi|265997235|ref|ZP_06109792.1| cytochrome o ubiquinol oxidase subunit III [Brucella ceti
           M490/95/1]
 gi|294851453|ref|ZP_06792126.1| cytochrome o ubiquinol oxidase [Brucella sp. NVSL 07-0026]
 gi|297247449|ref|ZP_06931167.1| cytochrome o ubiquinol oxidase, subunit III [Brucella abortus bv. 5
           str. B3196]
 gi|306840007|ref|ZP_07472801.1| cytochrome o ubiquinol oxidase, subunit III [Brucella sp. NF 2653]
 gi|306843644|ref|ZP_07476245.1| cytochrome o ubiquinol oxidase, subunit III [Brucella sp. BO1]
 gi|23346816|gb|AAN29001.1| ubiquinol oxidase subunit III [Brucella suis 1330]
 gi|161334845|gb|ABX61150.1| cytochrome o ubiquinol oxidase, subunit III [Brucella canis ATCC
           23365]
 gi|163673043|gb|ABY37154.1| cytochrome o ubiquinol oxidase, subunit III [Brucella suis ATCC
           23445]
 gi|225639952|gb|ACN99865.1| cytochrome o ubiquinol oxidase, subunit III [Brucella melitensis
           ATCC 23457]
 gi|255998668|gb|ACU47067.1| cytochrome o ubiquinol oxidase subunit III [Brucella microti CCM
           4915]
 gi|260156826|gb|EEW91906.1| cytochrome c oxidase [Brucella suis bv. 4 str. 40]
 gi|260676008|gb|EEX62829.1| cytochrome o ubiquinol oxidase subunit III [Brucella abortus bv. 6
           str. 870]
 gi|260874452|gb|EEX81521.1| cytochrome o ubiquinol oxidase subunit III [Brucella abortus bv. 9
           str. C68]
 gi|260916782|gb|EEX83643.1| cytochrome o ubiquinol oxidase subunit III [Brucella abortus bv. 3
           str. Tulya]
 gi|260919858|gb|EEX86511.1| cytochrome o ubiquinol oxidase subunit III [Brucella ceti B1/94]
 gi|260923136|gb|EEX89704.1| cytochrome o ubiquinol oxidase subunit III [Brucella ceti M13/05/1]
 gi|261293793|gb|EEX97289.1| cytochrome o ubiquinol oxidase subunit III [Brucella ceti
           M644/93/1]
 gi|261295927|gb|EEX99423.1| cytochrome o ubiquinol oxidase subunit III [Brucella pinnipedialis
           B2/94]
 gi|261300144|gb|EEY03641.1| cytochrome o ubiquinol oxidase subunit III [Brucella neotomae 5K33]
 gi|261303764|gb|EEY07261.1| cytochrome o ubiquinol oxidase subunit III [Brucella pinnipedialis
           M163/99/10]
 gi|261739144|gb|EEY27140.1| cytochrome o ubiquinol oxidase subunit III [Brucella sp. F5/99]
 gi|261741122|gb|EEY29048.1| cytochrome o ubiquinol oxidase subunit III [Brucella suis bv. 5
           str. 513]
 gi|261745687|gb|EEY33613.1| cytochrome o ubiquinol oxidase subunit III [Brucella suis bv. 3
           str. 686]
 gi|262551703|gb|EEZ07693.1| cytochrome o ubiquinol oxidase subunit III [Brucella ceti
           M490/95/1]
 gi|262764972|gb|EEZ10893.1| cytochrome o ubiquinol oxidase subunit III [Brucella melitensis bv.
           3 str. Ether]
 gi|263095387|gb|EEZ18988.1| cytochrome c oxidase [Brucella melitensis bv. 2 str. 63/9]
 gi|264659971|gb|EEZ30232.1| cytochrome o ubiquinol oxidase subunit III [Brucella pinnipedialis
           M292/94/1]
 gi|264661817|gb|EEZ32078.1| cytochrome o ubiquinol oxidase subunit III [Brucella sp. 83/13]
 gi|294820042|gb|EFG37041.1| cytochrome o ubiquinol oxidase [Brucella sp. NVSL 07-0026]
 gi|297174618|gb|EFH33965.1| cytochrome o ubiquinol oxidase, subunit III [Brucella abortus bv. 5
           str. B3196]
 gi|306276335|gb|EFM58035.1| cytochrome o ubiquinol oxidase, subunit III [Brucella sp. BO1]
 gi|306404971|gb|EFM61256.1| cytochrome o ubiquinol oxidase, subunit III [Brucella sp. NF 2653]
 gi|326408056|gb|ADZ65121.1| cytochrome o ubiquinol oxidase subunit III [Brucella melitensis
           M28]
 gi|326537772|gb|ADZ85987.1| cytochrome o ubiquinol oxidase, subunit III [Brucella melitensis
           M5-90]
          Length = 209

 Score =  188 bits (477), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 127/196 (64%), Gaps = 4/196 (2%)

Query: 18  KDKKESCVDHDG---TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
            D       HD    T +GFWIYLMSDC++F+  F TYAVL   +A GP   ++FD+  +
Sbjct: 15  NDHPAHEDHHDAGSTTLVGFWIYLMSDCILFSGLFATYAVLAHQFAGGPTGRELFDLQFV 74

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            V T++LL+SSL+   A L S  K      + WL VT   G  F+ MEIYEF HLI   A
Sbjct: 75  LVETMLLLVSSLTYGLATL-SMYKNNRSGVLGWLGVTFLLGAAFLAMEIYEFHHLIVEGA 133

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            P RS+FLS+FF LVG HGLH+  GLIW+ VL   +L+ GL   N+ R++CLS+FWHFLD
Sbjct: 134 GPDRSSFLSAFFTLVGTHGLHITSGLIWILVLSAMLLRDGLTERNRTRVMCLSLFWHFLD 193

Query: 195 LIWICVFSFVYLMGVV 210
           +IWI VF+ VYL+GV+
Sbjct: 194 IIWIGVFTLVYLLGVL 209


>gi|33595746|ref|NP_883389.1| cytochrome O ubiquinol oxidase [Bordetella parapertussis 12822]
 gi|33565825|emb|CAE36370.1| cytochrome O ubiquinol oxidase [Bordetella parapertussis]
          Length = 203

 Score =  188 bits (477), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 130/183 (71%), Gaps = 5/183 (2%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T LGFWIYLMSD L+F+V F T+AVL    A GP   D+FD+S +   T++LL+SS +  
Sbjct: 24  TVLGFWIYLMSDLLIFSVLFATFAVLSSATAGGPTGKDLFDLSFVLGETMLLLVSSFTFG 83

Query: 90  FAMLA--SATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
            AML   + +K    K ++WL VT  FG  FI+ME+YEF HL+S+ A PQ SA+LS+FF 
Sbjct: 84  MAMLNLHAGSKG---KVIAWLWVTFLFGAGFIVMEVYEFHHLLSIGAGPQTSAYLSAFFT 140

Query: 148 LVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           L+G HGLHV FGLIW+ V++  + + G+     RRL CLS+FWHFLD++WICVF+FVYL+
Sbjct: 141 LIGTHGLHVTFGLIWILVMIHMLSRYGIDPITTRRLSCLSLFWHFLDIVWICVFTFVYLL 200

Query: 208 GVV 210
           G +
Sbjct: 201 GAL 203


>gi|33593869|ref|NP_881513.1| cytochrome O ubiquinol oxidase [Bordetella pertussis Tohama I]
 gi|33600271|ref|NP_887831.1| cytochrome O ubiquinol oxidase [Bordetella bronchiseptica RB50]
 gi|33563942|emb|CAE43203.1| cytochrome O ubiquinol oxidase [Bordetella pertussis Tohama I]
 gi|33567869|emb|CAE31783.1| cytochrome O ubiquinol oxidase [Bordetella bronchiseptica RB50]
 gi|332383288|gb|AEE68135.1| cytochrome O ubiquinol oxidase [Bordetella pertussis CS]
          Length = 203

 Score =  188 bits (477), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 130/183 (71%), Gaps = 5/183 (2%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T LGFWIYLMSD L+F+V F T+AVL    A GP   D+FD+S +   T++LL+SS +  
Sbjct: 24  TVLGFWIYLMSDLLIFSVLFATFAVLSSATAGGPTGKDLFDLSFVLGETMLLLVSSFTFG 83

Query: 90  FAMLA--SATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
            AML   + +K    K ++WL VT  FG  FI+ME+YEF HL+S+ A PQ SA+LS+FF 
Sbjct: 84  MAMLNLHAGSKG---KVIAWLWVTFLFGAGFIVMEVYEFHHLLSIGAGPQTSAYLSAFFT 140

Query: 148 LVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           L+G HGLHV FGLIW+ V++  + + G+     RRL CLS+FWHFLD++WICVF+FVYL+
Sbjct: 141 LIGTHGLHVTFGLIWILVMIHMLSRYGIDPITTRRLSCLSLFWHFLDIVWICVFTFVYLL 200

Query: 208 GVV 210
           G +
Sbjct: 201 GAL 203


>gi|306842663|ref|ZP_07475308.1| cytochrome o ubiquinol oxidase, subunit III [Brucella sp. BO2]
 gi|306287198|gb|EFM58695.1| cytochrome o ubiquinol oxidase, subunit III [Brucella sp. BO2]
          Length = 209

 Score =  188 bits (477), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 127/196 (64%), Gaps = 4/196 (2%)

Query: 18  KDKKESCVDHDG---TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
            D       HD    T +GFWIYLMSDC++F+  F TYAVL   +A GP   ++FD+  +
Sbjct: 15  NDHPAHEDHHDAGSTTLVGFWIYLMSDCILFSGLFATYAVLAHQFAGGPTGRELFDLQFV 74

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            V T++LL+SSL+   A L S  K      + WL VT   G  F+ MEIYEF HLI   A
Sbjct: 75  LVETMLLLVSSLTYGLATL-SMYKNNRSGVLGWLGVTFLLGAAFLAMEIYEFHHLIVEGA 133

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            P RS+FLS+FF LVG HGLH+  GLIW+ VL   +L+ GL   N+ R++CLS+FWHFLD
Sbjct: 134 GPDRSSFLSAFFTLVGTHGLHITSGLIWILVLSAMLLRDGLTERNRTRVMCLSLFWHFLD 193

Query: 195 LIWICVFSFVYLMGVV 210
           +IWI VF+ VYL+GV+
Sbjct: 194 IIWIGVFTLVYLLGVL 209


>gi|62289031|ref|YP_220824.1| ubiquinol oxidase subunit III [Brucella abortus bv. 1 str. 9-941]
 gi|82698968|ref|YP_413542.1| cytochrome c oxidase subunit III [Brucella melitensis biovar
           Abortus 2308]
 gi|189023306|ref|YP_001934074.1| Cytochrome c oxidase, subunit III [Brucella abortus S19]
 gi|237814518|ref|ZP_04593516.1| cytochrome o ubiquinol oxidase, subunit III [Brucella abortus str.
           2308 A]
 gi|254696474|ref|ZP_05158302.1| Cytochrome c oxidase, subunit III [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254731386|ref|ZP_05189964.1| Cytochrome c oxidase, subunit III [Brucella abortus bv. 4 str. 292]
 gi|260546325|ref|ZP_05822065.1| cytochrome c oxidase [Brucella abortus NCTC 8038]
 gi|260759124|ref|ZP_05871472.1| cytochrome o ubiquinol oxidase subunit III [Brucella abortus bv. 4
           str. 292]
 gi|260760849|ref|ZP_05873192.1| cytochrome o ubiquinol oxidase subunit III [Brucella abortus bv. 2
           str. 86/8/59]
 gi|62195163|gb|AAX73463.1| ubiquinol oxidase subunit III [Brucella abortus bv. 1 str. 9-941]
 gi|82615069|emb|CAJ09997.1| Cytochrome c oxidase, subunit III [Brucella melitensis biovar
           Abortus 2308]
 gi|189018878|gb|ACD71600.1| Cytochrome c oxidase, subunit III [Brucella abortus S19]
 gi|237789355|gb|EEP63565.1| cytochrome o ubiquinol oxidase, subunit III [Brucella abortus str.
           2308 A]
 gi|260096432|gb|EEW80308.1| cytochrome c oxidase [Brucella abortus NCTC 8038]
 gi|260669442|gb|EEX56382.1| cytochrome o ubiquinol oxidase subunit III [Brucella abortus bv. 4
           str. 292]
 gi|260671281|gb|EEX58102.1| cytochrome o ubiquinol oxidase subunit III [Brucella abortus bv. 2
           str. 86/8/59]
          Length = 209

 Score =  188 bits (477), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 127/196 (64%), Gaps = 4/196 (2%)

Query: 18  KDKKESCVDHDG---TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
            D       HD    T +GFWIYLMSDC++F+  F TYAVL   +A GP   ++FD+  +
Sbjct: 15  NDHPAHEDHHDAGSTTLVGFWIYLMSDCILFSGLFATYAVLAHQFAGGPTGRELFDLQFV 74

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            V T++LL+SSL+   A L S  K      + WL VT   G  F+ MEIYEF HLI   A
Sbjct: 75  LVETMLLLVSSLTYGLATL-SMYKNNRSGVLGWLGVTFLLGAAFLAMEIYEFHHLIVEGA 133

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            P RS+FLS+FF LVG HGLH+  GLIW+ VL   +L+ GL   N+ R++CLS+FWHFLD
Sbjct: 134 GPDRSSFLSAFFTLVGTHGLHITSGLIWILVLSAMLLRDGLTERNRTRVMCLSLFWHFLD 193

Query: 195 LIWICVFSFVYLMGVV 210
           +IWI VF+ VYL+GV+
Sbjct: 194 IIWIGVFTLVYLLGVL 209


>gi|312961437|ref|ZP_07775940.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas
           fluorescens WH6]
 gi|311284332|gb|EFQ62910.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas
           fluorescens WH6]
          Length = 204

 Score =  187 bits (476), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 92/178 (51%), Positives = 124/178 (69%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLM+DC++FA  F  YAVL  + A GP+ +D+F++  +   T++LLLSS++  +AM
Sbjct: 28  GFWIYLMTDCILFATLFAGYAVLRDSVAGGPSSVDIFELPYVLGETMLLLLSSITYGYAM 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           LA    +  H  + WL +T   G  FI MEI EF HLI     P RSAFL++FF LVG H
Sbjct: 88  LAMNRGQQGH-VLRWLGLTFVLGAGFIAMEINEFHHLIEAGHGPDRSAFLTAFFTLVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           G HV  GL+W+ VL+ Q+ ++GL + N  RL CLS+FWHFLD++WICVF+ VYL+GVV
Sbjct: 147 GAHVLTGLVWMAVLMAQVHQRGLTTTNATRLSCLSLFWHFLDVVWICVFTVVYLLGVV 204


>gi|254193615|ref|ZP_04900047.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei S13]
 gi|169650366|gb|EDS83059.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei S13]
          Length = 197

 Score =  187 bits (476), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 93/194 (47%), Positives = 129/194 (66%), Gaps = 4/194 (2%)

Query: 20  KKESCVDHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            + +  DH  ++   GFW+YLM+DC++FA  F  +AV+   +A GP  +D+FDI G+ + 
Sbjct: 5   PRHAAHDHPPSHSVFGFWLYLMTDCVIFAALFAVFAVMAHQFAGGPTAVDLFDIPGVALE 64

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T +LL+SS++  FAM+ +   R       WL VT   G  F+ +E+ EF+ +I+  A PQ
Sbjct: 65  TALLLVSSITYGFAMIGAQRGRR-GALFGWLAVTFVLGAAFLSLELREFSQMIAEGAGPQ 123

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKK-GLISGNQRRLICLSMFWHFLDLI 196
           RSAFLSSFF LVG HGLHV  GL+W+ VL  Q L++  L   + RRL CLS+FWHFLD++
Sbjct: 124 RSAFLSSFFTLVGTHGLHVAIGLLWMAVLACQALRRPALTERDIRRLTCLSLFWHFLDIV 183

Query: 197 WICVFSFVYLMGVV 210
           WICVFSFVYL  V+
Sbjct: 184 WICVFSFVYLASVI 197


>gi|262396850|ref|YP_003288703.1| cytochrome O ubiquinol oxidase subunit III [Vibrio sp. Ex25]
 gi|262340444|gb|ACY54238.1| cytochrome O ubiquinol oxidase subunit III [Vibrio sp. Ex25]
          Length = 200

 Score =  187 bits (476), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 96/178 (53%), Positives = 122/178 (68%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSDC++FA  F TYAVL  N  AGP   D+F++  +FV T++LL SS++  F +
Sbjct: 24  GFWVYLMSDCVLFATLFATYAVLSSNSIAGPTGKDIFELPFVFVETMLLLFSSITFGFGI 83

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   +  +     W+LVT  FG+ FI ME+YEF HLI     PQ SAFLS+FF LVG H
Sbjct: 84  IA-MKRNNVAGLKRWMLVTFAFGLGFICMEVYEFHHLIEEGYGPQTSAFLSAFFTLVGTH 142

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV FGLIWL V   Q+  KGL      R  CLS+FWHFLD++WICVF+ VYL+GV+
Sbjct: 143 GLHVTFGLIWLAVAYHQLSTKGLNDNMAMRFNCLSLFWHFLDIVWICVFTIVYLLGVM 200


>gi|89072119|ref|ZP_01158715.1| cytochrome o ubiquinol oxidase, subunit III [Photobacterium sp.
           SKA34]
 gi|89052220|gb|EAR57671.1| cytochrome o ubiquinol oxidase, subunit III [Photobacterium sp.
           SKA34]
          Length = 198

 Score =  187 bits (476), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 100/189 (52%), Positives = 124/189 (65%), Gaps = 4/189 (2%)

Query: 25  VDHDGTYL---GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVL 81
             HD T +   GFWIYLMSDC++FA  F TYAVL  +  AGP   D+F++  +FV T++L
Sbjct: 11  THHDTTGIKLFGFWIYLMSDCVLFATLFATYAVLESSSIAGPTGQDIFELPFVFVETMLL 70

Query: 82  LLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAF 141
           L SS++  F M+ S  +  I     WL VT   G+ FI ME+YEF HLI     PQ SAF
Sbjct: 71  LFSSITFGFGMI-SMKRNKITVFKRWLQVTFLLGLSFICMELYEFHHLIENGNGPQGSAF 129

Query: 142 LSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVF 201
           LS+FF LVG HGLHV FGLIW+ V   Q+  KGL      R  CLS+FWHFLD++WICVF
Sbjct: 130 LSAFFTLVGTHGLHVTFGLIWMVVCYQQLSSKGLTENMSMRFQCLSLFWHFLDIVWICVF 189

Query: 202 SFVYLMGVV 210
           + VYLMGV+
Sbjct: 190 TIVYLMGVM 198


>gi|227113458|ref|ZP_03827114.1| cytochrome o ubiquinol oxidase subunit III [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 204

 Score =  187 bits (476), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 94/178 (52%), Positives = 125/178 (70%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSD ++F   F TYAVL    A GP+  ++F +  + V T  LL SS++   AM
Sbjct: 28  GFWVYLMSDLIIFGSLFATYAVLVNGTAGGPSGKELFQLPFVLVETFALLFSSITYGMAM 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K    +  +WL VT  FG++FI MEIYEF HLI     P RSAFLS+FFALVG H
Sbjct: 88  IA-MNKGNKSQVNTWLGVTFLFGLVFIGMEIYEFHHLIVEGYGPDRSAFLSAFFALVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           G+HV  GLIWL +++IQ+ K+GL + N+ RL+CLS+FWHFLD++WICVF+ VYL+G +
Sbjct: 147 GIHVTGGLIWLVIMMIQVSKRGLTATNKTRLMCLSLFWHFLDVVWICVFTVVYLLGAM 204


>gi|84386635|ref|ZP_00989661.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio splendidus
           12B01]
 gi|84378441|gb|EAP95298.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio splendidus
           12B01]
          Length = 205

 Score =  187 bits (476), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 99/207 (47%), Positives = 127/207 (61%), Gaps = 3/207 (1%)

Query: 4   QKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGP 63
           Q    S  + L +  D       +     GFW+YLMSDC++FA  F TYAVL     AGP
Sbjct: 2   QANTPSHTYDLAHSHDHHHEAAGNK--LFGFWVYLMSDCVLFATLFATYAVLESGSIAGP 59

Query: 64  APIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEI 123
              D+F++  +FV T++LL SS++  F M+A   K +      W+ VT   G+ FI ME+
Sbjct: 60  TGKDIFELPFVFVETMMLLFSSITFGFGMIAMKRKDVT-GLKRWIKVTFALGLAFICMEV 118

Query: 124 YEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRL 183
           YEF HLI+    PQ SAFLS+FF LVG HGLHV FGLIW+ V   Q+  KGL      R 
Sbjct: 119 YEFHHLIAEGYGPQESAFLSAFFTLVGTHGLHVTFGLIWMAVAYHQLSTKGLNDNMSMRF 178

Query: 184 ICLSMFWHFLDLIWICVFSFVYLMGVV 210
            CLS+FWHFLD++WICVF+ VYLMGV+
Sbjct: 179 QCLSLFWHFLDIVWICVFTIVYLMGVM 205


>gi|121598058|ref|YP_990967.1| ubiquinol oxidase, subunit III [Burkholderia mallei SAVP1]
 gi|167000704|ref|ZP_02266513.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia mallei
           PRL-20]
 gi|167724805|ref|ZP_02408041.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei DM98]
 gi|167820936|ref|ZP_02452616.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 91]
 gi|167850764|ref|ZP_02476272.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei B7210]
 gi|167907699|ref|ZP_02494904.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei NCTC
           13177]
 gi|254177194|ref|ZP_04883850.1| ubiquinol oxidase, subunit III [Burkholderia mallei ATCC 10399]
 gi|262192874|ref|YP_001077432.2| ubiquinol oxidase, subunit III [Burkholderia mallei NCTC 10247]
 gi|121225856|gb|ABM49387.1| ubiquinol oxidase, subunit III [Burkholderia mallei SAVP1]
 gi|160698234|gb|EDP88204.1| ubiquinol oxidase, subunit III [Burkholderia mallei ATCC 10399]
 gi|243063389|gb|EES45575.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia mallei
           PRL-20]
 gi|261834995|gb|ABO02431.2| cytochrome o ubiquinol oxidase, subunit III [Burkholderia mallei
           NCTC 10247]
          Length = 202

 Score =  187 bits (476), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 93/194 (47%), Positives = 129/194 (66%), Gaps = 4/194 (2%)

Query: 20  KKESCVDHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            + +  DH  ++   GFW+YLM+DC++FA  F  +AV+   +A GP  +D+FDI G+ + 
Sbjct: 10  PRHAAHDHPPSHSVFGFWLYLMTDCVIFAALFAVFAVMAHQFAGGPTAVDLFDIPGVALE 69

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T +LL+SS++  FAM+ +   R       WL VT   G  F+ +E+ EF+ +I+  A PQ
Sbjct: 70  TALLLVSSITYGFAMIGAQRGRR-GALFGWLAVTFVLGAAFLGLELREFSQMIAEGAGPQ 128

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKK-GLISGNQRRLICLSMFWHFLDLI 196
           RSAFLSSFF LVG HGLHV  GL+W+ VL  Q L++  L   + RRL CLS+FWHFLD++
Sbjct: 129 RSAFLSSFFTLVGTHGLHVAIGLLWMAVLACQALRRPALTERDIRRLTCLSLFWHFLDIV 188

Query: 197 WICVFSFVYLMGVV 210
           WICVFSFVYL  V+
Sbjct: 189 WICVFSFVYLASVI 202


>gi|293607261|ref|ZP_06689602.1| quinol oxidase subunit III [Achromobacter piechaudii ATCC 43553]
 gi|292814353|gb|EFF73493.1| quinol oxidase subunit III [Achromobacter piechaudii ATCC 43553]
          Length = 204

 Score =  187 bits (476), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 94/181 (51%), Positives = 125/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLMSD L+F+V F T+AVL    A GP   ++FD+  + V T++LL SS +  
Sbjct: 25  TVFGFWVYLMSDLLIFSVLFATFAVLSNATAGGPTGKELFDLKFVLVETLLLLFSSFTFG 84

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
            A L         + + WL+VT  FG  FI ME++EF HLI+  A P RSA+LS+FF L+
Sbjct: 85  MANLNVHANNK-SRAMGWLMVTFLFGAGFIAMEVWEFHHLITEGAGPGRSAYLSAFFTLI 143

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV FGLIW+ V++  I + GL S N+RRL CLS+FWHFLD++WICVF+FVYL+G 
Sbjct: 144 GTHGLHVTFGLIWIIVMLDMIRRHGLDSINKRRLACLSLFWHFLDIVWICVFTFVYLLGA 203

Query: 210 V 210
           +
Sbjct: 204 I 204


>gi|261826555|gb|ABM98575.2| cytochrome o ubiquinol oxidase, subunit III [Burkholderia mallei
           NCTC 10229]
          Length = 202

 Score =  187 bits (476), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 93/194 (47%), Positives = 129/194 (66%), Gaps = 4/194 (2%)

Query: 20  KKESCVDHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            + +  DH  ++   GFW+YLM+DC++FA  F  +AV+   +A GP  +D+FDI G+ + 
Sbjct: 10  PRHAAHDHPPSHSVFGFWLYLMTDCVIFAALFAVFAVMAHQFAGGPTAVDLFDIPGVALE 69

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T +LL+SS++  FAM+ +   R       WL VT   G  F+ +E+ EF+ +I+  A PQ
Sbjct: 70  TALLLVSSITYGFAMIGAQRGRR-GALFGWLAVTFVLGAAFLGLELREFSQMIAEGAGPQ 128

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKK-GLISGNQRRLICLSMFWHFLDLI 196
           RSAFLSSFF LVG HGLHV  GL+W+ VL  Q L++  L   + RRL CLS+FWHFLD++
Sbjct: 129 RSAFLSSFFTLVGTHGLHVAIGLLWMAVLACQALRRSALTERDIRRLTCLSLFWHFLDIV 188

Query: 197 WICVFSFVYLMGVV 210
           WICVFSFVYL  V+
Sbjct: 189 WICVFSFVYLASVI 202


>gi|126444259|ref|YP_001063706.1| ubiquinol oxidase subunit III [Burkholderia pseudomallei 668]
 gi|126223750|gb|ABN87255.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia
           pseudomallei 668]
          Length = 197

 Score =  187 bits (476), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 93/194 (47%), Positives = 129/194 (66%), Gaps = 4/194 (2%)

Query: 20  KKESCVDHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            + +  DH  ++   GFW+YLM+DC++FA  F  +AV+   +A GP  +D+FDI G+ + 
Sbjct: 5   PRHAAHDHPPSHSVFGFWLYLMTDCVVFAALFAVFAVMAHQFAGGPTAVDLFDIPGVALE 64

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T +LL+SS++  FAM+ +   R       WL VT   G  F+ +E+ EF+ +I+  A PQ
Sbjct: 65  TALLLVSSITYGFAMIGAQRGRR-GALFGWLAVTFVLGAAFLGLELREFSQMIAEGAGPQ 123

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKK-GLISGNQRRLICLSMFWHFLDLI 196
           RSAFLSSFF LVG HGLHV  GL+W+ VL  Q L++  L   + RRL CLS+FWHFLD++
Sbjct: 124 RSAFLSSFFTLVGTHGLHVVIGLLWMAVLACQALRRPALTERDIRRLTCLSLFWHFLDIV 183

Query: 197 WICVFSFVYLMGVV 210
           WICVFSFVYL  V+
Sbjct: 184 WICVFSFVYLASVI 197


>gi|167829291|ref|ZP_02460762.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 9]
 gi|167916041|ref|ZP_02503132.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 112]
 gi|167923882|ref|ZP_02510973.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei BCC215]
          Length = 202

 Score =  187 bits (476), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 93/194 (47%), Positives = 129/194 (66%), Gaps = 4/194 (2%)

Query: 20  KKESCVDHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            + +  DH  ++   GFW+YLM+DC++FA  F  +AV+   +A GP  +D+FDI G+ + 
Sbjct: 10  PRHAAHDHPPSHSVFGFWLYLMTDCVVFAALFAVFAVMAHQFAGGPTAVDLFDIPGVALE 69

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T +LL+SS++  FAM+ +   R       WL VT   G  F+ +E+ EF+ +I+  A PQ
Sbjct: 70  TALLLVSSITYGFAMIGAQRGRR-GALFGWLAVTFVLGAAFLGLELREFSQMIAEGAGPQ 128

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKK-GLISGNQRRLICLSMFWHFLDLI 196
           RSAFLSSFF LVG HGLHV  GL+W+ VL  Q L++  L   + RRL CLS+FWHFLD++
Sbjct: 129 RSAFLSSFFTLVGTHGLHVAIGLLWMAVLACQALRRPALTERDIRRLTCLSLFWHFLDIV 188

Query: 197 WICVFSFVYLMGVV 210
           WICVFSFVYL  V+
Sbjct: 189 WICVFSFVYLASVI 202


>gi|42795025|gb|AAS45858.1| CyoC [Pseudomonas putida]
          Length = 208

 Score =  187 bits (476), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 97/181 (53%), Positives = 126/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T LGFW+YLM+DC++FA  F TYAVL  ++A GP+  D+F +  + V T+ LLLSS++  
Sbjct: 29  TVLGFWLYLMTDCILFASLFATYAVLSGSFAGGPSGHDIFQLDFVAVETLFLLLSSITFG 88

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAML     +     + WL VT  FG  FI MEIYEF HLIS    PQRS FLS FFALV
Sbjct: 89  FAMLKMFDGKKA-GVLGWLAVTFLFGAGFIAMEIYEFHHLISEGFGPQRSGFLSGFFALV 147

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G +GLHV  GLIW+ +++ QI K G+    + R+ CLS+FWHFLD++WICVF+ VYL+GV
Sbjct: 148 GTYGLHVTAGLIWMAIMMYQINKHGITPTAKTRMSCLSLFWHFLDVVWICVFTVVYLLGV 207

Query: 210 V 210
           +
Sbjct: 208 L 208


>gi|53722916|ref|YP_111901.1| cytochrome O ubiquinol oxidase subunit III [Burkholderia
           pseudomallei K96243]
 gi|126457786|ref|YP_001076600.1| ubiquinol oxidase subunit III [Burkholderia pseudomallei 1106a]
 gi|217422722|ref|ZP_03454225.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia
           pseudomallei 576]
 gi|237508107|ref|ZP_04520822.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia
           pseudomallei MSHR346]
 gi|242311585|ref|ZP_04810602.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 1106b]
 gi|254184767|ref|ZP_04891356.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 1655]
 gi|52213330|emb|CAH39373.1| cytochrome O ubiquinol oxidase subunit III [Burkholderia
           pseudomallei K96243]
 gi|126231554|gb|ABN94967.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 1106a]
 gi|184215359|gb|EDU12340.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 1655]
 gi|217394953|gb|EEC34972.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia
           pseudomallei 576]
 gi|235000312|gb|EEP49736.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia
           pseudomallei MSHR346]
 gi|242134824|gb|EES21227.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 1106b]
          Length = 197

 Score =  187 bits (475), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 93/194 (47%), Positives = 129/194 (66%), Gaps = 4/194 (2%)

Query: 20  KKESCVDHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            + +  DH  ++   GFW+YLM+DC++FA  F  +AV+   +A GP  +D+FDI G+ + 
Sbjct: 5   PRHAAHDHPPSHSVFGFWLYLMTDCVIFAALFAVFAVMAHQFAGGPTAVDLFDIPGVALE 64

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T +LL+SS++  FAM+ +   R       WL VT   G  F+ +E+ EF+ +I+  A PQ
Sbjct: 65  TALLLVSSITYGFAMIGAQRGRR-GALFGWLAVTFVLGAAFLGLELREFSQMIAEGAGPQ 123

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKK-GLISGNQRRLICLSMFWHFLDLI 196
           RSAFLSSFF LVG HGLHV  GL+W+ VL  Q L++  L   + RRL CLS+FWHFLD++
Sbjct: 124 RSAFLSSFFTLVGTHGLHVAIGLLWMAVLACQALRRPALTERDIRRLTCLSLFWHFLDIV 183

Query: 197 WICVFSFVYLMGVV 210
           WICVFSFVYL  V+
Sbjct: 184 WICVFSFVYLASVI 197


>gi|124381907|ref|YP_001025368.1| ubiquinol oxidase, subunit III [Burkholderia mallei NCTC 10229]
          Length = 197

 Score =  187 bits (475), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 93/194 (47%), Positives = 129/194 (66%), Gaps = 4/194 (2%)

Query: 20  KKESCVDHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            + +  DH  ++   GFW+YLM+DC++FA  F  +AV+   +A GP  +D+FDI G+ + 
Sbjct: 5   PRHAAHDHPPSHSVFGFWLYLMTDCVIFAALFAVFAVMAHQFAGGPTAVDLFDIPGVALE 64

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T +LL+SS++  FAM+ +   R       WL VT   G  F+ +E+ EF+ +I+  A PQ
Sbjct: 65  TALLLVSSITYGFAMIGAQRGRR-GALFGWLAVTFVLGAAFLGLELREFSQMIAEGAGPQ 123

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKK-GLISGNQRRLICLSMFWHFLDLI 196
           RSAFLSSFF LVG HGLHV  GL+W+ VL  Q L++  L   + RRL CLS+FWHFLD++
Sbjct: 124 RSAFLSSFFTLVGTHGLHVAIGLLWMAVLACQALRRSALTERDIRRLTCLSLFWHFLDIV 183

Query: 197 WICVFSFVYLMGVV 210
           WICVFSFVYL  V+
Sbjct: 184 WICVFSFVYLASVI 197


>gi|226195781|ref|ZP_03791368.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei Pakistan
           9]
 gi|254185986|ref|ZP_04892504.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei Pasteur
           52237]
 gi|254301042|ref|ZP_04968486.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 406e]
 gi|157810813|gb|EDO87983.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 406e]
 gi|157933672|gb|EDO89342.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei Pasteur
           52237]
 gi|225932266|gb|EEH28266.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei Pakistan
           9]
          Length = 197

 Score =  187 bits (475), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 93/194 (47%), Positives = 129/194 (66%), Gaps = 4/194 (2%)

Query: 20  KKESCVDHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            + +  DH  ++   GFW+YLM+DC++FA  F  +AV+   +A GP  +D+FDI G+ + 
Sbjct: 5   PRHAAHDHPPSHSVFGFWLYLMTDCVVFAALFAVFAVMAHQFAGGPTAVDLFDIPGVALE 64

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T +LL+SS++  FAM+ +   R       WL VT   G  F+ +E+ EF+ +I+  A PQ
Sbjct: 65  TALLLVSSITYGFAMIGAQRGRR-GALFGWLAVTFVLGAAFLGLELREFSQMIAEGAGPQ 123

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKK-GLISGNQRRLICLSMFWHFLDLI 196
           RSAFLSSFF LVG HGLHV  GL+W+ VL  Q L++  L   + RRL CLS+FWHFLD++
Sbjct: 124 RSAFLSSFFTLVGTHGLHVAIGLLWMAVLACQALRRPALTERDIRRLTCLSLFWHFLDIV 183

Query: 197 WICVFSFVYLMGVV 210
           WICVFSFVYL  V+
Sbjct: 184 WICVFSFVYLASVI 197


>gi|73538404|ref|YP_298771.1| cytochrome O ubiquinol oxidase subunit III [Ralstonia eutropha
           JMP134]
 gi|72121741|gb|AAZ63927.1| cyoC2, RSc1860; probable transmembrane cytochrome O ubiquinol
           oxidase (subunit III) oxidoreductase protein [Ralstonia
           eutropha JMP134]
          Length = 220

 Score =  187 bits (475), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 126/197 (63%), Gaps = 7/197 (3%)

Query: 17  VKDKKESCVDHDG------TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFD 70
           V     +  +HD       T LGFW+YLMSDCL+FAV F TY VLG + A GPA  ++FD
Sbjct: 20  VHHAAHTGAEHDAHASEGHTTLGFWLYLMSDCLIFAVLFATYGVLGNHTAGGPAGRELFD 79

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKR-LIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           +  + V T++LL SS +   AM++    R  +   + WL +T   G  FI MEIYEF  L
Sbjct: 80  LRFVLVETMLLLCSSYTFGMAMMSIKNGRGEVRDVIRWLAITFMLGACFIGMEIYEFREL 139

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
           +   A PQRSA LS+FF LVG HG+HV  GL W+ VL  Q+   GL +  +RRL CLS+F
Sbjct: 140 LHEGAGPQRSAALSAFFMLVGTHGMHVAAGLAWIVVLAHQMQAFGLDAIVRRRLACLSLF 199

Query: 190 WHFLDLIWICVFSFVYL 206
           WHFLDL+WICVF+FVYL
Sbjct: 200 WHFLDLVWICVFTFVYL 216


>gi|113867652|ref|YP_726141.1| bo3-type quinol oxidase, subunit III [Ralstonia eutropha H16]
 gi|113526428|emb|CAJ92773.1| bo3-type quinol oxidase, subunit III [Ralstonia eutropha H16]
          Length = 210

 Score =  187 bits (475), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 121/177 (68%), Gaps = 1/177 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T LGFW+YLMSDCL+FAV F T+ VL  N A GP    +F++  +F  T+VLLLSS +  
Sbjct: 31  TPLGFWLYLMSDCLIFAVLFATFGVLSGNTAGGPGGRQLFELPFVFAETMVLLLSSYTFG 90

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
            AML   T     + + WL VT   G +FI ME+YEFAHL+   A P  SA+LS+FF LV
Sbjct: 91  LAMLRQGTDD-APRMIRWLAVTFALGALFIAMEVYEFAHLLHQGAGPGVSAYLSAFFTLV 149

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
           G HGLHV  GL+WL V++ QI   GL    +RRL CLS+FWHFLDL+WICVF+FVYL
Sbjct: 150 GTHGLHVTSGLLWLAVMIHQIRHFGLDDIVRRRLACLSLFWHFLDLVWICVFTFVYL 206


>gi|83716302|ref|YP_438681.1| cytochrome c oxidase subunit III [Burkholderia thailandensis E264]
 gi|167615186|ref|ZP_02383821.1| Cytochrome c oxidase subunit III [Burkholderia thailandensis Bt4]
 gi|257141751|ref|ZP_05590013.1| cytochrome c oxidase subunit III [Burkholderia thailandensis E264]
 gi|83650127|gb|ABC34191.1| Cytochrome c oxidase subunit III [Burkholderia thailandensis E264]
          Length = 204

 Score =  187 bits (475), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 92/188 (48%), Positives = 128/188 (68%), Gaps = 4/188 (2%)

Query: 26  DHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLL 83
           DH  ++   GFW+YLM+DC++FA  F  +AV+   +A GP  +D+FDI G+ + T +LL+
Sbjct: 18  DHPPSHSVFGFWLYLMTDCVIFAALFAVFAVMAHQFAGGPTAVDLFDIPGVALETALLLV 77

Query: 84  SSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLS 143
           SS++  FAM+ +   R       WL VT   G  F+ +E+ EF+H+I+  A PQRSAFLS
Sbjct: 78  SSITYGFAMIGAQRGRR-GALFGWLAVTFALGAAFLGLELREFSHMIAEGAGPQRSAFLS 136

Query: 144 SFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ-RRLICLSMFWHFLDLIWICVFS 202
           SFF LVG HGLHV  GL+W+ VL  Q +++  ++    RRL CLS+FWHFLD++WICVFS
Sbjct: 137 SFFTLVGTHGLHVAIGLLWMAVLAFQAMRRPTLTERDIRRLTCLSLFWHFLDIVWICVFS 196

Query: 203 FVYLMGVV 210
           FVYL  V+
Sbjct: 197 FVYLASVI 204


>gi|227327521|ref|ZP_03831545.1| cytochrome o ubiquinol oxidase subunit III [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 204

 Score =  187 bits (475), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 94/178 (52%), Positives = 124/178 (69%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSD ++F   F TYAVL    A GP   ++F +  + V T  LL SS++   AM
Sbjct: 28  GFWVYLMSDLIIFGSLFATYAVLVNGTAGGPTGKELFQLPFVLVETFALLFSSITYGMAM 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K    +  +WL VT  FG++FI MEIYEF HLI     P RSAFLS+FFALVG H
Sbjct: 88  IA-MNKGNKSQVNAWLGVTFLFGLVFIGMEIYEFHHLIVEGYGPDRSAFLSAFFALVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           G+HV  GLIWL +++IQ+ K+GL + N+ RL+CLS+FWHFLD++WICVF+ VYL+G +
Sbjct: 147 GIHVTGGLIWLVIMMIQVSKRGLTATNKTRLMCLSLFWHFLDVVWICVFTVVYLLGAM 204


>gi|148978617|ref|ZP_01815044.1| cytochrome o ubiquinol oxidase, subunit III [Vibrionales bacterium
           SWAT-3]
 gi|145962283|gb|EDK27565.1| cytochrome o ubiquinol oxidase, subunit III [Vibrionales bacterium
           SWAT-3]
          Length = 205

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 121/178 (67%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSDC++FA  F TYAVL     AGP   D+F++  +FV T++LL SS++  F M
Sbjct: 29  GFWVYLMSDCVLFATLFATYAVLESGSIAGPTGKDIFELPFVFVETMMLLFSSITFGFGM 88

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   ++ +     WL VT   G+ FI ME+YEF HLI+    PQ SAFLS+FF LVG H
Sbjct: 89  IA-MKRQDVAGLKKWLKVTFLLGLAFICMEVYEFHHLIAEGYGPQESAFLSAFFTLVGTH 147

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV FGLIW+ V   Q+  KGL      R  CLS+FWHFLD++WICVF+ VYLMGV+
Sbjct: 148 GLHVTFGLIWMAVAYHQLSTKGLNDNMSMRFQCLSLFWHFLDIVWICVFTIVYLMGVM 205


>gi|262042466|ref|ZP_06015625.1| quinol oxidase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|259040170|gb|EEW41282.1| quinol oxidase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
          Length = 181

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 123/178 (69%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++FA  F TYAVL    A GP   D+F++  + V T +LL SS++   A 
Sbjct: 5   GFWIYLMSDCIIFATLFATYAVLVNGTAGGPTGKDIFELPFVLVETALLLFSSITYGMAA 64

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K    + VSWL +T  FG  FI MEIYEF HLI       RS FLS+FFALVG H
Sbjct: 65  IA-MYKNNKSQVVSWLALTWLFGAGFIGMEIYEFHHLIMEGFGLDRSGFLSAFFALVGTH 123

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+ VL+ Q+ ++GL S N+ R++CLS+FWHFLD++WICVFS VYLMG +
Sbjct: 124 GLHVTSGLIWMAVLMFQVSRRGLTSTNRTRILCLSLFWHFLDVVWICVFSVVYLMGAM 181


>gi|167573743|ref|ZP_02366617.1| ubiquinol oxidase, subunit III [Burkholderia oklahomensis C6786]
          Length = 202

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 124/179 (69%), Gaps = 2/179 (1%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLM+DC++FA  F  +AV+   +A GP  +D+FDI G+ + T +LL+SS++  FAM
Sbjct: 25  GFWLYLMTDCVIFAALFAVFAVMAHQFAGGPTAVDLFDIPGVAIETALLLVSSITYGFAM 84

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           + +   R     + WL VT   G  F+ +E+ EF+H+I+  A PQRSAFLSSFF LVG H
Sbjct: 85  IGAQRGRR-SALLGWLAVTFVLGAAFLGLELREFSHMIAEGAGPQRSAFLSSFFTLVGTH 143

Query: 153 GLHVFFGLIWLFVLVIQILKK-GLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GL+W+ VL  Q  ++  L   + RRL CLS+FWHFLD++WICVF+FVYL  V+
Sbjct: 144 GLHVAIGLLWMAVLAFQATRRPALTERDIRRLTCLSLFWHFLDIVWICVFTFVYLASVI 202


>gi|326793469|ref|YP_004311289.1| cytochrome o ubiquinol oxidase subunit III [Marinomonas
           mediterranea MMB-1]
 gi|326544233|gb|ADZ89453.1| cytochrome o ubiquinol oxidase, subunit III [Marinomonas
           mediterranea MMB-1]
          Length = 202

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 97/181 (53%), Positives = 127/181 (70%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFWIYLM+DC++F+ FF TYAVL  N A G +  D+FD++ +   T  LL SS++  
Sbjct: 23  TTFGFWIYLMTDCILFSCFFATYAVLFMNTAGGVSGKDIFDLTLVGGGTAALLFSSITFG 82

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAM+ SA K+    T+ WL VT  FG +F+ +E+YEF HLI     P +SAFL++FF+LV
Sbjct: 83  FAMI-SAYKKNKGGTLFWLAVTFVFGAVFLGLEVYEFHHLIHAGHGPDKSAFLTAFFSLV 141

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           GLHG HV  G+IW+ V+  ++ K GL S    RL CLS+FWHFLD+IWICVFSFVYLMG 
Sbjct: 142 GLHGFHVTAGMIWIIVMFCEVSKGGLESRTVTRLSCLSLFWHFLDVIWICVFSFVYLMGA 201

Query: 210 V 210
           +
Sbjct: 202 M 202


>gi|166713086|ref|ZP_02244293.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 210

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 125/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL SSLS  
Sbjct: 31  TVFGFWVYLMSDCLLFAGLFATYAVLSGATVDGPTAKELFDLKFVLVETFLLLFSSLSFG 90

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAM+A A KR +     WL VTA  G+ F+ MEI+EF HLI   A P RSAFLS+FF LV
Sbjct: 91  FAMIA-AHKRKMGGLYGWLAVTALLGIGFLCMEIWEFNHLIHEGAGPGRSAFLSAFFTLV 149

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GL+W+ VLVIQI K GL + N  RL CLS+FWHFLD+IWI VF+ VYL+G 
Sbjct: 150 GTHGLHVASGLLWMAVLVIQISKNGLTARNSTRLACLSLFWHFLDIIWIGVFTVVYLLGA 209

Query: 210 V 210
           +
Sbjct: 210 L 210


>gi|73540687|ref|YP_295207.1| transmembrane cytochrome O ubiquinol oxidase (subunit III)
           oxidoreductase protein [Ralstonia eutropha JMP134]
 gi|72118100|gb|AAZ60363.1| probable transmembrane cytochrome O ubiquinol oxidase (subunit III)
           oxidoreductase protein [Ralstonia eutropha JMP134]
          Length = 217

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 96/210 (45%), Positives = 132/210 (62%), Gaps = 4/210 (1%)

Query: 4   QKIGKSPNFSLFYVKDKKESCVDHD---GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
            + G +   +  +  D+      HD    T  GFW+YLMSDC++FA  F  +AVL    A
Sbjct: 9   DRFGAAQAPAHAHSHDETHDHAHHDTSENTIFGFWLYLMSDCILFACLFAAFAVLRGEVA 68

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
            GP+  ++F+++ + V T +LL SS++  FAM+ S   R   + + WL +T   G  F+ 
Sbjct: 69  GGPSAKELFELNYVLVETFILLFSSITYGFAMI-SMQNRSKGRVLVWLGITFLLGAAFMY 127

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           MEI EF HLI+  A P RSAFLSSFF LVG HGLHV  G++W+ VL+ Q+ KKGL     
Sbjct: 128 MEINEFHHLIAEGAGPSRSAFLSSFFTLVGTHGLHVASGMVWMLVLMWQVSKKGLTPTMS 187

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           +RL CLS+FWHFLD++WI VF+ VYLMG +
Sbjct: 188 KRLNCLSLFWHFLDVVWIGVFTVVYLMGAM 217


>gi|289670392|ref|ZP_06491467.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas campestris
           pv. musacearum NCPPB4381]
          Length = 210

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 103/181 (56%), Positives = 125/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL SSLS  
Sbjct: 31  TVFGFWVYLMSDCLLFAGLFATYAVLSGATVDGPTAKELFDLKFVLVETFLLLFSSLSFG 90

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAM+A A KR +     WL VTA  G+ F+ ME++EF HLI   A P RSAFLS+FF LV
Sbjct: 91  FAMIA-AHKRKMGGLYGWLAVTALLGIGFLCMEVWEFNHLIHEGAGPSRSAFLSAFFTLV 149

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GL+W+ VLVIQI K GL + N  RL CLS+FWHFLD+IWI VF+ VYL+G 
Sbjct: 150 GTHGLHVASGLLWMAVLVIQISKNGLTARNSTRLACLSLFWHFLDIIWIGVFTVVYLLGA 209

Query: 210 V 210
           +
Sbjct: 210 L 210


>gi|294627030|ref|ZP_06705620.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
 gi|292598692|gb|EFF42839.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
          Length = 208

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 103/181 (56%), Positives = 125/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL SSLS  
Sbjct: 29  TVFGFWVYLMSDCLLFAGLFATYAVLSGATVNGPTAKELFDLKFVLVETFLLLFSSLSFG 88

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAM+A A KR +     WL VTA  G+ F+ ME++EF HLI   A P RSAFLS+FF LV
Sbjct: 89  FAMIA-AHKRKMGGLYGWLAVTALLGIGFLCMEVWEFNHLIHEGAGPGRSAFLSAFFTLV 147

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GL+W+ VLVIQI K GL + N  RL CLS+FWHFLD+IWI VF+ VYL+G 
Sbjct: 148 GTHGLHVASGLLWMAVLVIQISKNGLTARNSTRLACLSLFWHFLDIIWIGVFTVVYLLGA 207

Query: 210 V 210
           +
Sbjct: 208 L 208


>gi|167899367|ref|ZP_02486768.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 7894]
          Length = 202

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 93/194 (47%), Positives = 128/194 (65%), Gaps = 4/194 (2%)

Query: 20  KKESCVDHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            + +  DH  ++   GFW+YLM+DC++FA  F  +AV+   +A GP  +D+FDI G+ + 
Sbjct: 10  PRHAAHDHPPSHSVFGFWLYLMTDCVVFAALFAVFAVMAHQFAGGPTAVDLFDIPGVALE 69

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T +LL+SS++  FAM+ +   R       WL VT   G  F+ +E+ EF+ +I+  A PQ
Sbjct: 70  TALLLVSSITYGFAMIGAQRGRR-GALFGWLAVTFVLGAAFLGLELREFSQMIAEGAGPQ 128

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILK-KGLISGNQRRLICLSMFWHFLDLI 196
           RSAFLSSFF LVG HGLHV  GL+W+ VL  Q L+   L   + RRL CLS+FWHFLD++
Sbjct: 129 RSAFLSSFFTLVGTHGLHVAIGLLWMAVLACQALRHPALTERDIRRLTCLSLFWHFLDIV 188

Query: 197 WICVFSFVYLMGVV 210
           WICVFSFVYL  V+
Sbjct: 189 WICVFSFVYLASVI 202


>gi|21242013|ref|NP_641595.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas axonopodis
           pv. citri str. 306]
 gi|21107411|gb|AAM36131.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas axonopodis
           pv. citri str. 306]
          Length = 208

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 103/181 (56%), Positives = 125/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL SSLS  
Sbjct: 29  TVFGFWVYLMSDCLLFACLFATYAVLSGATVDGPTAKELFDLKFVLVETFLLLFSSLSFG 88

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAM+A A KR +     WL VTA  G+ F+ ME++EF HLI   A P RSAFLS+FF LV
Sbjct: 89  FAMIA-AHKRKMGGLYGWLAVTALLGIGFLCMEVWEFNHLIHEGAGPGRSAFLSAFFTLV 147

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GL+W+ VLVIQI K GL + N  RL CLS+FWHFLD+IWI VF+ VYL+G 
Sbjct: 148 GTHGLHVASGLLWMAVLVIQISKNGLTARNSTRLACLSLFWHFLDIIWIGVFTVVYLLGA 207

Query: 210 V 210
           +
Sbjct: 208 L 208


>gi|239995159|ref|ZP_04715683.1| cytochrome o ubiquinol oxidase subunit III (Ubiquinol oxidase chain
           C) [Alteromonas macleodii ATCC 27126]
          Length = 205

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 128/183 (69%), Gaps = 1/183 (0%)

Query: 28  DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
           + T  GFW+YLM+DCL+FA FF TYAVL  N A G +  D+F+++ + V T  LLLSS++
Sbjct: 24  NNTVFGFWLYLMTDCLLFASFFATYAVLFMNTAGGVSGKDIFELNFVAVETAALLLSSIA 83

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
             FAM+  A ++     ++WL VT   G  FI ME+YEF HLI     PQ+SAFL++FF+
Sbjct: 84  FGFAMIC-AHRQNKSGALAWLAVTWALGACFIGMEVYEFHHLIEHGNGPQQSAFLTAFFS 142

Query: 148 LVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           LVGLHGLHV  GLIW+ ++ I++ ++ L      RL CLS+FWHFLD++WICVF+ VYLM
Sbjct: 143 LVGLHGLHVTAGLIWMTIMFIEVTRRDLGEQTVTRLSCLSLFWHFLDIVWICVFTVVYLM 202

Query: 208 GVV 210
           G +
Sbjct: 203 GAM 205


>gi|325928655|ref|ZP_08189834.1| cytochrome bo3 quinol oxidase subunit 3 [Xanthomonas perforans
           91-118]
 gi|325540983|gb|EGD12546.1| cytochrome bo3 quinol oxidase subunit 3 [Xanthomonas perforans
           91-118]
          Length = 210

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 103/181 (56%), Positives = 125/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL SSLS  
Sbjct: 31  TVFGFWVYLMSDCLLFAGLFATYAVLSGATVDGPTAKELFDLKFVLVETFLLLFSSLSFG 90

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAM+A A KR +     WL VTA  G+ F+ ME++EF HLI   A P RSAFLS+FF LV
Sbjct: 91  FAMIA-AHKRKMGGLYGWLAVTALLGIGFLCMEVWEFNHLIHEGAGPGRSAFLSAFFTLV 149

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GL+W+ VLVIQI K GL + N  RL CLS+FWHFLD+IWI VF+ VYL+G 
Sbjct: 150 GTHGLHVASGLLWMAVLVIQISKNGLTARNSTRLACLSLFWHFLDIIWIGVFTVVYLLGA 209

Query: 210 V 210
           +
Sbjct: 210 L 210


>gi|197284018|ref|YP_002149890.1| cytochrome O ubiquinol oxidase subunit III [Proteus mirabilis
           HI4320]
 gi|227358112|ref|ZP_03842453.1| cytochrome O ubiquinol oxidase subunit III [Proteus mirabilis ATCC
           29906]
 gi|194681505|emb|CAR40377.1| cytochrome O ubiquinol oxidase subunit III [Proteus mirabilis
           HI4320]
 gi|227161448|gb|EEI46485.1| cytochrome O ubiquinol oxidase subunit III [Proteus mirabilis ATCC
           29906]
          Length = 203

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 128/194 (65%), Gaps = 4/194 (2%)

Query: 18  KDKKESCVDHDG---TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
            +  E    HD       GFWIYLMSD ++FA  F TYAVL    A GP+  ++F +  +
Sbjct: 9   ANAHEHHGHHDAGATKVFGFWIYLMSDLILFASLFATYAVLVNGIADGPSGKEIFSLPFV 68

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            V T +LL SS++  FAML S  K  + +   WL VT  FG+ F++ME+YEF  LI+   
Sbjct: 69  LVETFLLLFSSITFGFAML-SMNKGSVSQVNLWLFVTFLFGLGFVVMEVYEFHELIAEGY 127

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            P RSAFLS+FFALV  HGLHV  GL+W+ +++IQ+ ++GL   N+ RL CLS+FWHFLD
Sbjct: 128 GPDRSAFLSAFFALVSTHGLHVTAGLVWIIIMMIQVSRRGLTDVNRTRLSCLSLFWHFLD 187

Query: 195 LIWICVFSFVYLMG 208
           ++WICVF+ VYLMG
Sbjct: 188 VVWICVFTVVYLMG 201


>gi|91225751|ref|ZP_01260780.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio alginolyticus
           12G01]
 gi|269968096|ref|ZP_06182133.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio alginolyticus
           40B]
 gi|91189640|gb|EAS75915.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio alginolyticus
           12G01]
 gi|269827342|gb|EEZ81639.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio alginolyticus
           40B]
          Length = 200

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 121/178 (67%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSDC++FA  F TYAVL  N  AGP   D+F++  +FV T++LL SS++  F +
Sbjct: 24  GFWVYLMSDCVLFATLFATYAVLSSNSIAGPTGKDIFELPFVFVETMLLLFSSITFGFGI 83

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   +  +     W+LVT   G+ FI ME+YEF HLI     PQ SAFLS+FF LVG H
Sbjct: 84  IA-MKRNNVAGLKRWMLVTFALGLGFICMEVYEFHHLIEEGYGPQTSAFLSAFFTLVGTH 142

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV FGLIWL V   Q+  KGL      R  CLS+FWHFLD++WICVF+ VYL+GV+
Sbjct: 143 GLHVTFGLIWLAVAYHQLSTKGLNDNMAMRFNCLSLFWHFLDIVWICVFTIVYLLGVM 200


>gi|254202955|ref|ZP_04909317.1| ubiquinol oxidase, subunit III [Burkholderia mallei FMH]
 gi|254208289|ref|ZP_04914638.1| ubiquinol oxidase, subunit III [Burkholderia mallei JHU]
 gi|147746000|gb|EDK53078.1| ubiquinol oxidase, subunit III [Burkholderia mallei FMH]
 gi|147750976|gb|EDK58044.1| ubiquinol oxidase, subunit III [Burkholderia mallei JHU]
          Length = 197

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 128/194 (65%), Gaps = 4/194 (2%)

Query: 20  KKESCVDHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            + +  DH  ++   GFW+YLM+DC++FA  F  +AV+   +A GP  +D+FDI G+ + 
Sbjct: 5   PRHAAHDHPPSHSVFGFWLYLMTDCVIFAALFAVFAVMAHQFAGGPTAVDLFDIPGVALE 64

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T +LL+SS++  FAM+ +   R       W  VT   G  F+ +E+ EF+ +I+  A PQ
Sbjct: 65  TALLLVSSITYGFAMIGAQRGRR-GALFGWFAVTFVLGAAFLGLELREFSQMIAEGAGPQ 123

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKK-GLISGNQRRLICLSMFWHFLDLI 196
           RSAFLSSFF LVG HGLHV  GL+W+ VL  Q L++  L   + RRL CLS+FWHFLD++
Sbjct: 124 RSAFLSSFFTLVGTHGLHVAIGLLWMAVLACQALRRPALTERDIRRLTCLSLFWHFLDIV 183

Query: 197 WICVFSFVYLMGVV 210
           WICVFSFVYL  V+
Sbjct: 184 WICVFSFVYLASVI 197


>gi|148560198|ref|YP_001258091.1| cytochrome o ubiquinol oxidase subunit III [Brucella ovis ATCC
           25840]
 gi|148371455|gb|ABQ61434.1| cytochrome o ubiquinol oxidase, subunit III [Brucella ovis ATCC
           25840]
          Length = 209

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 126/196 (64%), Gaps = 4/196 (2%)

Query: 18  KDKKESCVDHDG---TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
            D       HD    T +GFWIYLMSDC++F+  F TYAVL   +A GP   ++FD+  +
Sbjct: 15  NDHPAHEDHHDAGSTTLVGFWIYLMSDCILFSGLFATYAVLAHRFAGGPTGRELFDLQFV 74

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            V T++LL+SSL+   A L S  K      + WL VT   G  F+ MEIYEF HLI   A
Sbjct: 75  LVETMLLLVSSLTYGLATL-SMYKNNRSGVLGWLGVTFLLGAAFLAMEIYEFHHLIVEGA 133

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            P RS+FLS+FF LVG HG H+  GLIW+ VL   +L+ GL   N+ R++CLS+FWHFLD
Sbjct: 134 GPDRSSFLSAFFTLVGTHGFHITSGLIWILVLSAMLLRDGLTERNRTRVMCLSLFWHFLD 193

Query: 195 LIWICVFSFVYLMGVV 210
           +IWI VF+ VYL+GV+
Sbjct: 194 IIWIGVFTLVYLLGVL 209


>gi|78046865|ref|YP_363040.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
 gi|78035295|emb|CAJ22940.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
          Length = 208

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 103/181 (56%), Positives = 125/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL SSLS  
Sbjct: 29  TVFGFWVYLMSDCLLFAGLFATYAVLSGATVDGPTAKELFDLKFVLVETFLLLFSSLSFG 88

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAM+A A KR +     WL VTA  G+ F+ ME++EF HLI   A P RSAFLS+FF LV
Sbjct: 89  FAMIA-AHKRKMGGLYGWLAVTALLGIGFLCMEVWEFNHLIHEGAGPGRSAFLSAFFTLV 147

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GL+W+ VLVIQI K GL + N  RL CLS+FWHFLD+IWI VF+ VYL+G 
Sbjct: 148 GTHGLHVASGLLWMAVLVIQISKNGLTARNSTRLACLSLFWHFLDIIWIGVFTVVYLLGA 207

Query: 210 V 210
           +
Sbjct: 208 L 208


>gi|294664344|ref|ZP_06729708.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
 gi|292605884|gb|EFF49171.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
          Length = 208

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 103/181 (56%), Positives = 125/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL SSLS  
Sbjct: 29  TVFGFWVYLMSDCLLFAGLFATYAVLSGATVDGPTAKELFDLKFVLVETFLLLFSSLSFG 88

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAM+A A KR +     WL VTA  G+ F+ ME++EF HLI   A P RSAFLS+FF LV
Sbjct: 89  FAMIA-AHKRKMGGLYGWLAVTALLGIGFLCMEVWEFNHLIHEGAGPGRSAFLSAFFTLV 147

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GL+W+ VLVIQI K GL + N  RL CLS+FWHFLD+IWI VF+ VYL+G 
Sbjct: 148 GTHGLHVASGLLWMAVLVIQISKNGLTARNSTRLACLSLFWHFLDIIWIGVFTVVYLLGA 207

Query: 210 V 210
           +
Sbjct: 208 L 208


>gi|58581254|ref|YP_200270.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|58425848|gb|AAW74885.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas oryzae pv.
           oryzae KACC10331]
          Length = 210

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 103/181 (56%), Positives = 125/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL SSLS  
Sbjct: 31  TVFGFWVYLMSDCLLFAGLFATYAVLSGATVDGPTAKELFDLKFVLVETFLLLFSSLSFG 90

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAM+A A KR +     W+ VTA  G+ F+ MEI+EF HLI   A P RSAFLS+FF LV
Sbjct: 91  FAMIA-AHKRKMGGLYGWMAVTALLGIGFLCMEIWEFNHLIHEGAGPGRSAFLSAFFTLV 149

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GL+W+ VLVIQI K GL + N  RL CLS+FWHFLD+IWI VF+ VYL+G 
Sbjct: 150 GTHGLHVASGLLWMAVLVIQISKNGLTARNSTRLACLSLFWHFLDIIWIGVFTVVYLLGA 209

Query: 210 V 210
           +
Sbjct: 210 L 210


>gi|53716519|ref|YP_105023.1| ubiquinol oxidase, subunit III [Burkholderia mallei ATCC 23344]
 gi|67641746|ref|ZP_00440514.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia mallei
           GB8 horse 4]
 gi|52422489|gb|AAU46059.1| ubiquinol oxidase, subunit III [Burkholderia mallei ATCC 23344]
 gi|238522721|gb|EEP86164.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia mallei
           GB8 horse 4]
          Length = 202

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 128/194 (65%), Gaps = 4/194 (2%)

Query: 20  KKESCVDHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            + +  DH  ++   GFW+YLM+DC++FA  F  +AV+   +A GP  +D+FDI G+ + 
Sbjct: 10  PRHAAHDHPPSHSVFGFWLYLMTDCVIFAALFAVFAVMAHQFAGGPTAVDLFDIPGVALE 69

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T +LL+SS++  FAM+ +   R       W  VT   G  F+ +E+ EF+ +I+  A PQ
Sbjct: 70  TALLLVSSITYGFAMIGAQRGRR-GALFGWFAVTFVLGAAFLGLELREFSQMIAEGAGPQ 128

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKK-GLISGNQRRLICLSMFWHFLDLI 196
           RSAFLSSFF LVG HGLHV  GL+W+ VL  Q L++  L   + RRL CLS+FWHFLD++
Sbjct: 129 RSAFLSSFFTLVGTHGLHVAIGLLWMAVLACQALRRPALTERDIRRLTCLSLFWHFLDIV 188

Query: 197 WICVFSFVYLMGVV 210
           WICVFSFVYL  V+
Sbjct: 189 WICVFSFVYLASVI 202


>gi|134278331|ref|ZP_01765045.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 305]
 gi|134250115|gb|EBA50195.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 305]
          Length = 197

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 93/194 (47%), Positives = 127/194 (65%), Gaps = 4/194 (2%)

Query: 20  KKESCVDHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            + +  DH   +   GFW+YLM+DC++FA  F  +AV+   +A GP  +D+FDI G+ + 
Sbjct: 5   PRHAAHDHPPAHSVFGFWLYLMTDCVIFAALFAVFAVMAHQFAGGPTAVDLFDIPGVALE 64

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T +LL+SS++  FAM+ +   R       WL VT   G  F+ +E+ EF+ +I+  A PQ
Sbjct: 65  TALLLVSSITYGFAMIGAQRGRR-GALFGWLAVTFVLGAAFLGLELREFSQMIAEGAGPQ 123

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQIL-KKGLISGNQRRLICLSMFWHFLDLI 196
           RSAFLSSFF LVG HGLHV  GL+W+ VL  Q L +  L   + RRL CLS+FWHFLD++
Sbjct: 124 RSAFLSSFFTLVGTHGLHVAIGLLWMAVLACQALHRPALTERDIRRLTCLSLFWHFLDIV 183

Query: 197 WICVFSFVYLMGVV 210
           WICVFSFVYL  V+
Sbjct: 184 WICVFSFVYLASVI 197


>gi|153837577|ref|ZP_01990244.1| cytOchrome o ubiquinol oxidase, subunit III [Vibrio
           parahaemolyticus AQ3810]
 gi|149749074|gb|EDM59885.1| cytOchrome o ubiquinol oxidase, subunit III [Vibrio
           parahaemolyticus AQ3810]
          Length = 200

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 121/178 (67%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSDC++FA  F TYAVL  N  AGP   ++F++  +FV T++LL SS++  F +
Sbjct: 24  GFWVYLMSDCVLFATLFATYAVLSSNSIAGPTGKEIFELPFVFVETMLLLFSSITFGFGI 83

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   +  +     W+LVT   G+ FI ME+YEF HLI     PQ SAFLS+FF LVG H
Sbjct: 84  IA-MKRNDVSGLKRWMLVTFALGLGFICMEVYEFHHLIKEGYGPQTSAFLSAFFTLVGTH 142

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV FGLIWL V   Q+  KGL      R  CLS+FWHFLD++WICVF+ VYLMGV+
Sbjct: 143 GLHVTFGLIWLAVAYHQLSTKGLNDNMAMRFNCLSLFWHFLDIVWICVFTIVYLMGVM 200


>gi|260901248|ref|ZP_05909643.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio
           parahaemolyticus AQ4037]
 gi|308106822|gb|EFO44362.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio
           parahaemolyticus AQ4037]
          Length = 200

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 121/178 (67%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSDC++FA  F TYAVL  N  AGP   ++F++  +FV T++LL SS++  F +
Sbjct: 24  GFWVYLMSDCVLFATLFATYAVLSSNSIAGPTGKEIFELPFVFVETMLLLFSSITFGFGI 83

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   +  +     W+LVT   G+ FI ME+YEF HLI     PQ SAFLS+FF LVG H
Sbjct: 84  IA-MKRNDVAGLKRWMLVTFALGLGFICMEVYEFHHLIQEGYGPQTSAFLSAFFTLVGTH 142

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV FGLIWL V   Q+  KGL      R  CLS+FWHFLD++WICVF+ VYLMGV+
Sbjct: 143 GLHVTFGLIWLAVAYHQLSTKGLNDNMAMRFNCLSLFWHFLDIVWICVFTIVYLMGVM 200


>gi|28900484|ref|NP_800139.1| cytochrome o ubiquinol oxidase subunit III [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|260365637|ref|ZP_05778158.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio
           parahaemolyticus K5030]
 gi|260877437|ref|ZP_05889792.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio
           parahaemolyticus AN-5034]
 gi|260898918|ref|ZP_05907359.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio
           parahaemolyticus Peru-466]
 gi|28808864|dbj|BAC61972.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|308089175|gb|EFO38870.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio
           parahaemolyticus Peru-466]
 gi|308090543|gb|EFO40238.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio
           parahaemolyticus AN-5034]
 gi|308111449|gb|EFO48989.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio
           parahaemolyticus K5030]
          Length = 200

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 121/178 (67%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSDC++FA  F TYAVL  N  AGP   ++F++  +FV T++LL SS++  F +
Sbjct: 24  GFWVYLMSDCVLFATLFATYAVLSSNSIAGPTGKEIFELPFVFVETMLLLFSSITFGFGI 83

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   +  +     W+LVT   G+ FI ME+YEF HLI     PQ SAFLS+FF LVG H
Sbjct: 84  IA-MKRNDVAGLKRWMLVTFALGLGFICMEVYEFHHLIQEGYGPQTSAFLSAFFTLVGTH 142

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV FGLIWL V   Q+  KGL      R  CLS+FWHFLD++WICVF+ VYLMGV+
Sbjct: 143 GLHVTFGLIWLAVAYHQLSTKGLNDNMAMRFNCLSLFWHFLDIVWICVFTIVYLMGVM 200


>gi|84623174|ref|YP_450546.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|84367114|dbj|BAE68272.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
          Length = 208

 Score =  185 bits (470), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 103/181 (56%), Positives = 125/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL SSLS  
Sbjct: 29  TVFGFWVYLMSDCLLFAGLFATYAVLSGATVDGPTAKELFDLKFVLVETFLLLFSSLSFG 88

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAM+A A KR +     W+ VTA  G+ F+ MEI+EF HLI   A P RSAFLS+FF LV
Sbjct: 89  FAMIA-AHKRKMGGLYGWMAVTALLGIGFLCMEIWEFNHLIHEGAGPGRSAFLSAFFTLV 147

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GL+W+ VLVIQI K GL + N  RL CLS+FWHFLD+IWI VF+ VYL+G 
Sbjct: 148 GTHGLHVASGLLWMAVLVIQISKNGLTARNSTRLACLSLFWHFLDIIWIGVFTVVYLLGA 207

Query: 210 V 210
           +
Sbjct: 208 L 208


>gi|188575778|ref|YP_001912707.1| cytOchrome o ubiquinol oxidase, subunit III [Xanthomonas oryzae pv.
           oryzae PXO99A]
 gi|188520230|gb|ACD58175.1| cytOchrome o ubiquinol oxidase, subunit III [Xanthomonas oryzae pv.
           oryzae PXO99A]
          Length = 210

 Score =  185 bits (470), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 103/181 (56%), Positives = 125/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL SSLS  
Sbjct: 31  TVFGFWVYLMSDCLLFAGLFATYAVLSGATVDGPTAKELFDLKFVLVETFLLLFSSLSFG 90

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAM+A A KR +     W+ VTA  G+ F+ MEI+EF HLI   A P RSAFLS+FF LV
Sbjct: 91  FAMIA-AHKRKMGGLYGWMAVTALLGIGFLCMEIWEFNHLIHEGAGPGRSAFLSAFFTLV 149

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GL+W+ VLVIQI K GL + N  RL CLS+FWHFLD+IWI VF+ VYL+G 
Sbjct: 150 GTHGLHVASGLLWMAVLVIQISKNGLTARNSTRLACLSLFWHFLDIIWIGVFTVVYLLGA 209

Query: 210 V 210
           +
Sbjct: 210 L 210


>gi|238025054|ref|YP_002909286.1| cytochrome c oxidase subunit III [Burkholderia glumae BGR1]
 gi|237879719|gb|ACR32051.1| Cytochrome c oxidase subunit III [Burkholderia glumae BGR1]
          Length = 203

 Score =  185 bits (469), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/179 (51%), Positives = 119/179 (66%), Gaps = 2/179 (1%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLM+DC++F   F  +AV+   +A GP   D+FDI G+ + T  LLLSS++  FAM
Sbjct: 26  GFWLYLMTDCILFGTLFAVFAVMQHEFAGGPTAKDLFDIPGVALETAALLLSSITYGFAM 85

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +  A +        WL VT   G  F+ MEI EF HLI+  A P RS FLSSFF LV  H
Sbjct: 86  IG-AHRNNRGAVFGWLAVTFLLGASFLFMEIREFTHLIAEGAGPDRSGFLSSFFTLVATH 144

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQ-RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+ VLV+QI +   +S    RRL CLS+FWHFLD++WICVF+FVYL+ V+
Sbjct: 145 GLHVTMGLIWMVVLVVQIARNPELSEQDVRRLTCLSLFWHFLDIVWICVFTFVYLVSVI 203


>gi|156976718|ref|YP_001447624.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio harveyi ATCC
           BAA-1116]
 gi|156528312|gb|ABU73397.1| hypothetical protein VIBHAR_05493 [Vibrio harveyi ATCC BAA-1116]
          Length = 199

 Score =  185 bits (469), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 96/178 (53%), Positives = 119/178 (66%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSDC++FA  F TYAVL     AGP   D+F++  +FV T++LL SS++  F M
Sbjct: 23  GFWVYLMSDCVLFATLFATYAVLESGSIAGPTGKDIFELPFVFVETMLLLFSSITFGFGM 82

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K  +     WL VT   G+ FI ME+YEF HLI     PQ SAFLS+FF LVG H
Sbjct: 83  IAMKRKD-VAGLKRWLKVTFLLGLGFICMEVYEFHHLIEEGYGPQESAFLSAFFTLVGTH 141

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV FGLIWL V   Q+  KGL      R  CLS+FWHFLD++WICVF+ VYL+GV+
Sbjct: 142 GLHVTFGLIWLAVGYHQLSTKGLNDNMSMRFQCLSLFWHFLDIVWICVFTIVYLLGVM 199


>gi|153833148|ref|ZP_01985815.1| cytOchrome o ubiquinol oxidase, subunit III [Vibrio harveyi HY01]
 gi|163800403|ref|ZP_02194304.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio sp. AND4]
 gi|148870578|gb|EDL69486.1| cytOchrome o ubiquinol oxidase, subunit III [Vibrio harveyi HY01]
 gi|159175846|gb|EDP60640.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio sp. AND4]
          Length = 199

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 96/178 (53%), Positives = 119/178 (66%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSDC++FA  F TYAVL     AGP   D+F++  +FV T++LL SS++  F M
Sbjct: 23  GFWVYLMSDCVLFATLFATYAVLESGSIAGPTGKDIFELPFVFVETMLLLFSSITFGFGM 82

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K  +     WL VT   G+ FI ME+YEF HLI     PQ SAFLS+FF LVG H
Sbjct: 83  IAMKRKD-VAGLKRWLKVTFLLGLGFICMEVYEFHHLIEEGYGPQESAFLSAFFTLVGTH 141

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV FGLIWL V   Q+  KGL      R  CLS+FWHFLD++WICVF+ VYL+GV+
Sbjct: 142 GLHVTFGLIWLAVGYHQLSTKGLNDNMSMRFQCLSLFWHFLDIVWICVFTIVYLLGVM 199


>gi|186472486|ref|YP_001859828.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia phymatum
           STM815]
 gi|184194818|gb|ACC72782.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia phymatum
           STM815]
          Length = 204

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 123/175 (70%), Gaps = 2/175 (1%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLM+DC++FA  F  +AV+   + AGP   D+FDI G+ V T  LLLSS++  FAM
Sbjct: 27  GFWLYLMTDCVLFASLFAVFAVMAHQFNAGPTGKDLFDIPGVAVETAALLLSSITYGFAM 86

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A A ++     + WL VT   G +F+ +E+ EF+HL++  A P RSAFLSSFF LVG H
Sbjct: 87  VA-ARRQNPRAVLGWLAVTFVLGAVFLKLELNEFSHLVAEGAGPSRSAFLSSFFVLVGTH 145

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQ-RRLICLSMFWHFLDLIWICVFSFVYL 206
           GLHV  GLIW+ VL +Q+ +   ++  +  RL CLS+FWHFLD++WICVF+FVYL
Sbjct: 146 GLHVATGLIWMAVLAVQVARAPQLTQREITRLTCLSLFWHFLDVVWICVFTFVYL 200


>gi|312881377|ref|ZP_07741174.1| cytochrome o ubiquinol oxidase subunit III [Vibrio caribbenthicus
           ATCC BAA-2122]
 gi|309371017|gb|EFP98472.1| cytochrome o ubiquinol oxidase subunit III [Vibrio caribbenthicus
           ATCC BAA-2122]
          Length = 199

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 96/178 (53%), Positives = 119/178 (66%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++FA  F TYAVL     +GP   D+F++  +FV T++LL SS++  F M
Sbjct: 23  GFWIYLMSDCILFATLFATYAVLETGSISGPTGKDIFELPFVFVETMLLLFSSITFGFGM 82

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   +  I     W+ VT   G+ FI MEIYEF HLI     PQ SAFLS+FF LVG H
Sbjct: 83  IA-MKRNDIAGLKRWMKVTFLLGVGFIAMEIYEFHHLIEAGYGPQESAFLSAFFTLVGTH 141

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV FGL+WL V   Q+  KGL      R  CLS+FWHFLD++WICVF+ VYLMGV+
Sbjct: 142 GLHVTFGLVWLAVCYHQLSTKGLNENMAMRFSCLSLFWHFLDIVWICVFTIVYLMGVM 199


>gi|76818220|ref|YP_336149.1| ubiquinol oxidase subunit III [Burkholderia pseudomallei 1710b]
 gi|76582693|gb|ABA52167.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 1710b]
          Length = 202

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 128/194 (65%), Gaps = 4/194 (2%)

Query: 20  KKESCVDHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            + +  DH  ++   GFW+YLM+DC++FA  F  +AV+   +A GP  +D+FDI G+ + 
Sbjct: 10  PRHAAHDHPPSHSVFGFWLYLMTDCVVFAALFAVFAVMAHQFAGGPTAVDLFDIPGVALE 69

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T +LL+SS++  FAM+ +   R       WL VT   G  F+ +E+ EF+ +I+  A PQ
Sbjct: 70  TALLLVSSITYGFAMIGAQRGRR-GALFGWLAVTFVLGAAFLGLELREFSQMIAEGAGPQ 128

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKK-GLISGNQRRLICLSMFWHFLDLI 196
           RSAFLSSFF LVG HGLHV  GL+W+ VL  Q L++  L   + RRL CLS+FWHFLD++
Sbjct: 129 RSAFLSSFFTLVGTHGLHVAIGLLWMAVLACQALRRPALTERDIRRLTCLSLFWHFLDIV 188

Query: 197 WICVFSFVYLMGVV 210
           WICV SFVYL  V+
Sbjct: 189 WICVSSFVYLASVI 202


>gi|260769715|ref|ZP_05878648.1| cytochrome O ubiquinol oxidase subunit III [Vibrio furnissii CIP
           102972]
 gi|260615053|gb|EEX40239.1| cytochrome O ubiquinol oxidase subunit III [Vibrio furnissii CIP
           102972]
 gi|315182289|gb|ADT89202.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio furnissii NCTC
           11218]
          Length = 200

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 121/178 (67%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++FA  F T+AVL    A GP   ++F++  +F  T++LL SS++  F M
Sbjct: 23  GFWIYLMSDCVLFASLFATFAVLSNATAGGPTGKELFELPFVFAETMLLLFSSITFGFGM 82

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K  I     WL VT   G  FI ME+YEF HLI+  A PQRSAFLS+FF LVG H
Sbjct: 83  IAMKRKD-IAGLKRWLAVTFLLGAGFIGMELYEFHHLIAEGAGPQRSAFLSAFFTLVGTH 141

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV FGLIWL V   Q+  KGL    + R  CLS+FWHFLD++WICVF+ VYL+GV+
Sbjct: 142 GLHVTFGLIWLAVCYWQLNTKGLNDMMETRFNCLSLFWHFLDIVWICVFTIVYLLGVM 199


>gi|325921008|ref|ZP_08182891.1| cytochrome bo3 quinol oxidase subunit 3 [Xanthomonas gardneri ATCC
           19865]
 gi|325548515|gb|EGD19486.1| cytochrome bo3 quinol oxidase subunit 3 [Xanthomonas gardneri ATCC
           19865]
          Length = 209

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 104/193 (53%), Positives = 126/193 (65%), Gaps = 1/193 (0%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            D  E       T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V 
Sbjct: 18  HDDHEHHDAGGNTVFGFWVYLMSDCLLFAGLFATYAVLSGATVDGPTAKELFDLKFVLVE 77

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T +LL SSLS   AM+ SA KR +    +WL VTA  G+ F+ ME++EF HLI   A P 
Sbjct: 78  TFLLLFSSLSFGVAMI-SAHKRSMTGLYAWLGVTALLGIGFLCMEVWEFNHLIHEGAGPG 136

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
           RSAFLS+FF LVG HGLHV  GL+W+ VLVIQI K GL   N  RL CLS+FWHFLD+IW
Sbjct: 137 RSAFLSAFFTLVGTHGLHVASGLLWMAVLVIQISKNGLTPRNSTRLACLSLFWHFLDIIW 196

Query: 198 ICVFSFVYLMGVV 210
           I VF+ VYL+G +
Sbjct: 197 IGVFTVVYLLGAL 209


>gi|209518752|ref|ZP_03267567.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia sp. H160]
 gi|209500794|gb|EEA00835.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia sp. H160]
          Length = 201

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 134/196 (68%), Gaps = 8/196 (4%)

Query: 20  KKESCVDHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
           + +   DH  ++   GFW+YLM+DC++FA  F  +AV+   +A GP+  D+F+I G+ + 
Sbjct: 9   EPQLAPDHVPSHSVFGFWLYLMTDCIVFAALFAVFAVMSHQFAGGPSGKDLFEIPGVALE 68

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTV--SWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           T +LLLSS++  FAML +   R   K V   WL VT   G+ F+++E+ EF+HLI+  A 
Sbjct: 69  TTMLLLSSITYGFAMLGAHKNR---KGVLLGWLGVTFLLGLAFLVLEMREFSHLIAEGAG 125

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILK-KGLISGNQRRLICLSMFWHFLD 194
           P RSAFLSSFF LVG HGLHV FGLIW+ VL +Q+++ + L   +  RL CLS+FWHFLD
Sbjct: 126 PGRSAFLSSFFTLVGTHGLHVTFGLIWMVVLALQVMRHRDLTERDMIRLTCLSLFWHFLD 185

Query: 195 LIWICVFSFVYLMGVV 210
           ++WI VF+FVYL  V+
Sbjct: 186 VVWIGVFTFVYLASVI 201


>gi|21230618|ref|NP_636535.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas campestris
           pv. campestris str. ATCC 33913]
 gi|66769386|ref|YP_244148.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas campestris
           pv. campestris str. 8004]
 gi|188992573|ref|YP_001904583.1| Cytochrome O ubiquinol oxidase subunit III [Xanthomonas campestris
           pv. campestris str. B100]
 gi|21112199|gb|AAM40459.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas campestris
           pv. campestris str. ATCC 33913]
 gi|66574718|gb|AAY50128.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas campestris
           pv. campestris str. 8004]
 gi|167734333|emb|CAP52543.1| Cytochrome O ubiquinol oxidase subunit III [Xanthomonas campestris
           pv. campestris]
          Length = 209

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 125/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL SSLS  
Sbjct: 30  TVFGFWVYLMSDCLLFAGLFATYAVLSGATVDGPTAKELFDLKFVLVETFLLLFSSLSFG 89

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAM+ SA KR +     WL VTA  G+ F+ MEI+EF HLI   A P RSAFLS+FF LV
Sbjct: 90  FAMI-SAHKRKMAGLYGWLAVTALLGIGFLCMEIWEFNHLIHEGAGPGRSAFLSAFFFLV 148

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GL+W+ VLVIQI K GL + N  RL CLS+FWHFLD+IWI VF+ VYL+G 
Sbjct: 149 GTHGLHVASGLLWMAVLVIQISKNGLTARNSTRLACLSLFWHFLDIIWIGVFTVVYLLGA 208

Query: 210 V 210
           +
Sbjct: 209 L 209


>gi|127511302|ref|YP_001092499.1| cytochrome c oxidase, subunit III [Shewanella loihica PV-4]
 gi|126636597|gb|ABO22240.1| cytochrome c oxidase, subunit III [Shewanella loihica PV-4]
          Length = 208

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 136/207 (65%), Gaps = 2/207 (0%)

Query: 5   KIGKSPNFSLFYVKDKKESCVDH-DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGP 63
            I    + S+  V+   E   D  + T LGFWIYLM+DC++FA  F TYAVL  N   G 
Sbjct: 2   SIAIPADLSVTQVETLHEEHHDTGENTLLGFWIYLMTDCILFASAFATYAVLYMNTDGGV 61

Query: 64  APIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEI 123
           +  DVF++  + + T  LLLSS++   A++  A +     T++WL VT   G +FI ME+
Sbjct: 62  SGKDVFELDFVLIETAALLLSSITYGLALI-FAKRHHKGATLAWLAVTFALGCVFIGMEV 120

Query: 124 YEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRL 183
            EF HLI     PQRSAFLS+FFALVG+HGLHV  GL+W+ +++++++K+G       RL
Sbjct: 121 NEFHHLILEGNGPQRSAFLSAFFALVGMHGLHVSAGLVWMAIMMLEVVKRGTGGRTLTRL 180

Query: 184 ICLSMFWHFLDLIWICVFSFVYLMGVV 210
            CLS+FWHFLD++WICVF+ VYLMGV+
Sbjct: 181 NCLSLFWHFLDIVWICVFTVVYLMGVL 207


>gi|114049400|ref|YP_739950.1| cytochrome c oxidase subunit III [Shewanella sp. MR-7]
 gi|113890842|gb|ABI44893.1| cytochrome c oxidase, subunit III [Shewanella sp. MR-7]
          Length = 206

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 94/182 (51%), Positives = 128/182 (70%), Gaps = 3/182 (1%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLM+DC++FA  F TYAVL  N   G +  D+F++  + + T  LLLSS++  
Sbjct: 27  TLFGFWLYLMTDCILFASVFATYAVLYMNTDGGVSGKDIFELDFVLIETAALLLSSITYG 86

Query: 90  FAML-ASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
           FA++ A    RL   T++WL +T   G +FI ME+YEF HLI     PQRSAFLSSFF L
Sbjct: 87  FALIFAKRHNRL--ATLTWLAITFALGCVFIGMEVYEFHHLIEHGNGPQRSAFLSSFFTL 144

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           VG+HGLHV  GLIW+ +++I++ K GL + +  RL CLS+FWHFLD++WICVF+ VYL+G
Sbjct: 145 VGMHGLHVTAGLIWMAIMMIEVAKTGLGNRSITRLSCLSLFWHFLDIVWICVFTVVYLLG 204

Query: 209 VV 210
            +
Sbjct: 205 AL 206


>gi|149189686|ref|ZP_01867968.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio shilonii AK1]
 gi|148836498|gb|EDL53453.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio shilonii AK1]
          Length = 199

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 126/186 (67%), Gaps = 2/186 (1%)

Query: 26  DH-DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLS 84
           DH D    GFWIYLMSDC++FA  F TYAVL  N   G    ++F++  +FV T++LLLS
Sbjct: 14  DHSDNKLFGFWIYLMSDCVLFATLFATYAVLASNPMTGSLARELFELPFVFVETMLLLLS 73

Query: 85  SLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSS 144
           S++  F M+A   + + +  + W+ VT   G+ FI ME+YEF HLI     PQ +AFLS+
Sbjct: 74  SITFGFGMIAMKRQDITNLKL-WMKVTFLLGLGFIGMEVYEFHHLIVEGYGPQTNAFLSA 132

Query: 145 FFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFV 204
           FF LVG HGLHV FGLIW+ V   Q+ KKGL S    R  CLS+FWHFLD++WICVF+ V
Sbjct: 133 FFTLVGTHGLHVTFGLIWMAVCYHQLSKKGLNSNMTMRFSCLSLFWHFLDIVWICVFTIV 192

Query: 205 YLMGVV 210
           YL+GV+
Sbjct: 193 YLLGVM 198


>gi|254264481|ref|ZP_04955346.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 1710a]
 gi|254215483|gb|EET04868.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 1710a]
          Length = 197

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 128/194 (65%), Gaps = 4/194 (2%)

Query: 20  KKESCVDHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            + +  DH  ++   GFW+YLM+DC++FA  F  +AV+   +A GP  +D+FDI G+ + 
Sbjct: 5   PRHAAHDHPPSHSVFGFWLYLMTDCVVFAALFAVFAVMAHQFAGGPTAVDLFDIPGVALE 64

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T +LL+SS++  FAM+ +   R       WL VT   G  F+ +E+ EF+ +I+  A PQ
Sbjct: 65  TALLLVSSITYGFAMIGAQRGRR-GALFGWLAVTFVLGAAFLGLELREFSQMIAEGAGPQ 123

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKK-GLISGNQRRLICLSMFWHFLDLI 196
           RSAFLSSFF LVG HGLHV  GL+W+ VL  Q L++  L   + RRL CLS+FWHFLD++
Sbjct: 124 RSAFLSSFFTLVGTHGLHVAIGLLWMAVLACQALRRPALTERDIRRLTCLSLFWHFLDIV 183

Query: 197 WICVFSFVYLMGVV 210
           WICV SFVYL  V+
Sbjct: 184 WICVSSFVYLASVI 197


>gi|295699446|ref|YP_003607339.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia sp.
           CCGE1002]
 gi|295438659|gb|ADG17828.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia sp.
           CCGE1002]
          Length = 201

 Score =  184 bits (467), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 132/190 (69%), Gaps = 8/190 (4%)

Query: 26  DHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLL 83
           DH  ++   GFW+YLM+DC++FA  F  +AV+ + +A GP+  D+F+I G+ + T +LLL
Sbjct: 15  DHVPSHSVFGFWVYLMTDCIIFAALFAVFAVMSQQFAGGPSGKDLFEIPGVALETTMLLL 74

Query: 84  SSLSCSFAMLASATKRLIHKTV--SWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAF 141
           SS++  FAML +   R   K V   WL VT   G  F+++E+ EF+H+I+  A P RSAF
Sbjct: 75  SSITYGFAMLGAHKNR---KGVLLGWLGVTFLLGFAFLVLEMREFSHMIAEGAGPSRSAF 131

Query: 142 LSSFFALVGLHGLHVFFGLIWLFVLVIQILK-KGLISGNQRRLICLSMFWHFLDLIWICV 200
           LSSFF LVG HGLHV FGLIW+ VL +Q+++ + L   +  RL CLS+FWHFLD++WI V
Sbjct: 132 LSSFFTLVGTHGLHVTFGLIWMVVLALQVMRHRDLTERDMIRLTCLSLFWHFLDVVWIGV 191

Query: 201 FSFVYLMGVV 210
           F+FVYL  V+
Sbjct: 192 FTFVYLASVI 201


>gi|260778347|ref|ZP_05887240.1| cytochrome O ubiquinol oxidase subunit III [Vibrio coralliilyticus
           ATCC BAA-450]
 gi|260606360|gb|EEX32645.1| cytochrome O ubiquinol oxidase subunit III [Vibrio coralliilyticus
           ATCC BAA-450]
          Length = 198

 Score =  184 bits (467), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 125/191 (65%), Gaps = 7/191 (3%)

Query: 26  DHD-----GTYL-GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTI 79
           DHD     G  L GFW+YLMSDC++FA  F TYAVL     +GP   D+F++  +FV T+
Sbjct: 9   DHDHHDTSGNKLFGFWVYLMSDCVLFATLFATYAVLESGSISGPTGKDIFELPFVFVETM 68

Query: 80  VLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS 139
           +LL SS++  F M+A   K  +     WL VT   G+ FI ME+YEF HLI+    PQ S
Sbjct: 69  LLLFSSITFGFGMIAMKRKD-VAGLKRWLQVTFLLGLGFIGMEVYEFHHLIAEGYGPQAS 127

Query: 140 AFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWIC 199
           AFLS+FF LVG HGLHV FGLIWL V   Q+  KGL      R  CLS+FWHFLD++WIC
Sbjct: 128 AFLSAFFTLVGTHGLHVTFGLIWLAVCYHQLSTKGLNDNMAMRFNCLSLFWHFLDIVWIC 187

Query: 200 VFSFVYLMGVV 210
           VF+ VYL+GV+
Sbjct: 188 VFTIVYLLGVM 198


>gi|153002718|ref|YP_001368399.1| cytochrome o ubiquinol oxidase subunit III [Shewanella baltica
           OS185]
 gi|151367336|gb|ABS10336.1| Cytochrome o ubiquinol oxidase subunit III [Shewanella baltica
           OS185]
          Length = 206

 Score =  184 bits (466), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 127/181 (70%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFWIYLM+DC++FA  F TYAVL  N   G +  D+F++  + + T  LL+SS++  
Sbjct: 27  TLFGFWIYLMTDCILFASVFATYAVLYMNTDGGVSGKDIFELDFVLIETAALLVSSITYG 86

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
            A++  A +     T++WLLVT   G +FI ME+YEF HLI     PQRSAFLSSFF LV
Sbjct: 87  MALI-FAKRHNKAATLAWLLVTFALGCVFIGMEVYEFHHLIEHGNGPQRSAFLSSFFTLV 145

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G+HGLHV  GLIW+ +++I++ K GL + +  RL CLS+FWHFLD++WICVF+ VYL+G 
Sbjct: 146 GMHGLHVTAGLIWMAIMMIEVAKTGLGNRSITRLSCLSLFWHFLDIVWICVFTVVYLLGA 205

Query: 210 V 210
           +
Sbjct: 206 L 206


>gi|304412073|ref|ZP_07393683.1| cytochrome o ubiquinol oxidase, subunit III [Shewanella baltica
           OS183]
 gi|307305968|ref|ZP_07585714.1| cytochrome o ubiquinol oxidase, subunit III [Shewanella baltica
           BA175]
 gi|304349623|gb|EFM14031.1| cytochrome o ubiquinol oxidase, subunit III [Shewanella baltica
           OS183]
 gi|306911461|gb|EFN41887.1| cytochrome o ubiquinol oxidase, subunit III [Shewanella baltica
           BA175]
          Length = 206

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 127/181 (70%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFWIYLM+DC++FA  F TYAVL  N   G +  D+F++  + + T  LL+SS++  
Sbjct: 27  TLFGFWIYLMTDCILFASVFATYAVLYMNTDGGVSGKDIFELDFVLIETAALLVSSITYG 86

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
            A++  A +     T++WLLVT   G +FI ME+YEF HLI     PQRSAFLSSFF LV
Sbjct: 87  MALI-FAKRHNKAATLAWLLVTFALGCVFIGMEVYEFHHLIEHGNGPQRSAFLSSFFTLV 145

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G+HGLHV  GLIW+ +++I++ K GL + +  RL CLS+FWHFLD++WICVF+ VYL+G 
Sbjct: 146 GMHGLHVTAGLIWMAIMMIEVAKTGLGNRSITRLSCLSLFWHFLDIVWICVFTVVYLLGA 205

Query: 210 V 210
           +
Sbjct: 206 L 206


>gi|117922464|ref|YP_871656.1| cytochrome c oxidase subunit III [Shewanella sp. ANA-3]
 gi|117614796|gb|ABK50250.1| cytochrome c oxidase, subunit III [Shewanella sp. ANA-3]
          Length = 206

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 92/181 (50%), Positives = 127/181 (70%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLM+DC++FA  F TYAVL  N   G +  D+F++  + + T  LLLSS++  
Sbjct: 27  TLFGFWLYLMTDCILFASVFATYAVLYMNTDGGVSGKDIFELDFVLIETAALLLSSITYG 86

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FA++  A +     T++WL +T   G +FI ME+YEF HLI     PQRSAFLSSFF LV
Sbjct: 87  FALIF-AKRHNKAATLTWLAITFALGCVFIGMEVYEFHHLIEHGNGPQRSAFLSSFFTLV 145

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G+HGLHV  GLIW+ +++I++ K GL + +  RL CLS+FWHFLD++WICVF+ VYL+G 
Sbjct: 146 GMHGLHVTAGLIWMAIMMIEVAKTGLGNRSITRLSCLSLFWHFLDIVWICVFTVVYLLGA 205

Query: 210 V 210
           +
Sbjct: 206 L 206


>gi|152994133|ref|YP_001338968.1| cytochrome o ubiquinol oxidase subunit III [Marinomonas sp. MWYL1]
 gi|150835057|gb|ABR69033.1| Cytochrome o ubiquinol oxidase subunit III [Marinomonas sp. MWYL1]
          Length = 203

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 123/178 (69%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLM+DCL+FA  F TYAVL  N A G +  D+F++  + V T +LL+SS++  FAM
Sbjct: 27  GFWLYLMTDCLLFATIFATYAVLFMNTAGGVSGKDIFELDFVLVETALLLVSSITYGFAM 86

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +  A K+    T+SWL VT   G  FI MEIYEF HLI     PQ SAFLS+FF LVG H
Sbjct: 87  IC-AHKKDKKGTMSWLSVTFLLGAGFIGMEIYEFHHLIVHGNGPQASAFLSAFFTLVGTH 145

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+ +L+I++   G  S    RL CLS+FWHFLD+IWICVF+ VYLMG +
Sbjct: 146 GLHVTAGLIWMAILMIELTVSGFGSRTVTRLSCLSLFWHFLDVIWICVFTVVYLMGAI 203


>gi|332290094|ref|YP_004420946.1| cytochrome o ubiquinol oxidase subunit III [Gallibacterium anatis
           UMN179]
 gi|330432990|gb|AEC18049.1| cytochrome o ubiquinol oxidase subunit III [Gallibacterium anatis
           UMN179]
          Length = 202

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 124/178 (69%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSD ++F+  F TY VL    A  P+  D+F++  + V T +LL SS++  FA+
Sbjct: 25  GFWIYLMSDLILFSCLFATYIVLLPGTAGAPSGKDIFELPYVLVETFLLLFSSITYGFAV 84

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           LA   +    + + WL+VT  FG  F+ MEI EF HLI+    P RS FLS FF LVG H
Sbjct: 85  LA-MNRNNAKQVLLWLVVTFLFGAAFVGMEINEFHHLIAQGVGPDRSGFLSGFFTLVGTH 143

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+ V++IQ++ +GL + N+ RL+CLS+FWHFLD++WICVFS VYLMGV+
Sbjct: 144 GLHVTAGLIWMVVMMIQVVTRGLSAVNRTRLMCLSLFWHFLDIVWICVFSVVYLMGVL 201


>gi|294143096|ref|YP_003559074.1| cytochrome o ubiquinol oxidase subunit III [Shewanella violacea
           DSS12]
 gi|7657997|dbj|BAA94866.1| quinol oxidase sybunit IV [Shewanella violacea]
 gi|293329565|dbj|BAJ04296.1| cytochrome o ubiquinol oxidase, subunit III [Shewanella violacea
           DSS12]
          Length = 207

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 92/197 (46%), Positives = 135/197 (68%), Gaps = 4/197 (2%)

Query: 17  VKDKKESCVDHD---GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISG 73
           V+  +     HD    T  GFW+YLM+DC++FA  F TYAVL  N   G +  D+F+++ 
Sbjct: 12  VQADEHHDEHHDTSGNTLFGFWLYLMTDCILFASVFATYAVLYMNTDGGVSGKDIFELNF 71

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           + + T VLL+SS++  FA++ +  ++    T+ WLL+T   G  FI ME+YEF HLI   
Sbjct: 72  VAIETAVLLISSITFGFALICAKHQKRT-ATLIWLLITFALGCGFISMEVYEFYHLIEQG 130

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
             PQRSAFL++FF LVG+HGLHV  GLIW+ ++++++ K GL + +  RL CLS+FWHFL
Sbjct: 131 NGPQRSAFLTAFFTLVGMHGLHVTAGLIWMAIMMLEVTKSGLNNRSITRLGCLSLFWHFL 190

Query: 194 DLIWICVFSFVYLMGVV 210
           D++WICVF+ VYL+G++
Sbjct: 191 DVVWICVFTLVYLLGML 207


>gi|262369761|ref|ZP_06063089.1| cytochrome o ubiquinol oxidase subunit III [Acinetobacter johnsonii
           SH046]
 gi|262315829|gb|EEY96868.1| cytochrome o ubiquinol oxidase subunit III [Acinetobacter johnsonii
           SH046]
          Length = 206

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 99/196 (50%), Positives = 130/196 (66%), Gaps = 4/196 (2%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVFDISGIFV 76
            D+     D D T  GFW YLMSD ++F   F+ +AVL  +   G P+  ++F  S  FV
Sbjct: 12  HDEHHQHDDTDITVFGFWTYLMSDLILFGTLFIAFAVLSSHVPMGTPSAKELFGESLGFV 71

Query: 77  --STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
              T  LL+SS++  FA+LA A K+ +++ ++WL +T  FG  FI ME+YEF HL+    
Sbjct: 72  LTETFALLISSVTFGFAVLA-AYKKNVNQVLTWLAITWLFGASFIGMELYEFNHLVHAGH 130

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            P  SAFLSSFF LVG HG+HV  GL+W+ +L+IQI K GL   N RRL CLS+FWHFLD
Sbjct: 131 GPSVSAFLSSFFTLVGTHGIHVTSGLVWMIILMIQIKKNGLTLPNTRRLACLSLFWHFLD 190

Query: 195 LIWICVFSFVYLMGVV 210
           ++WICVFS VYLMGV+
Sbjct: 191 IVWICVFSVVYLMGVL 206


>gi|120596926|ref|YP_961500.1| cytochrome c oxidase subunit III [Shewanella sp. W3-18-1]
 gi|217975291|ref|YP_002360042.1| cytochrome o ubiquinol oxidase subunit III [Shewanella baltica
           OS223]
 gi|120557019|gb|ABM22946.1| cytochrome c oxidase, subunit III [Shewanella sp. W3-18-1]
 gi|217500426|gb|ACK48619.1| cytochrome o ubiquinol oxidase, subunit III [Shewanella baltica
           OS223]
          Length = 206

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 126/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFWIYLM+DC++FA  F TYAVL  N   G +  D+F++  + + T  LL+SS++  
Sbjct: 27  TLFGFWIYLMTDCILFASVFATYAVLYMNTDGGVSGKDIFELDFVLIETAALLVSSITYG 86

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
            A++  A +     T++WLLVT   G +FI ME+YEF HLI     PQRSAFLSSFF LV
Sbjct: 87  MALI-FAKRHNKAATLAWLLVTFALGCVFIGMEVYEFHHLIEHGNGPQRSAFLSSFFTLV 145

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G+HGLHV  GLIW+ +++I++ K GL   +  RL CLS+FWHFLD++WICVF+ VYL+G 
Sbjct: 146 GMHGLHVTAGLIWMAIMMIEVAKTGLGHRSITRLSCLSLFWHFLDIVWICVFTVVYLLGA 205

Query: 210 V 210
           +
Sbjct: 206 L 206


>gi|113972152|ref|YP_735945.1| cytochrome c oxidase subunit III [Shewanella sp. MR-4]
 gi|113886836|gb|ABI40888.1| cytochrome c oxidase, subunit III [Shewanella sp. MR-4]
          Length = 206

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 92/181 (50%), Positives = 127/181 (70%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLM+DC++FA  F TYAVL  N   G +  D+F++  + + T  LLLSS++  
Sbjct: 27  TLFGFWLYLMTDCILFASVFATYAVLYMNTDGGVSGKDIFELDFVLIETAALLLSSITYG 86

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FA++  A +     T++WL +T   G +FI ME+YEF HLI     PQRSAFLSSFF LV
Sbjct: 87  FALIF-AKRHNKAATLTWLAITFALGCVFIGMEVYEFHHLIEHGNGPQRSAFLSSFFTLV 145

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G+HGLHV  GLIW+ +++I++ K GL + +  RL CLS+FWHFLD++WICVF+ VYL+G 
Sbjct: 146 GMHGLHVTAGLIWMAIMMIEVGKTGLGNRSITRLSCLSLFWHFLDIVWICVFTVVYLLGA 205

Query: 210 V 210
           +
Sbjct: 206 L 206


>gi|330821326|ref|YP_004350188.1| Cytochrome c oxidase subunit III [Burkholderia gladioli BSR3]
 gi|327373321|gb|AEA64676.1| Cytochrome c oxidase subunit III [Burkholderia gladioli BSR3]
          Length = 203

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 93/179 (51%), Positives = 119/179 (66%), Gaps = 2/179 (1%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLM+DC++F   F  +AV+   +A GP   D+FDI G+ + T  LLLSS++  FAM
Sbjct: 26  GFWLYLMTDCILFGSLFAVFAVMQHQFAGGPTAKDLFDIPGVALETAALLLSSITYGFAM 85

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +  A +        WL VT   G  F+ MEI EFAHLI   A P RSAFLSSFF LV  H
Sbjct: 86  IG-AHRNNRGAVFGWLAVTFILGASFLFMEIREFAHLIEEGAGPGRSAFLSSFFTLVATH 144

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQ-RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  G+IW+ VL+ QI +   +S    RRL CLS+FWHFLD++WICVF+FVYL+ V+
Sbjct: 145 GLHVTMGMIWMVVLLFQIARNPQLSEQDIRRLTCLSLFWHFLDIVWICVFTFVYLVSVI 203


>gi|269964140|ref|ZP_06178437.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269831095|gb|EEZ85257.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 199

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 118/178 (66%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++FA  F TYAVL     AGP   D+F++  +FV T++LL SS++  F M
Sbjct: 23  GFWIYLMSDCVLFATLFATYAVLESGSIAGPTGKDIFELPFVFVETMLLLFSSITFGFGM 82

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K  +     WL VT   G  FI ME+YEF HLI     PQ SAFLS+FF LVG H
Sbjct: 83  IAMKLKD-VAGLKRWLKVTFLLGAGFIGMEVYEFHHLIVEGYGPQESAFLSAFFTLVGTH 141

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV FGLIWL V   Q+  KGL      R  CLS+FWHFLD++WICVF+ VYL+GV+
Sbjct: 142 GLHVTFGLIWLAVCYHQLSTKGLNDNMSMRFQCLSLFWHFLDIVWICVFTIVYLLGVM 199


>gi|187919714|ref|YP_001888745.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           phytofirmans PsJN]
 gi|187718152|gb|ACD19375.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia
           phytofirmans PsJN]
          Length = 201

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 94/181 (51%), Positives = 127/181 (70%), Gaps = 6/181 (3%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLM+DC++FA  F  +AV+G  +A GP+  D+F+I G+ + T +LLLSS++  FAM
Sbjct: 24  GFWLYLMTDCIIFAALFAVFAVMGHQFAGGPSGKDLFEIPGVALETTMLLLSSITYGFAM 83

Query: 93  LASATKRLIHKTVS--WLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVG 150
           L +   R   K V   WL VT   G+ F+++E+ EF+HLI+  A P RSAFLSSFF LVG
Sbjct: 84  LGAHKNR---KGVLLFWLGVTFLLGLAFLVLELREFSHLIAEGAGPSRSAFLSSFFTLVG 140

Query: 151 LHGLHVFFGLIWLFVLVIQILK-KGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
            HGLHV  GLIW+ VL IQ++  + L   +  RL CLS+FWHFLD++WI VF+FVYL  V
Sbjct: 141 THGLHVTCGLIWMVVLAIQVISHRDLTERDMIRLTCLSLFWHFLDVVWIGVFTFVYLASV 200

Query: 210 V 210
           +
Sbjct: 201 I 201


>gi|146294941|ref|YP_001185365.1| cytochrome c oxidase subunit III [Shewanella putrefaciens CN-32]
 gi|145566631|gb|ABP77566.1| cytochrome c oxidase, subunit III [Shewanella putrefaciens CN-32]
          Length = 206

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 126/182 (69%), Gaps = 1/182 (0%)

Query: 29  GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSC 88
            T  GFWIYLM+DC++FA  F TYAVL  N   G +  D+F++  + + T  LL+SS++ 
Sbjct: 26  NTLFGFWIYLMTDCILFASVFATYAVLYMNTDGGVSGKDIFELDFVLIETAALLVSSITY 85

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
             A++  A +     T++WLLVT   G +FI ME+YEF HLI     PQRSAFLSSFF L
Sbjct: 86  GMALIF-AKRHNKAATLTWLLVTFALGCVFIGMEVYEFHHLIEHGNGPQRSAFLSSFFTL 144

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           VG+HGLHV  GLIW+ +++I++ K GL   +  RL CLS+FWHFLD++WICVF+ VYL+G
Sbjct: 145 VGMHGLHVTAGLIWMAIMMIEVAKTGLGHRSITRLSCLSLFWHFLDIVWICVFTVVYLLG 204

Query: 209 VV 210
            +
Sbjct: 205 AL 206


>gi|270263563|ref|ZP_06191832.1| hypothetical protein SOD_e01870 [Serratia odorifera 4Rx13]
 gi|270042447|gb|EFA15542.1| hypothetical protein SOD_e01870 [Serratia odorifera 4Rx13]
          Length = 172

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 121/172 (70%), Gaps = 1/172 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           MSDC++FA  F TYAVL    A GP+  D+FD+  + V T +LL SS++   AM+    K
Sbjct: 1   MSDCILFASLFATYAVLVNGTAGGPSGKDIFDLKFVLVETFLLLFSSITYGMAMIG-MNK 59

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
             +    +WL +T  FG+ F+ MEIYEF HLI+    P RSAFLS FFALV  HGLHV  
Sbjct: 60  GKVGSVNTWLFLTFLFGLGFVAMEIYEFHHLIAEGFGPDRSAFLSGFFALVATHGLHVST 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GL+W+ +++IQ+ K+GL S N+ RL+CLS+FWHFLD++WICVF+ VYL+GV+
Sbjct: 120 GLVWIIIMMIQVSKRGLTSTNKTRLMCLSLFWHFLDVVWICVFTVVYLLGVM 171


>gi|70732358|ref|YP_262114.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas fluorescens
           Pf-5]
 gi|68346657|gb|AAY94263.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas
           fluorescens Pf-5]
          Length = 208

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 123/183 (67%), Gaps = 5/183 (2%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLM+DC++FA  F  YAVL  N A GP+  D+F++  +   T +LL SS++  
Sbjct: 29  TVFGFWLYLMTDCILFASIFAVYAVLVNNVAGGPSGHDIFELPYVLGETALLLFSSITYG 88

Query: 90  FAMLA--SATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
           FAMLA     K+   + + WL +T  FG+ FI MEI EF  LIS    P RS FLS FF 
Sbjct: 89  FAMLAFFRGNKK---QVLGWLAMTFLFGLGFIGMEINEFHLLISEGYGPSRSGFLSGFFT 145

Query: 148 LVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           LVG HGLHV  GLIW+ +++ Q+ K GL + N+ RL CLS+FWHFLD++WICVF+ VYLM
Sbjct: 146 LVGTHGLHVTSGLIWMAIMMYQVQKNGLTATNKTRLSCLSLFWHFLDVVWICVFTVVYLM 205

Query: 208 GVV 210
           G +
Sbjct: 206 GTM 208


>gi|229592522|ref|YP_002874641.1| cytochrome C oxidase (ubiquinol oxidase) subunit III [Pseudomonas
           fluorescens SBW25]
 gi|229364388|emb|CAY52170.1| cytochrome C oxidase (ubiquinol oxidase) subunit III [Pseudomonas
           fluorescens SBW25]
          Length = 208

 Score =  182 bits (462), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 95/183 (51%), Positives = 124/183 (67%), Gaps = 5/183 (2%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLM+DC++FA  F  YAVL  N A GP+  D+F++  +   T +LL SS++  
Sbjct: 29  TVFGFWLYLMTDCILFASIFAVYAVLVNNVAGGPSGHDIFELPYVLGETALLLFSSITYG 88

Query: 90  FAMLA--SATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
           FAMLA     K+     +SWL +T  FG+ FI MEI EF  LIS    P RS FLS+FF 
Sbjct: 89  FAMLAFYKGNKK---GVLSWLALTFLFGLGFIGMEINEFHLLISEGYGPHRSGFLSAFFT 145

Query: 148 LVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           LVG HGLHV  GL+W+ V++ Q+ K GL + N+ RL CLS+FWHFLD++WICVF+ VYLM
Sbjct: 146 LVGTHGLHVTAGLLWMAVMMYQVNKHGLTNTNKTRLSCLSLFWHFLDVVWICVFTVVYLM 205

Query: 208 GVV 210
           G +
Sbjct: 206 GTL 208


>gi|323191348|gb|EFZ76611.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           RN587/1]
          Length = 171

 Score =  182 bits (462), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 91/170 (53%), Positives = 120/170 (70%), Gaps = 1/170 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           MSDC++F++ F TYAVL    A GP   D+F++  + V T +LL SS++   A +A   K
Sbjct: 1   MSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIA-MYK 59

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
             + + +SWL +T  FG  FI MEIYEF HLI     P RS FLS+FFALVG HGLHV  
Sbjct: 60  NNVSQVISWLTLTWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTS 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           GLIW+ VL++QI ++GL S N+ R++CLS+FWHFLD++WICVF+ VYLMG
Sbjct: 120 GLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMG 169


>gi|296156345|ref|ZP_06839184.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia sp.
           Ch1-1]
 gi|295893851|gb|EFG73630.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia sp.
           Ch1-1]
          Length = 201

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 97/213 (45%), Positives = 137/213 (64%), Gaps = 15/213 (7%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           M ++ I   P+ +  +V            +  GFW+YLM+DC++FA  F  +AV+G  +A
Sbjct: 1   MLQKTIAVQPHLAPDHVPSH---------SVFGFWLYLMTDCVIFAALFAVFAVMGHQFA 51

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVS--WLLVTAFFGMIF 118
            GP+  D+F+I G+ + T +LLLSS++  FAML +   R   K V   WL VT   G+ F
Sbjct: 52  GGPSGKDLFEIPGVALETTMLLLSSITYGFAMLGAHKNR---KGVLLFWLAVTFLLGLAF 108

Query: 119 IIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILK-KGLIS 177
           + +E+ EF+HLI+  A P RSAFLSSFF LVG HGLHV  GLIW+ VL +Q+++ + L  
Sbjct: 109 LTLEMREFSHLIAEGAGPGRSAFLSSFFTLVGTHGLHVTCGLIWMVVLAVQVMRHRDLTE 168

Query: 178 GNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
            +  RL CLS+FWHFLD++WI VF+FVYL  V+
Sbjct: 169 RDMIRLTCLSLFWHFLDVVWIGVFTFVYLASVI 201


>gi|28868535|ref|NP_791154.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|213968331|ref|ZP_03396475.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. tomato T1]
 gi|301383463|ref|ZP_07231881.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. tomato Max13]
 gi|302060280|ref|ZP_07251821.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. tomato K40]
 gi|302129917|ref|ZP_07255907.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. tomato NCPPB 1108]
 gi|28851773|gb|AAO54849.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|213926969|gb|EEB60520.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. tomato T1]
 gi|331015176|gb|EGH95232.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. lachrymans str. M302278PT]
          Length = 210

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 125/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLM+DC++FA FF  YAV+  + A GP+  D+F +  + V T  LL+SS++  
Sbjct: 31  TVYGFWLYLMTDCVLFASFFAVYAVMVNSVAGGPSGQDIFLLPFVAVETAFLLVSSITYG 90

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAMLA   K    + + WL +T   G  FI MEIYEF HLI     P RS FLS+FFALV
Sbjct: 91  FAMLA-LYKGKKSQVLGWLALTFLCGAAFIGMEIYEFHHLIHEGYGPSRSGFLSAFFALV 149

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           GLHG+HV  GLIW+ +++ Q+ KKGL + N+ RL CLS+FWHFLD++WI VF+ VYLMG 
Sbjct: 150 GLHGVHVTSGLIWMAIMMFQVQKKGLTNTNKTRLSCLSLFWHFLDVVWIGVFTVVYLMGA 209

Query: 210 V 210
           +
Sbjct: 210 L 210


>gi|91778472|ref|YP_553680.1| CyoC [Burkholderia xenovorans LB400]
 gi|91691132|gb|ABE34330.1| cytochrome bo3 quinol oxidase subunit 3 [Burkholderia xenovorans
           LB400]
          Length = 201

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 97/213 (45%), Positives = 137/213 (64%), Gaps = 15/213 (7%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           M ++ I   P+ +  +V            +  GFW+YLM+DC++FA  F  +AV+G  +A
Sbjct: 1   MLQKTIAVQPHLAPDHVPSH---------SVFGFWLYLMTDCVIFAALFAVFAVMGHQFA 51

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVS--WLLVTAFFGMIF 118
            GP+  D+F+I G+ + T +LLLSS++  FAML +   R   K V   WL VT   G+ F
Sbjct: 52  GGPSGKDLFEIPGVALETTMLLLSSITYGFAMLGAHRNR---KGVLLFWLAVTFLLGLAF 108

Query: 119 IIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILK-KGLIS 177
           + +E+ EF+HLI+  A P RSAFLSSFF LVG HGLHV  GLIW+ VL +Q+++ + L  
Sbjct: 109 LTLEMREFSHLIAEGAGPGRSAFLSSFFTLVGTHGLHVTCGLIWMVVLAVQVMRHRDLTE 168

Query: 178 GNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
            +  RL CLS+FWHFLD++WI VF+FVYL  V+
Sbjct: 169 RDMIRLTCLSLFWHFLDVVWIGVFTFVYLASVI 201


>gi|238754226|ref|ZP_04615583.1| Cytochrome o ubiquinol oxidase subunit 3 [Yersinia ruckeri ATCC
           29473]
 gi|238707473|gb|EEP99833.1| Cytochrome o ubiquinol oxidase subunit 3 [Yersinia ruckeri ATCC
           29473]
          Length = 171

 Score =  181 bits (460), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 91/170 (53%), Positives = 119/170 (70%), Gaps = 1/170 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           MSDC++FA  F TYAVL    A GP   D+FD++ + V T +LL SS++   AML    K
Sbjct: 1   MSDCILFATLFATYAVLVNGTAGGPTGKDIFDLNFVLVETFLLLFSSITYGVAMLG-MNK 59

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
              ++   WL +T  FG+ F+ MEIYEF HLI+    P RSAFLSSFFALV  HGLHV  
Sbjct: 60  GNKNQVNIWLGMTFLFGLGFVAMEIYEFHHLIAEGYGPDRSAFLSSFFALVATHGLHVTT 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           GL+W+ +++IQ+ K+GL   NQ RL+CLS+FWHFLD++WICVF+ VYL+G
Sbjct: 120 GLVWIIIMMIQVAKRGLNPTNQTRLMCLSLFWHFLDVVWICVFTVVYLLG 169


>gi|238791423|ref|ZP_04635061.1| Cytochrome o ubiquinol oxidase subunit 3 [Yersinia intermedia ATCC
           29909]
 gi|238729039|gb|EEQ20555.1| Cytochrome o ubiquinol oxidase subunit 3 [Yersinia intermedia ATCC
           29909]
          Length = 171

 Score =  181 bits (460), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 89/172 (51%), Positives = 122/172 (70%), Gaps = 1/172 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           MSDC++FA  F TYAVL    A GP+  D+FD++ + V T +LL SS++   AML    K
Sbjct: 1   MSDCILFATLFATYAVLVNGTAGGPSGRDIFDLNFVLVETFLLLFSSITYGIAMLG-MNK 59

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
              ++  +WL +T  FG+ F+ MEIYEF HLI+    P RSAFLSSFFALV  HG+HV  
Sbjct: 60  GHKNQVNTWLGLTFLFGLGFVAMEIYEFHHLIAEGYGPDRSAFLSSFFALVATHGIHVTT 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GL+W+ +++IQ+ K+GL   N+ RL+CLS+FWHFLD++WICVF+ VYL+G +
Sbjct: 120 GLVWIIIMMIQVAKRGLNETNRTRLMCLSLFWHFLDVVWICVFTVVYLLGAM 171


>gi|66044394|ref|YP_234235.1| cytochrome c oxidase, subunit III [Pseudomonas syringae pv.
           syringae B728a]
 gi|63255101|gb|AAY36197.1| Cytochrome c oxidase, subunit III [Pseudomonas syringae pv.
           syringae B728a]
          Length = 210

 Score =  181 bits (460), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 124/181 (68%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLM+DC++FA FF  YAV+  + A GP+  D+F +  + V T  LL+SS++  
Sbjct: 31  TVYGFWLYLMTDCVLFASFFAVYAVMVNSVAGGPSGQDIFLLPFVAVETAFLLVSSITYG 90

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAMLA   K    + + WL +T   G  FI MEIYEF HLI     P RS FLS+FFALV
Sbjct: 91  FAMLA-LYKGNKSQVLGWLALTFLCGAAFIGMEIYEFHHLIEEGYGPSRSGFLSAFFALV 149

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           GLHG HV  GLIW+ +++ Q+ KKGL + N+ RL CLS+FWHFLD++WI VF+ VYLMG 
Sbjct: 150 GLHGAHVTSGLIWMAIMMFQVQKKGLTNTNKTRLSCLSLFWHFLDVVWIGVFTVVYLMGA 209

Query: 210 V 210
           +
Sbjct: 210 L 210


>gi|330811630|ref|YP_004356092.1| cytochrome o subunit III [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327379738|gb|AEA71088.1| Cytochrome o subunit III [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 208

 Score =  181 bits (460), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 121/181 (66%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLM+DC++FA  F  YAVL  N A GP+  D+F++  +   T +LL SS++  
Sbjct: 29  TVFGFWLYLMTDCILFASIFAAYAVLVNNVAGGPSGHDIFELPYVLGETALLLFSSITYG 88

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAMLA    +   + + WL +T  FG  FI MEI EF  LIS    P RS FLS FF LV
Sbjct: 89  FAMLALFKGKKT-QVLGWLAMTFLFGAGFIGMEINEFHMLISEGYGPNRSGFLSGFFTLV 147

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GLIW+ +++ Q+ K GL + N+ RL CLS+FWHFLD++WICVF+ VYLMG 
Sbjct: 148 GTHGLHVTSGLIWMAIMMYQVQKNGLTATNKTRLSCLSLFWHFLDVVWICVFTVVYLMGT 207

Query: 210 V 210
           +
Sbjct: 208 L 208


>gi|312962954|ref|ZP_07777440.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas
           fluorescens WH6]
 gi|311282723|gb|EFQ61318.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas
           fluorescens WH6]
          Length = 208

 Score =  181 bits (460), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 95/183 (51%), Positives = 124/183 (67%), Gaps = 5/183 (2%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLM+DC++FA  F  YAVL  N A GP+  D+F++  +   T +LL SS++  
Sbjct: 29  TVFGFWLYLMTDCILFASIFAVYAVLVNNVAGGPSGHDIFELPYVLGETALLLFSSITYG 88

Query: 90  FAMLA--SATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
           FAMLA     K+     +SWL +T  FG+ FI MEI EF  LIS    P RS FLS+FF 
Sbjct: 89  FAMLAFYKGNKK---GVLSWLGLTFLFGLGFIGMEINEFHLLISEGYGPHRSGFLSAFFT 145

Query: 148 LVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           LVG HGLHV  GL+W+ V++ Q+ K GL + N+ RL CLS+FWHFLD++WICVF+ VYLM
Sbjct: 146 LVGTHGLHVSAGLLWMAVMMYQVNKHGLTNTNKTRLSCLSLFWHFLDVVWICVFTVVYLM 205

Query: 208 GVV 210
           G +
Sbjct: 206 GTL 208


>gi|238759270|ref|ZP_04620437.1| Cytochrome o ubiquinol oxidase subunit 3 [Yersinia aldovae ATCC
           35236]
 gi|238765441|ref|ZP_04626362.1| Cytochrome o ubiquinol oxidase subunit 3 [Yersinia kristensenii
           ATCC 33638]
 gi|238696335|gb|EEP89131.1| Cytochrome o ubiquinol oxidase subunit 3 [Yersinia kristensenii
           ATCC 33638]
 gi|238702557|gb|EEP95107.1| Cytochrome o ubiquinol oxidase subunit 3 [Yersinia aldovae ATCC
           35236]
          Length = 171

 Score =  181 bits (460), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 89/172 (51%), Positives = 122/172 (70%), Gaps = 1/172 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           MSDC++FA  F TYAVL    A GP+  D+FD++ + V T +LL SS++   AML    K
Sbjct: 1   MSDCILFATLFATYAVLVNGTAGGPSGRDIFDLNFVLVETFLLLFSSITYGIAMLG-MNK 59

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
              ++  +WL +T  FG+ F+ MEIYEF HLI+    P RSAFLSSFFALV  HG+HV  
Sbjct: 60  GHKNQVNTWLGLTFLFGLGFVAMEIYEFHHLIAEGYGPDRSAFLSSFFALVATHGIHVTA 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GL+W+ +++IQ+ K+GL   N+ RL+CLS+FWHFLD++WICVF+ VYL+G +
Sbjct: 120 GLVWIIIMMIQVAKRGLNETNRTRLMCLSLFWHFLDVVWICVFTVVYLLGAM 171


>gi|257487315|ref|ZP_05641356.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. tabaci ATCC 11528]
 gi|289623937|ref|ZP_06456891.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. aesculi str. NCPPB3681]
 gi|289646771|ref|ZP_06478114.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. aesculi str. 2250]
 gi|298485879|ref|ZP_07003955.1| Cytochrome O ubiquinol oxidase subunit III [Pseudomonas savastanoi
           pv. savastanoi NCPPB 3335]
 gi|298159568|gb|EFI00613.1| Cytochrome O ubiquinol oxidase subunit III [Pseudomonas savastanoi
           pv. savastanoi NCPPB 3335]
          Length = 210

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 124/181 (68%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLM+DC++FA FF  YAV+  + A GP+  D+F +  + V T  LL+SS++  
Sbjct: 31  TVYGFWLYLMTDCVLFASFFAVYAVMVNSVAGGPSGQDIFLLPFVAVETAFLLVSSITYG 90

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAMLA   K    + + WL +T   G  FI MEIYEF HLI     P RS FLS+FFALV
Sbjct: 91  FAMLA-LYKGKKSQVLGWLALTFLCGAAFIGMEIYEFHHLIHEGYGPSRSGFLSAFFALV 149

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           GLHG HV  GLIW+ +++ Q+ KKGL + N+ RL CLS+FWHFLD++WI VF+ VYLMG 
Sbjct: 150 GLHGAHVTSGLIWMAIMMFQVQKKGLTNTNKTRLSCLSLFWHFLDVVWIGVFTVVYLMGA 209

Query: 210 V 210
           +
Sbjct: 210 L 210


>gi|289678124|ref|ZP_06499014.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. syringae FF5]
          Length = 210

 Score =  181 bits (459), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 94/181 (51%), Positives = 125/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLM+DC++FA FF  YAV+  + A GP+  D+F +  + V T  LL+SS++  
Sbjct: 31  TVYGFWLYLMTDCVLFASFFAVYAVMVNSVAGGPSGQDIFLLPFVAVETAFLLVSSITYG 90

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAMLA   K    + + WL +T   G  FI ME+YEF HLI     P RS FLS+FFALV
Sbjct: 91  FAMLA-LYKGNKSQVLGWLALTFLCGAAFIGMEVYEFHHLIEEGFGPSRSGFLSAFFALV 149

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           GLHG+HV  GLIW+ +++ Q+ KKGL + N+ RL CLS+FWHFLD++WI VF+ VYLMG 
Sbjct: 150 GLHGVHVTSGLIWMAIMMFQVQKKGLTNTNKTRLSCLSLFWHFLDVVWIGVFTVVYLMGA 209

Query: 210 V 210
           +
Sbjct: 210 L 210


>gi|282891621|ref|ZP_06300110.1| hypothetical protein pah_c186o005 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281498484|gb|EFB40814.1| hypothetical protein pah_c186o005 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 198

 Score =  181 bits (459), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 130/198 (65%), Gaps = 3/198 (1%)

Query: 13  SLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
           SLF+  + +     +  T LGFWIYLM+DC++F   F TYAVL      GP+  D+F +S
Sbjct: 4   SLFHSAEFEHET--YSRTVLGFWIYLMTDCILFTSLFTTYAVLHTETFGGPSSRDLFSLS 61

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
             F  T++LL SS++C  AML+S   +  H  + WL+VT   G  FI +E++EFA L+  
Sbjct: 62  TAFSETMILLSSSVTCGLAMLSSLQNKKNH-VIGWLIVTFLLGASFIALELHEFASLVHE 120

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
               QRSAFLSSFF LVG HGLHV  GLIW+ V+++Q+    + +   RRL+  SM+WHF
Sbjct: 121 GNSWQRSAFLSSFFTLVGTHGLHVSIGLIWMLVMILQLYFHDITTITFRRLVIFSMYWHF 180

Query: 193 LDLIWICVFSFVYLMGVV 210
           LDL+WI +F+FVYL+GV+
Sbjct: 181 LDLVWIFIFTFVYLLGVI 198


>gi|160877454|ref|YP_001556770.1| cytochrome o ubiquinol oxidase subunit III [Shewanella baltica
           OS195]
 gi|160862976|gb|ABX51510.1| cytochrome o ubiquinol oxidase, subunit III [Shewanella baltica
           OS195]
 gi|315269656|gb|ADT96509.1| cytochrome o ubiquinol oxidase, subunit III [Shewanella baltica
           OS678]
          Length = 206

 Score =  181 bits (459), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 126/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFWIYLM+DC++FA  F TYAVL  N   G +  D+F++  + + T  LL+SS++  
Sbjct: 27  TLFGFWIYLMTDCILFASVFATYAVLYMNTDGGVSGKDIFELDFVLIETAALLVSSITYG 86

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
            A++  A +     T++WL +T   G +FI ME+YEF HLI     PQRSAFLSSFF LV
Sbjct: 87  MALIF-AKRHNKAATLTWLAITFALGCVFIGMEVYEFHHLIEHGNGPQRSAFLSSFFTLV 145

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G+HGLHV  GLIW+ +++I++ K GL + +  RL CLS+FWHFLD++WICVF+ VYL+G 
Sbjct: 146 GMHGLHVTAGLIWMAIMMIEVAKTGLGNRSITRLSCLSLFWHFLDIVWICVFTVVYLLGA 205

Query: 210 V 210
           +
Sbjct: 206 L 206


>gi|320173752|gb|EFW48935.1| Cytochrome O ubiquinol oxidase subunit III [Shigella dysenteriae
           CDC 74-1112]
 gi|332098473|gb|EGJ03439.1| cytochrome o ubiquinol oxidase, subunit III [Shigella boydii
           3594-74]
          Length = 171

 Score =  181 bits (459), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 91/170 (53%), Positives = 119/170 (70%), Gaps = 1/170 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           MSDC++F++ F TYAVL    A GP   D+F++  + V T +LL SS++   A +A   K
Sbjct: 1   MSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIA-MYK 59

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
               + +SWL +T  FG  FI MEIYEF HLI     P RS FLS+FFALVG HGLHV  
Sbjct: 60  NNKSQVISWLALTCLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTS 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           GLIW+ VL++QI ++GL S N+ R++CLS+FWHFLD++WICVF+ VYLMG
Sbjct: 120 GLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMG 169


>gi|186470620|ref|YP_001861938.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia phymatum
           STM815]
 gi|184196929|gb|ACC74892.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia phymatum
           STM815]
          Length = 204

 Score =  181 bits (459), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 122/201 (60%), Gaps = 1/201 (0%)

Query: 6   IGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAP 65
           +  +P ++     D +    D   T LGFWIYLMSDCL+FA  F T+ VL    A GPA 
Sbjct: 1   MANTPTYAAAAHHDARGHHDDGTRTTLGFWIYLMSDCLIFATLFATFGVLANATAGGPAG 60

Query: 66  IDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYE 125
             +F++  +   T++LL SS +    ML+    R     + WL VT   G  FI ME+YE
Sbjct: 61  RQLFELPYVLGETLLLLASSFTFGMGMLSVYANRR-GTVIGWLAVTFVLGAAFIGMEVYE 119

Query: 126 FAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLIC 185
           FA L S  A P  SAFLS +F LVG HGLHV  GL+W+ V++ QI + GL    +RR+ C
Sbjct: 120 FAKLASDGAGPSTSAFLSGYFTLVGTHGLHVTTGLLWIGVMMHQIGRFGLTPVTRRRIAC 179

Query: 186 LSMFWHFLDLIWICVFSFVYL 206
           LS+FWHFLDL+WICVFS VYL
Sbjct: 180 LSLFWHFLDLVWICVFSLVYL 200


>gi|302186054|ref|ZP_07262727.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. syringae 642]
          Length = 210

 Score =  181 bits (458), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 94/181 (51%), Positives = 125/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLM+DC++FA FF  YAV+  + A GP+  D+F +  + V T  LL+SS++  
Sbjct: 31  TVYGFWLYLMTDCVLFASFFAVYAVMVNSVAGGPSGQDIFLLPFVAVETAFLLVSSITYG 90

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAMLA   K    + + WL +T   G  FI ME+YEF HLI     P RS FLS+FFALV
Sbjct: 91  FAMLA-LYKGNKSQVLGWLALTFLCGAAFIGMEVYEFHHLIHEGYGPSRSGFLSAFFALV 149

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           GLHG+HV  GLIW+ +++ Q+ KKGL + N+ RL CLS+FWHFLD++WI VF+ VYLMG 
Sbjct: 150 GLHGVHVTSGLIWMAIMMFQVQKKGLTNTNKTRLSCLSLFWHFLDVVWIGVFTVVYLMGA 209

Query: 210 V 210
           +
Sbjct: 210 L 210


>gi|330819564|ref|YP_004348426.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia gladioli
           BSR3]
 gi|327371559|gb|AEA62914.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia gladioli
           BSR3]
          Length = 201

 Score =  181 bits (458), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 124/182 (68%), Gaps = 3/182 (1%)

Query: 26  DHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS 85
           D   T +GFWIYLMSDCL+FA  F T+ VL    A GP    +F++  +   T++LL+SS
Sbjct: 18  DGGKTTVGFWIYLMSDCLIFATLFATFGVLANATAGGPTGQGLFELDYVLGETMLLLVSS 77

Query: 86  LSCSFAMLA-SATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSS 144
            +   AMLA +A +R     ++WL +T  FG  FI ME++EFA L++  A P  SAFLS+
Sbjct: 78  FTFGLAMLAMNAGRR--GAVIAWLAITFVFGAGFIGMEVHEFAKLVADGAGPHTSAFLSA 135

Query: 145 FFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFV 204
           +F LVG HGLHV  GL+W+ V++ Q+ K GL    QRRL CLSMFWHFLDL+WICVF+FV
Sbjct: 136 YFGLVGTHGLHVTCGLLWIGVMMHQVWKFGLNGMVQRRLACLSMFWHFLDLVWICVFTFV 195

Query: 205 YL 206
           YL
Sbjct: 196 YL 197


>gi|238795550|ref|ZP_04639065.1| Cytochrome o ubiquinol oxidase subunit 3 [Yersinia mollaretii ATCC
           43969]
 gi|238720669|gb|EEQ12470.1| Cytochrome o ubiquinol oxidase subunit 3 [Yersinia mollaretii ATCC
           43969]
          Length = 171

 Score =  181 bits (458), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 89/172 (51%), Positives = 122/172 (70%), Gaps = 1/172 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           MSDC++FA  F TYAVL    A GP+  D+FD++ + V T +LL SS++   AML    K
Sbjct: 1   MSDCILFATLFATYAVLVNGTAGGPSGKDIFDLNFVLVETFLLLFSSITYGIAMLG-MNK 59

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
              ++  +WL +T  FG+ F+ MEIYEF HLI+    P RSAFLSSFFALV  HG+HV  
Sbjct: 60  GHKNQVNTWLGLTFLFGLGFVAMEIYEFHHLIAEGYGPDRSAFLSSFFALVATHGIHVTA 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GL+W+ +++IQ+ K+GL   N+ RL+CLS+FWHFLD++WICVF+ VYL+G +
Sbjct: 120 GLVWIIIMMIQVAKRGLNEMNRTRLMCLSLFWHFLDVVWICVFTVVYLLGAM 171


>gi|313497177|gb|ADR58543.1| CyoC [Pseudomonas putida BIRD-1]
          Length = 202

 Score =  181 bits (458), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 127/181 (70%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T LGFW+YLM+DC++FA  F TYAVL  ++A GP+  D+F +  + V T++LLLSS++  
Sbjct: 23  TVLGFWLYLMTDCILFASLFATYAVLSGSFAGGPSGHDIFQLDFVAVETLLLLLSSITFG 82

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAML     +     + WL VT  FG  FI MEIYEF HLIS    PQRS FLS FFALV
Sbjct: 83  FAMLKMFDGKKA-GVLGWLAVTFLFGAGFIAMEIYEFHHLISEGFGPQRSGFLSGFFALV 141

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GLIW+ +++ QI K G+    + R+ CLS+FWHFLD++WICVF+ VYL+GV
Sbjct: 142 GTHGLHVTAGLIWMAIMMYQINKHGITPTAKTRMSCLSLFWHFLDVVWICVFTVVYLLGV 201

Query: 210 V 210
           +
Sbjct: 202 L 202


>gi|71734182|ref|YP_273478.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|71554735|gb|AAZ33946.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|320323023|gb|EFW79113.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. glycinea str. B076]
 gi|320329854|gb|EFW85842.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. glycinea str. race 4]
          Length = 208

 Score =  181 bits (458), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 124/181 (68%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLM+DC++FA FF  YAV+  + A GP+  D+F +  + V T  LL+SS++  
Sbjct: 29  TVYGFWLYLMTDCVLFASFFAVYAVMVNSVAGGPSGQDIFLLPFVAVETAFLLVSSITYG 88

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAMLA   K    + + WL +T   G  FI MEIYEF HLI     P RS FLS+FFALV
Sbjct: 89  FAMLA-LYKGKKSQVLGWLALTFLCGAAFIGMEIYEFHHLIHEGYGPSRSGFLSAFFALV 147

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           GLHG HV  GLIW+ +++ Q+ KKGL + N+ RL CLS+FWHFLD++WI VF+ VYLMG 
Sbjct: 148 GLHGAHVTSGLIWMAIMMFQVQKKGLTNTNKTRLSCLSLFWHFLDVVWIGVFTVVYLMGA 207

Query: 210 V 210
           +
Sbjct: 208 L 208


>gi|312964548|ref|ZP_07778804.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           2362-75]
 gi|307628101|gb|ADN72405.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli UM146]
 gi|312290782|gb|EFR18659.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           2362-75]
          Length = 171

 Score =  181 bits (458), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 119/170 (70%), Gaps = 1/170 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           MSDC++F++ F TYAVL    A GP   D+F++  + V T +LL SS++   A +A   K
Sbjct: 1   MSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIA-MYK 59

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
               + VSWL +T  FG  FI MEIYEF HLI     P RS FLS+FFALVG HGLHV  
Sbjct: 60  NNKSQVVSWLALTWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTS 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           GLIW+ VL++QI ++GL S N+ R++CLS+FWHFLD++WICVF+ VYLMG
Sbjct: 120 GLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMG 169


>gi|238787999|ref|ZP_04631795.1| Cytochrome o ubiquinol oxidase subunit 3 [Yersinia frederiksenii
           ATCC 33641]
 gi|238723947|gb|EEQ15591.1| Cytochrome o ubiquinol oxidase subunit 3 [Yersinia frederiksenii
           ATCC 33641]
          Length = 171

 Score =  181 bits (458), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 89/172 (51%), Positives = 122/172 (70%), Gaps = 1/172 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           MSDC++FA  F TYAVL    A GP+  D+FD++ + V T +LL SS++   AML    K
Sbjct: 1   MSDCILFATLFATYAVLVNGTAGGPSGRDIFDLNFVLVETFLLLFSSITYGIAMLG-MNK 59

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
              ++  +WL +T  FG+ F+ MEIYEF HLI+    P RSAFLSSFFALV  HG+HV  
Sbjct: 60  GHKNQVNTWLGLTFLFGLGFVAMEIYEFHHLIAEGYGPDRSAFLSSFFALVATHGIHVTA 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GL+W+ +++IQ+ K+GL   N+ RL+CLS+FWHFLD++WICVF+ VYL+G +
Sbjct: 120 GLVWIIIMMIQVAKRGLNEMNRTRLMCLSLFWHFLDVVWICVFTVVYLLGAM 171


>gi|224826960|ref|ZP_03700058.1| cytochrome o ubiquinol oxidase, subunit III [Lutiella nitroferrum
           2002]
 gi|224600793|gb|EEG06978.1| cytochrome o ubiquinol oxidase, subunit III [Lutiella nitroferrum
           2002]
          Length = 204

 Score =  181 bits (458), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 92/181 (50%), Positives = 122/181 (67%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T LGFW+YLM+DC++FA  F  YAVL  N   G A  ++F++  + V T  LL SS++  
Sbjct: 25  TQLGFWLYLMTDCILFASAFAAYAVLFGNVNGGVAGKEIFELKYVLVETFALLFSSITYG 84

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAM+ S  K      + WL VT  FG +FI ME++EF  LI+    P +SAFLS FFALV
Sbjct: 85  FAMI-SGHKGSKAGLLGWLAVTFLFGAVFIGMELHEFGTLIAEGHGPDKSAFLSGFFALV 143

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G+HGLHV  GLIW+ V++++++K GL      RL CLSMFWHFLD++WICVF+ VYL G 
Sbjct: 144 GMHGLHVTAGLIWMAVMMLEVIKTGLTGRAMTRLNCLSMFWHFLDIVWICVFTVVYLKGA 203

Query: 210 V 210
           +
Sbjct: 204 I 204


>gi|46446825|ref|YP_008190.1| cytochrome o ubiquinol oxidase chain III cyoC [Candidatus
           Protochlamydia amoebophila UWE25]
 gi|46400466|emb|CAF23915.1| probable cytochrome o ubiquinol oxidase chain III cyoC [Candidatus
           Protochlamydia amoebophila UWE25]
          Length = 211

 Score =  180 bits (457), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 124/181 (68%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           TY GFW+YLM+DCL+FA  F TYAVL K+   GP+  ++F +   F+ T++LLLSS++C 
Sbjct: 32  TYFGFWMYLMTDCLLFATLFCTYAVLHKSTFGGPSSHELFQLPTAFIETLILLLSSMTCG 91

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
            +MLA A K      + WL++T   G  F+ +EI EF+ LI       RSAFLSSFF LV
Sbjct: 92  LSMLA-AVKSQKKYVIGWLIITFCLGSSFLFLEIQEFSLLIREGNGFDRSAFLSSFFTLV 150

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLH+ FGL+W+ V++ Q++ +G+     RRL   S+FWHFLDLIWI +F+FVYL+GV
Sbjct: 151 GTHGLHITFGLLWMIVMIAQVIYQGITLSTFRRLALFSLFWHFLDLIWISIFTFVYLLGV 210

Query: 210 V 210
            
Sbjct: 211 A 211


>gi|183601052|ref|ZP_02962545.1| hypothetical protein PROSTU_04674 [Providencia stuartii ATCC 25827]
 gi|188019391|gb|EDU57431.1| hypothetical protein PROSTU_04674 [Providencia stuartii ATCC 25827]
          Length = 204

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 123/186 (66%), Gaps = 2/186 (1%)

Query: 26  DHDGTYL-GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLS 84
           D  GT + GFW+Y+MSD ++FA  F TY VL    A GP   D+F +S +   T +LL S
Sbjct: 20  DAGGTKVFGFWLYIMSDLILFACLFATYVVLADGTAGGPEGKDIFSLSFVLGETFLLLFS 79

Query: 85  SLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSS 144
           S++  FAMLA    ++    + WL VT   G+ F+IME+YEF  LI+    P RS FLS 
Sbjct: 80  SITYGFAMLAMHKGKIASVNL-WLFVTFLLGLGFVIMEVYEFHELIAEGYGPDRSGFLSG 138

Query: 145 FFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFV 204
           FF LV  HG+HV  GL+W+ +++IQ+ ++GL   NQ RL CLS+FWHFLD++WICVF+ V
Sbjct: 139 FFTLVATHGIHVTCGLVWIIIMIIQVSRRGLTEVNQTRLNCLSLFWHFLDVVWICVFTVV 198

Query: 205 YLMGVV 210
           YL+G +
Sbjct: 199 YLLGAI 204


>gi|262372201|ref|ZP_06065480.1| cytochrome aa3 quinol oxidase, subunit III [Acinetobacter junii
           SH205]
 gi|262312226|gb|EEY93311.1| cytochrome aa3 quinol oxidase, subunit III [Acinetobacter junii
           SH205]
          Length = 206

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 124/184 (67%), Gaps = 4/184 (2%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVFDISGIFV--STIVLLLSSL 86
           T  GFW YLMSD ++F   F+ +AVL  +   G P+  D+F  S  FV   T  LL+SS+
Sbjct: 24  TVFGFWTYLMSDLILFGSLFIAFAVLSSHIPPGTPSAKDLFGDSLGFVLTETFALLISSV 83

Query: 87  SCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFF 146
           +  FA+LAS  K  +++ ++WL VT  FG  FI MEIYEF HL+     P  SAFLS+FF
Sbjct: 84  TFGFAVLASYKKN-VNQVIAWLFVTFLFGATFIGMEIYEFQHLVHAGHGPTHSAFLSAFF 142

Query: 147 ALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
            LVG HG+HV  GL+W+ VL+ QI K GL   N RRL CLS+FWHFLD++WICVFS VYL
Sbjct: 143 TLVGTHGIHVTSGLVWMLVLMYQIKKNGLTLPNTRRLACLSLFWHFLDIVWICVFSVVYL 202

Query: 207 MGVV 210
           MGV+
Sbjct: 203 MGVL 206


>gi|94676901|ref|YP_588719.1| cytochrome o ubiquinol oxidase, subunit III [Baumannia
           cicadellinicola str. Hc (Homalodisca coagulata)]
 gi|94220051|gb|ABF14210.1| cytochrome o ubiquinol oxidase, subunit III [Baumannia
           cicadellinicola str. Hc (Homalodisca coagulata)]
          Length = 203

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 94/179 (52%), Positives = 123/179 (68%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWIYLMSDC++FA+ F TY VL  + A GP+  ++F++  +   T  LLLSSL+   A
Sbjct: 26  LGFWIYLMSDCILFAMLFATYVVLSHSIAGGPSGKEIFELPAVQFETFCLLLSSLTYGIA 85

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +LA   K+  +  + WL  T   G+ FII+EI EF +LI     P RSAFLS FF+LV  
Sbjct: 86  ILAMYRKQ-NNSVILWLFCTFILGLGFIIVEIMEFYNLIINGFGPNRSAFLSGFFSLVAT 144

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  GLIW+ V+++ + KKGL   NQ RL CLS+FWHFLD+IWICVF+ VYL+GV+
Sbjct: 145 HGCHVISGLIWIMVMIVHVYKKGLTLDNQIRLQCLSLFWHFLDIIWICVFTVVYLLGVL 203


>gi|238750998|ref|ZP_04612494.1| Cytochrome o ubiquinol oxidase subunit 3 [Yersinia rohdei ATCC
           43380]
 gi|238710688|gb|EEQ02910.1| Cytochrome o ubiquinol oxidase subunit 3 [Yersinia rohdei ATCC
           43380]
          Length = 171

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 120/170 (70%), Gaps = 1/170 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           MSDC++FA  F TYAVL    A GP+  D+FD++ + V T +LL SS++   AML    K
Sbjct: 1   MSDCILFATLFATYAVLVNGTAGGPSGKDIFDLNFVLVETFLLLFSSITYGIAMLG-MNK 59

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
              ++  +WL +T  FG+ F+ MEIYEF HLI     P RSAFLSSFFALV  HG+HV  
Sbjct: 60  GHKNQVNTWLGLTFLFGLGFVAMEIYEFHHLIVEGYGPDRSAFLSSFFALVATHGIHVTA 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           GL+W+ +++IQ+ K+GL   N+ RL+CLS+FWHFLD++WICVF+ VYL+G
Sbjct: 120 GLVWIIIMMIQVAKRGLNETNRTRLMCLSLFWHFLDVVWICVFTVVYLLG 169


>gi|194289182|ref|YP_002005089.1| cytochrome o ubiquinol oxidase subunit iii [Cupriavidus taiwanensis
           LMG 19424]
 gi|193223017|emb|CAQ69022.1| cytochrome o ubiquinol oxidase, subunit III [Cupriavidus
           taiwanensis LMG 19424]
          Length = 214

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 91/179 (50%), Positives = 124/179 (69%), Gaps = 1/179 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFWIYLMSDC++FA  F  +AVL    A GP+  ++F+++ + V T +LL SS++  
Sbjct: 35  TVYGFWIYLMSDCIIFAGLFAAFAVLRGELAGGPSAKELFELNYVLVETFILLFSSITYG 94

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
            AM++   + L H   +WL +T   G+ F+ MEI EF HLI+  A P RSAFLSSFF LV
Sbjct: 95  MAMISLQNRSLKH-VQTWLGITFLLGLAFMAMEINEFHHLIAEGAGPGRSAFLSSFFTLV 153

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           G HGLHV  G++W+ VL+ Q+ KKG+     +RL+CLS+FWHFLD++WI VF+ VYLMG
Sbjct: 154 GTHGLHVASGMLWMIVLMWQLGKKGITPTLSKRLMCLSLFWHFLDVVWIGVFTVVYLMG 212


>gi|197363323|ref|YP_002142960.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|197094800|emb|CAR60333.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
          Length = 171

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 91/170 (53%), Positives = 119/170 (70%), Gaps = 1/170 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           MSDC++F++ F TYAVL    A GP   D+F++  + V T +LL SS++   A +A   K
Sbjct: 1   MSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIA-MHK 59

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
               + +SWL +T  FG  FI MEIYEF HLI     P RS FLS+FFALVG HGLHV  
Sbjct: 60  NNKSQVISWLALTFLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTS 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           GLIW+ VL++Q+ ++GL S N+ R++CLS+FWHFLD+IWICVF+ VYLMG
Sbjct: 120 GLIWMAVLMVQVARRGLTSTNRTRIMCLSLFWHFLDVIWICVFTVVYLMG 169


>gi|212709188|ref|ZP_03317316.1| hypothetical protein PROVALCAL_00221 [Providencia alcalifaciens DSM
           30120]
 gi|212688100|gb|EEB47628.1| hypothetical protein PROVALCAL_00221 [Providencia alcalifaciens DSM
           30120]
          Length = 204

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 87/178 (48%), Positives = 123/178 (69%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSD ++FA  F TY VL    A GPA  D+F +  +   T +LL SS++  FAM
Sbjct: 28  GFWIYLMSDLILFASLFATYVVLSDGTAGGPAGRDIFSLQFVLGETFLLLFSSITYGFAM 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   +++    + WL +T  FG+ F++ME+YEF  LI+    P RS FLS+FFALV  H
Sbjct: 88  IAMHKEKVAAVNL-WLFITFLFGLGFVVMEVYEFHELIAEGYGPDRSGFLSAFFALVATH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           G+HV  GL+W+ +++IQ  ++GL + N+ RL CLS+FWHFLD++WICVF+ VYL+G +
Sbjct: 147 GIHVTCGLVWIILMIIQNCRRGLTAVNKTRLNCLSLFWHFLDVVWICVFTVVYLLGAI 204


>gi|268592044|ref|ZP_06126265.1| cytochrome o ubiquinol oxidase, subunit III [Providencia rettgeri
           DSM 1131]
 gi|291312437|gb|EFE52890.1| cytochrome o ubiquinol oxidase, subunit III [Providencia rettgeri
           DSM 1131]
          Length = 204

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 91/186 (48%), Positives = 124/186 (66%), Gaps = 2/186 (1%)

Query: 26  DHDGTYL-GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLS 84
           D  GT + GFW+Y+MSD ++FA  F TY VL    A GPA  D+F +  +   T +LL+S
Sbjct: 20  DAGGTKVFGFWLYIMSDLILFACLFATYVVLADGTAGGPAGKDIFSLKFVLGETFLLLVS 79

Query: 85  SLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSS 144
           S++  FAM+A    ++    + WL  T   G+ F+IMEIYEF  LI+    P RS FLS 
Sbjct: 80  SITYGFAMIAMHKGKIAAVNL-WLFATFLLGLGFVIMEIYEFHELIAEGFGPDRSGFLSG 138

Query: 145 FFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFV 204
           FFALV  HGLHV  GLIW+ +++IQ+ ++GL   N+ RL CLS+FWHFLD++WICVF+ V
Sbjct: 139 FFALVATHGLHVTAGLIWIIIMMIQVTRRGLTDVNKTRLNCLSLFWHFLDVVWICVFTVV 198

Query: 205 YLMGVV 210
           YL+G +
Sbjct: 199 YLLGAI 204


>gi|297516403|ref|ZP_06934789.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli OP50]
 gi|307137073|ref|ZP_07496429.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli H736]
 gi|312970525|ref|ZP_07784706.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           1827-70]
 gi|310337174|gb|EFQ02312.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           1827-70]
 gi|313646948|gb|EFS11405.1| cytochrome o ubiquinol oxidase, subunit III [Shigella flexneri 2a
           str. 2457T]
 gi|320181588|gb|EFW56503.1| Cytochrome O ubiquinol oxidase subunit III [Shigella boydii ATCC
           9905]
 gi|320192844|gb|EFW67484.1| Cytochrome O ubiquinol oxidase subunit III [Escherichia coli
           O157:H7 str. EC1212]
 gi|323157116|gb|EFZ43240.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           EPECa14]
 gi|323160460|gb|EFZ46408.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           E128010]
 gi|323164229|gb|EFZ50036.1| cytochrome o ubiquinol oxidase, subunit III [Shigella sonnei 53G]
 gi|323178302|gb|EFZ63880.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli 1180]
 gi|326341192|gb|EGD64984.1| Cytochrome O ubiquinol oxidase subunit III [Escherichia coli
           O157:H7 str. 1044]
 gi|326346033|gb|EGD69772.1| Cytochrome O ubiquinol oxidase subunit III [Escherichia coli
           O157:H7 str. 1125]
 gi|327254756|gb|EGE66372.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           STEC_7v]
 gi|332085695|gb|EGI90859.1| cytochrome o ubiquinol oxidase, subunit III [Shigella dysenteriae
           155-74]
 gi|332760716|gb|EGJ91004.1| cytochrome o ubiquinol oxidase, subunit III [Shigella flexneri
           4343-70]
 gi|332763721|gb|EGJ93959.1| cytochrome o ubiquinol oxidase, subunit III [Shigella flexneri
           K-671]
 gi|332768346|gb|EGJ98530.1| cytochrome o ubiquinol oxidase, subunit III [Shigella flexneri
           2930-71]
          Length = 171

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 91/170 (53%), Positives = 119/170 (70%), Gaps = 1/170 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           MSDC++F++ F TYAVL    A GP   D+F++  + V T +LL SS++   A +A   K
Sbjct: 1   MSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIA-MYK 59

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
               + +SWL +T  FG  FI MEIYEF HLI     P RS FLS+FFALVG HGLHV  
Sbjct: 60  NNKSQVISWLALTWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTS 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           GLIW+ VL++QI ++GL S N+ R++CLS+FWHFLD++WICVF+ VYLMG
Sbjct: 120 GLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMG 169


>gi|260549405|ref|ZP_05823624.1| heme/copper-type cytochrome/quinol oxidase [Acinetobacter sp.
           RUH2624]
 gi|260407514|gb|EEX00988.1| heme/copper-type cytochrome/quinol oxidase [Acinetobacter sp.
           RUH2624]
          Length = 206

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 124/184 (67%), Gaps = 4/184 (2%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVF--DISGIFVSTIVLLLSSL 86
           T  GFW YLMSD ++F   F+ +AVL  +  AG P+  D+F   +  +   T  LL+SS+
Sbjct: 24  TVFGFWTYLMSDLILFGSLFIAFAVLSSHVPAGTPSAYDLFHNSLGYVLTETFALLISSV 83

Query: 87  SCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFF 146
           +  FA+LAS  K  +++ ++WL +T  FG  FI ME+YEF HL+     P  SAFLSSFF
Sbjct: 84  TFGFAVLASYKKN-VNQVITWLFITFLFGATFIGMELYEFHHLVEEGHGPTHSAFLSSFF 142

Query: 147 ALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
            LVG HG+HV  GL+W+ VL+ QI  KGL   N RRL CLS+FWHFLD++WICVFS VYL
Sbjct: 143 TLVGTHGIHVTSGLVWMLVLMYQIKTKGLTLPNTRRLACLSLFWHFLDIVWICVFSVVYL 202

Query: 207 MGVV 210
           +GV+
Sbjct: 203 LGVL 206


>gi|295701243|ref|YP_003610244.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia sp.
           CCGE1002]
 gi|295441566|gb|ADG20733.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia sp.
           CCGE1002]
          Length = 203

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 128/184 (69%), Gaps = 4/184 (2%)

Query: 26  DHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLL 83
           DH  ++   GFW+YLM+DC++FA  F T++VL   +A GP   D+FD+S + + T VLLL
Sbjct: 17  DHPQSHSVFGFWVYLMTDCMLFAALFATFSVLRHQFAGGPTGHDLFDLSDVALGTSVLLL 76

Query: 84  SSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLS 143
           SS++  FAML     R     + WL++T   G +F+ +E+ EF+ LI+  A PQRSAFLS
Sbjct: 77  SSITYGFAMLDVLRAR-SGVVLGWLVITFILGALFLALELREFSQLIAEGAGPQRSAFLS 135

Query: 144 SFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ-RRLICLSMFWHFLDLIWICVFS 202
           +FF LV  HG+HVFFGL+W+ VL++Q+L+       + RRL CLS+FWHFLD++WI VFS
Sbjct: 136 AFFTLVTAHGIHVFFGLLWMLVLMMQVLRVPQFGEQEVRRLTCLSLFWHFLDVVWIFVFS 195

Query: 203 FVYL 206
           FVYL
Sbjct: 196 FVYL 199


>gi|262375301|ref|ZP_06068534.1| cytochrome aa3 quinol oxidase, subunit III [Acinetobacter lwoffii
           SH145]
 gi|262309555|gb|EEY90685.1| cytochrome aa3 quinol oxidase, subunit III [Acinetobacter lwoffii
           SH145]
          Length = 206

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 126/184 (68%), Gaps = 4/184 (2%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVFDISGIFV--STIVLLLSSL 86
           T  GFW YLMSD ++F   F+ +AVL  +   G P+  D+F  S  FV   T  LL+SS+
Sbjct: 24  TVFGFWTYLMSDLVLFGTLFIAFAVLSSHIPVGTPSARDLFGDSLGFVLTETFALLISSV 83

Query: 87  SCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFF 146
           +  FA+LA A K+ + K ++WL +T  FG IFI ME+YEF HL+     P  SAFLS+FF
Sbjct: 84  TFGFAVLA-AYKKDVAKVLTWLAITWVFGAIFIGMELYEFNHLVHAGHGPSTSAFLSAFF 142

Query: 147 ALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
            LVG HG+HV  GL+W+ VL++QI K GL   N RRL CLS+FWHFLD++WICVFS VYL
Sbjct: 143 TLVGTHGIHVTSGLVWMIVLMVQIKKYGLTLANTRRLACLSLFWHFLDIVWICVFSVVYL 202

Query: 207 MGVV 210
           MGV+
Sbjct: 203 MGVL 206


>gi|315500562|ref|YP_004089364.1| cytochrome o ubiquinol oxidase, subunit III [Asticcacaulis
           excentricus CB 48]
 gi|315418574|gb|ADU15213.1| cytochrome o ubiquinol oxidase, subunit III [Asticcacaulis
           excentricus CB 48]
          Length = 225

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 102/227 (44%), Positives = 136/227 (59%), Gaps = 19/227 (8%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTY-----------------LGFWIYLMSDCL 43
           MS   +  + N  +   K + ES  DH+                    LGFWIYLMSDCL
Sbjct: 1   MSSTPVNPAEN-PVGAFKQQLESAYDHNPNDVHDTHDHHHHDEEAKVTLGFWIYLMSDCL 59

Query: 44  MFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHK 103
           +FA  F TYAVL    A GP   ++FD+  + + T +LLLSSL+   +M++    +L + 
Sbjct: 60  IFATLFATYAVLKDATAGGPNGRELFDLGFVAIETSLLLLSSLTFGLSMISMQNNKL-NG 118

Query: 104 TVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWL 163
            + WL VT   G+ F+ ME+YEF HLI   A P RSAFLS+FF LVG HGLHV  GLIW+
Sbjct: 119 VLGWLAVTGLLGLGFMGMELYEFNHLIHEGAGPDRSAFLSAFFTLVGTHGLHVTSGLIWM 178

Query: 164 FVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
            V+ + + ++GL   N+ R++ LS+FWHFLD+IWI VFS VYLMG  
Sbjct: 179 GVMFVHLFRRGLTPANRIRMMELSLFWHFLDIIWIGVFSIVYLMGAA 225


>gi|301058579|ref|ZP_07199584.1| cytochrome o ubiquinol oxidase, subunit III [delta proteobacterium
           NaphS2]
 gi|300447311|gb|EFK11071.1| cytochrome o ubiquinol oxidase, subunit III [delta proteobacterium
           NaphS2]
          Length = 204

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 92/178 (51%), Positives = 125/178 (70%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSD  +F+  F T+AV+G NYA GP+  D+F +  +F  T++LL+SS +C F M
Sbjct: 28  GFWVYLMSDLALFSALFATFAVVGFNYAGGPSGKDLFHLPYLFGETMLLLVSSAACGFTM 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           LA    R     +  L+VT   G+ FI MEI+EF  +++    P+RSAFLS+FF LVG H
Sbjct: 88  LAVHGGRKARVQLG-LVVTFLLGLGFITMEIHEFYGMVAGGNGPERSAFLSAFFTLVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           G+HV FGLIW+ VL+ Q+  KGL +  + RL+ LSMFWHFLD++W+ VFS VYLMGV+
Sbjct: 147 GIHVSFGLIWMAVLMGQVTAKGLSTPVRSRLMRLSMFWHFLDIVWVGVFSVVYLMGVI 204


>gi|293609457|ref|ZP_06691759.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827909|gb|EFF86272.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325122719|gb|ADY82242.1| cytochrome o ubiquinol oxidase subunit III [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 206

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 97/184 (52%), Positives = 125/184 (67%), Gaps = 4/184 (2%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVFDISGIFV--STIVLLLSSL 86
           T  GFW YLMSD ++F   F+ +AVL  +  AG P+  D+F  S  FV   T  LL+SS+
Sbjct: 24  TVFGFWTYLMSDLILFGSLFIAFAVLSSHVPAGTPSAYDLFHDSLGFVLTETFALLISSV 83

Query: 87  SCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFF 146
           +  FA+LAS  K  +++ ++WL +T  FG  FI ME+YEF HL+     P  SAFLSSFF
Sbjct: 84  TFGFAVLASYKKN-VNQVITWLFITFLFGASFIGMEVYEFHHLVHEGHGPTHSAFLSSFF 142

Query: 147 ALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
            LVG HG+HV  GL+W+ VL+ QI  KGL   N RRL CLS+FWHFLD++WICVFS VYL
Sbjct: 143 TLVGTHGIHVTSGLVWMLVLMYQIKTKGLTLPNTRRLACLSLFWHFLDIVWICVFSVVYL 202

Query: 207 MGVV 210
           +GV+
Sbjct: 203 LGVL 206


>gi|261346372|ref|ZP_05974016.1| cytochrome o ubiquinol oxidase, subunit III [Providencia
           rustigianii DSM 4541]
 gi|282565689|gb|EFB71224.1| cytochrome o ubiquinol oxidase, subunit III [Providencia
           rustigianii DSM 4541]
          Length = 204

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 124/186 (66%), Gaps = 2/186 (1%)

Query: 26  DHDGTYL-GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLS 84
           D  GT + GFW+Y+MSD ++FA  F TY VL    A GP   D+F +  +   T +LL+S
Sbjct: 20  DAGGTKVFGFWLYIMSDLILFACLFATYVVLADGTAGGPEGKDIFSLKFVLGETFLLLVS 79

Query: 85  SLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSS 144
           S++  FAM+A    ++ +  V WL  T   G+ F+IME+YEF  LI+    P RS FLS 
Sbjct: 80  SITYGFAMIAMHKGKIAYVNV-WLFATFLLGLGFVIMEVYEFHELIAEGFGPDRSGFLSG 138

Query: 145 FFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFV 204
           FFALV  HGLHV  GL+W+ +++IQI ++GL   N+ RL CLS+FWHFLD++WICVF+ V
Sbjct: 139 FFALVATHGLHVSAGLVWIIIMMIQISRRGLTEVNKTRLNCLSLFWHFLDVVWICVFTVV 198

Query: 205 YLMGVV 210
           YL+G +
Sbjct: 199 YLLGAI 204


>gi|94309895|ref|YP_583105.1| cytochrome c oxidase subunit III [Cupriavidus metallidurans CH34]
 gi|93353747|gb|ABF07836.1| cytochrome o ubiquinol oxidase subunit III [Cupriavidus
           metallidurans CH34]
          Length = 214

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 93/183 (50%), Positives = 123/183 (67%), Gaps = 1/183 (0%)

Query: 28  DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
           + T  GFW+YLMSDC++FA  F  +AVL    A GP+  ++F+++ + V T +LL SS++
Sbjct: 33  ENTVFGFWLYLMSDCILFACLFAAFAVLRGEVAGGPSGKEIFELNYVLVETAILLFSSIT 92

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
             FAM+ S       + + WL VT   G  F+ MEI EFAHLI   A P RSAFLSSFF 
Sbjct: 93  YGFAMV-SMQNHQKGRVMFWLGVTFLLGAAFMGMEINEFAHLIHEGAGPSRSAFLSSFFT 151

Query: 148 LVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           LVG HGLHV  G++W+ VL+ Q+ KKGL     +RL CLS+FWHFLD++WI VF+ VYLM
Sbjct: 152 LVGTHGLHVASGMLWMLVLMWQLSKKGLTPVVAKRLNCLSLFWHFLDVVWIGVFTVVYLM 211

Query: 208 GVV 210
           G +
Sbjct: 212 GAM 214


>gi|33519708|ref|NP_878540.1| cytochrome o ubiquinol oxidase subunit III [Candidatus Blochmannia
           floridanus]
 gi|33504053|emb|CAD83314.1| cytochrome o ubiquinol oxidase subunit III [Candidatus Blochmannia
           floridanus]
          Length = 196

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 130/194 (67%), Gaps = 4/194 (2%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGP-APIDVFDISGIFVS 77
           +K      ++ T  GFW+Y+MSDC++FA  F  +AVL  N+        ++F ++ +F  
Sbjct: 5   NKNIKLNTNNTTIFGFWLYIMSDCILFASLFAMHAVLSTNFQKDLLISNNIFKLTFVFTE 64

Query: 78  TIVLLLSSLSCSFAML-ASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
           TI+LLLSS++CS +M+ A+ T     KT+ W+++T   G+ FI MEIYEF HLI+ +  P
Sbjct: 65  TILLLLSSITCSTSMIYANITNP--KKTLQWMILTLLLGLGFISMEIYEFHHLIANKYNP 122

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
            R+AF SSFF L+G HG+HV  GLIW+ ++ I ++  GL   N  RL C S+FWHFLD+I
Sbjct: 123 SRNAFFSSFFVLIGTHGIHVITGLIWIIIMTIHLIMTGLTQQNLIRLHCFSLFWHFLDII 182

Query: 197 WICVFSFVYLMGVV 210
           WICVF+ VYL+GV+
Sbjct: 183 WICVFTEVYLIGVL 196


>gi|239906127|ref|YP_002952866.1| cytochrome o ubiquinol oxidase subunit III [Desulfovibrio
           magneticus RS-1]
 gi|239795991|dbj|BAH74980.1| cytochrome o ubiquinol oxidase subunit III [Desulfovibrio
           magneticus RS-1]
          Length = 210

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 122/179 (68%), Gaps = 3/179 (1%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSD ++F+  F TY V+  NYA GP P D+F++  + V T++LL SS +   AM
Sbjct: 33  GFWLYLMSDLIVFSALFATYVVMAHNYAGGPTPKDLFELPAVLVETMLLLTSSAAYGLAM 92

Query: 93  LASATKRLIHKTVSWLLVTAF-FGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +A     L  ++V   LV AF  G+ F++ME+ EF H I + A P RS FLS+FF LVG 
Sbjct: 93  VAMHKGDL--RSVRLGLVAAFALGLGFLVMELAEFHHFIGIGAGPDRSGFLSAFFTLVGT 150

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HGLHV FGL+W+ V++ Q+  KGL +  + RL  L MFWHFLD++WI VF+ VYL+GVV
Sbjct: 151 HGLHVTFGLLWIVVMLAQLASKGLTAPVKGRLTRLGMFWHFLDIVWIGVFTVVYLLGVV 209


>gi|205351752|ref|YP_002225553.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|207855921|ref|YP_002242572.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|224582279|ref|YP_002636077.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|205271533|emb|CAR36351.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|206707724|emb|CAR32009.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|224466806|gb|ACN44636.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|261245724|emb|CBG23521.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhimurium str. D23580]
 gi|301157052|emb|CBW16536.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhimurium str. SL1344]
 gi|322614719|gb|EFY11648.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315996572]
 gi|322618825|gb|EFY15713.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-1]
 gi|322623532|gb|EFY20371.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-3]
 gi|322629170|gb|EFY25949.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-4]
 gi|322631890|gb|EFY28644.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-1]
 gi|322637373|gb|EFY34075.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-2]
 gi|322664720|gb|EFY60913.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. 81038-01]
 gi|322669227|gb|EFY65377.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. MD_MDA09249507]
 gi|322670772|gb|EFY66905.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. 414877]
 gi|322678989|gb|EFY75044.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. 366867]
 gi|322682017|gb|EFY78042.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. 413180]
 gi|322685154|gb|EFY81151.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. 446600]
 gi|323192953|gb|EFZ78176.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609458-1]
 gi|323196965|gb|EFZ82107.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556150-1]
 gi|323203950|gb|EFZ88967.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609460]
 gi|323206965|gb|EFZ91918.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. 507440-20]
 gi|323210817|gb|EFZ95689.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556152]
 gi|323214508|gb|EFZ99259.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB101509-0077]
 gi|323223065|gb|EGA07408.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB102109-0047]
 gi|323227014|gb|EGA11195.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB110209-0055]
 gi|323230168|gb|EGA14288.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB111609-0052]
 gi|323233906|gb|EGA17995.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009083312]
 gi|323238400|gb|EGA22458.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009085258]
 gi|323244088|gb|EGA28097.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315731156]
 gi|323246248|gb|EGA30231.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2009159199]
 gi|323251874|gb|EGA35737.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008282]
 gi|323261116|gb|EGA44708.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008284]
 gi|323264954|gb|EGA48453.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008285]
 gi|323272517|gb|EGA55924.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008287]
 gi|326626787|gb|EGE33130.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 9]
          Length = 171

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 120/172 (69%), Gaps = 1/172 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           MSDC++F++ F TYAVL    A GP   D+F++  + V T +LL SS++   A +A   K
Sbjct: 1   MSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIA-MHK 59

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
               + +SWL +T  FG  FI ME+YEF HLI     P RS FLS+FFALVG HGLHV  
Sbjct: 60  NNKSQVISWLALTFLFGAGFIGMELYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTS 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLIW+ VL++Q+ ++GL S N+ R++CLS+FWHFLD+IWICVF+ VYLMG +
Sbjct: 120 GLIWMAVLMVQVARRGLTSTNRTRIMCLSLFWHFLDVIWICVFTVVYLMGAM 171


>gi|296533147|ref|ZP_06895776.1| cytochrome c oxidase, subunit III [Roseomonas cervicalis ATCC
           49957]
 gi|296266519|gb|EFH12515.1| cytochrome c oxidase, subunit III [Roseomonas cervicalis ATCC
           49957]
          Length = 212

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 98/179 (54%), Positives = 123/179 (68%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWIYLMSDC++FA  F TYAVL    A GP    +FD+  +F  T++LL SS++    
Sbjct: 35  LGFWIYLMSDCILFAGIFATYAVLSHATAGGPDGHALFDLPYVFTETMILLASSITYGMG 94

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           MLA+   R     +SWL +TA  G+ F+ ME+ EF H+I+  A P RSAFLS+FF LVG 
Sbjct: 95  MLAAVRGRR-RVALSWLGLTALLGLAFLAMELNEFHHMIAEGAGPDRSAFLSAFFTLVGT 153

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HGLHV  GL+WL VL+ Q+  KGL   N  RL CLSMFWHFLD+IWI VF+ VYL+GV+
Sbjct: 154 HGLHVTAGLLWLGVLMAQVAVKGLSDTNLTRLNCLSMFWHFLDVIWIGVFTIVYLLGVL 212


>gi|113867093|ref|YP_725582.1| bo3-type quinol oxidase, subunit III [Ralstonia eutropha H16]
 gi|113525869|emb|CAJ92214.1| bo3-type quinol oxidase, subunit III [Ralstonia eutropha H16]
          Length = 214

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 122/179 (68%), Gaps = 1/179 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFWIYLMSDC++FA  F  +AVL    A GP+  ++F+++ + V T +LL SS++  
Sbjct: 35  TVYGFWIYLMSDCIIFAGLFAAFAVLRGELAGGPSAKELFELNYVLVETFILLFSSITYG 94

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
            AM+ S   R + +   WL VT   G  F+ MEI EF HLI+  A P RSAFLSSFF LV
Sbjct: 95  MAMI-SLQNRSLSRVQVWLGVTFLLGAAFMAMEINEFHHLIAEGAGPGRSAFLSSFFTLV 153

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           G HGLHV  G++W+ VL+ Q+ KKG+     +RL+CLS+FWHFLD++WI VF+ VYLMG
Sbjct: 154 GTHGLHVASGMLWMIVLMWQLSKKGITPTLSKRLMCLSLFWHFLDVVWIGVFTVVYLMG 212


>gi|77460867|ref|YP_350374.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas
           fluorescens Pf0-1]
 gi|77384870|gb|ABA76383.1| cytochrome bo3 quinol oxidase subunit 3 [Pseudomonas fluorescens
           Pf0-1]
          Length = 208

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 121/181 (66%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLM+DC++FA  F  YAVL  N A GP+  D+F++  +   T +LL SS++  
Sbjct: 29  TVYGFWLYLMTDCILFASIFAVYAVLVNNVAGGPSGHDIFELPYVLGETALLLFSSITYG 88

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAMLA   K    + + WL +T   G  FI MEI EF  LIS    P RS FLS+FF LV
Sbjct: 89  FAMLA-LYKGKKQQVLGWLFMTFLLGAGFIAMEINEFHLLISEGFGPSRSGFLSAFFTLV 147

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GLIW+ +++ Q+ K GL + N+ RL CLS+FWHFLD++WICVF+ VYLMG 
Sbjct: 148 GTHGLHVSAGLIWMGIMMYQVNKHGLTATNKTRLSCLSLFWHFLDVVWICVFTVVYLMGT 207

Query: 210 V 210
           +
Sbjct: 208 L 208


>gi|17224968|gb|AAL37190.1|AF321090_2 cytochrome o ubiquinol oxidase C [Pseudomonas putida]
          Length = 201

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 123/189 (65%), Gaps = 4/189 (2%)

Query: 25  VDHDG---TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVL 81
           + HD    T  GFW+YLM+DC++FA  F  YAVL  N A GP+  ++F++  +   T +L
Sbjct: 14  ITHDSGKMTVYGFWLYLMTDCILFASIFAVYAVLVNNVAGGPSGHEIFELPYVLGETALL 73

Query: 82  LLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAF 141
           L SS++  FAMLA   K      + WL +T   G  FI MEI EF  LIS    P RS F
Sbjct: 74  LFSSITYGFAMLA-LYKGKKQAVLGWLFMTFLLGAGFIAMEINEFHLLISEGFGPSRSGF 132

Query: 142 LSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVF 201
           LS+FF LVG HGLHV  GLIW+ +++ Q+ K GL S N+ RL CLS+FWHFLD++WICVF
Sbjct: 133 LSAFFTLVGTHGLHVSAGLIWMGIMMYQVNKHGLTSTNKTRLSCLSLFWHFLDVVWICVF 192

Query: 202 SFVYLMGVV 210
           + VYLMG +
Sbjct: 193 TVVYLMGTL 201


>gi|255319503|ref|ZP_05360717.1| cytOchrome o ubiquinol oxidase, subunit III [Acinetobacter
           radioresistens SK82]
 gi|262378473|ref|ZP_06071630.1| cytochrome aa3 quinol oxidase, subunit III [Acinetobacter
           radioresistens SH164]
 gi|255303443|gb|EET82646.1| cytOchrome o ubiquinol oxidase, subunit III [Acinetobacter
           radioresistens SK82]
 gi|262299758|gb|EEY87670.1| cytochrome aa3 quinol oxidase, subunit III [Acinetobacter
           radioresistens SH164]
          Length = 206

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 124/184 (67%), Gaps = 4/184 (2%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVFDISGIFV--STIVLLLSSL 86
           T  GFW YLMSD ++F   F+ +AVL  +   G P+  D+F  S  FV   T  LL+SS+
Sbjct: 24  TVFGFWTYLMSDLILFGTLFIAFAVLSSHVPPGTPSAGDLFGDSLGFVLTETFALLISSV 83

Query: 87  SCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFF 146
           +  FA+LAS  K  + + ++WL VT  FG  FI ME+YEF HL+     P  SAFLSSFF
Sbjct: 84  TFGFAVLASYKKN-VGQVIAWLAVTWLFGASFIGMELYEFNHLVHEGYGPTTSAFLSSFF 142

Query: 147 ALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
            LVG HG+HV  GL+W+ +L+IQI K GL   N RRL CLS+FWHFLD++WICVFS VYL
Sbjct: 143 TLVGTHGIHVTSGLVWMIILMIQIKKNGLTLPNMRRLACLSLFWHFLDIVWICVFSVVYL 202

Query: 207 MGVV 210
           MGV+
Sbjct: 203 MGVL 206


>gi|162147817|ref|YP_001602278.1| cytochrome o ubiquinol oxidase subunit 3 [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209542440|ref|YP_002274669.1| cytochrome o ubiquinol oxidase subunit III [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161786394|emb|CAP55976.1| putative cytochrome o ubiquinol oxidase subunit 3
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530117|gb|ACI50054.1| cytochrome o ubiquinol oxidase, subunit III [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 201

 Score =  178 bits (452), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 127/179 (70%), Gaps = 2/179 (1%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLM+DCL+F   F  +AV+   +A GP   D+F+++G+ + T +LL+SS++  FAM
Sbjct: 24  GFWLYLMTDCLIFGTLFAVFAVMRTQFAGGPTGKDLFELNGVGIETALLLVSSITYGFAM 83

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           + +A K  +     WL++T   G+ F+ MEI EF+H+++    P RSAFLSSFF LVG H
Sbjct: 84  I-NAHKNKLGAMRGWLVLTFLMGLGFLFMEIREFSHMVAEGNGPDRSAFLSSFFTLVGTH 142

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGN-QRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GL+W+ VL++Q + + ++S     +L CLS+FWHFLD++WICVF+FVYLM V+
Sbjct: 143 GLHVTCGLLWMAVLMVQSMGQTVLSERMMNKLTCLSLFWHFLDIVWICVFTFVYLMSVI 201


>gi|330993477|ref|ZP_08317412.1| Cytochrome o ubiquinol oxidase subunit 3 [Gluconacetobacter sp.
           SXCC-1]
 gi|329759507|gb|EGG76016.1| Cytochrome o ubiquinol oxidase subunit 3 [Gluconacetobacter sp.
           SXCC-1]
          Length = 197

 Score =  178 bits (452), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 124/181 (68%), Gaps = 6/181 (3%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLM+DC++F   F  +AVL   +A GP   +VF++SG+ + T +LL SS++  F M
Sbjct: 20  GFWLYLMTDCIIFGTLFAVFAVLRDQFAGGPTGHEVFELSGVGIETAILLFSSITYGFGM 79

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A+   + +    +WL VT   G+ F+ MEI EF+H+I+    P RSAFLSSFF LVG H
Sbjct: 80  IAAHENK-VSTMRTWLGVTFLLGLGFLFMEIREFSHMIAEGNGPDRSAFLSSFFTLVGTH 138

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQR---RLICLSMFWHFLDLIWICVFSFVYLMGV 209
           GLHV  GL+W+ VL+ Q   K  +  N+R   +L CLS+FWHFLD++WICVF+FVYLM V
Sbjct: 139 GLHVTCGLLWMAVLLFQTAGKTEL--NERMIGKLTCLSLFWHFLDIVWICVFTFVYLMSV 196

Query: 210 V 210
           +
Sbjct: 197 I 197


>gi|169633241|ref|YP_001706977.1| cytochrome o ubiquinol oxidase subunit III [Acinetobacter baumannii
           SDF]
 gi|169795507|ref|YP_001713300.1| cytochrome o ubiquinol oxidase subunit III [Acinetobacter baumannii
           AYE]
 gi|184158691|ref|YP_001847030.1| Heme/copper-type cytochrome/quinol oxidase subunit 3 [Acinetobacter
           baumannii ACICU]
 gi|215482994|ref|YP_002325199.1| cytochrome o ubiquinol oxidase, subunit III [Acinetobacter
           baumannii AB307-0294]
 gi|239501441|ref|ZP_04660751.1| cytochrome o ubiquinol oxidase, subunit III [Acinetobacter
           baumannii AB900]
 gi|260554569|ref|ZP_05826790.1| cytochrome aa3 quinol oxidase, subunit III [Acinetobacter baumannii
           ATCC 19606]
 gi|301345101|ref|ZP_07225842.1| cytochrome o ubiquinol oxidase subunit III [Acinetobacter baumannii
           AB056]
 gi|301510827|ref|ZP_07236064.1| cytochrome o ubiquinol oxidase subunit III [Acinetobacter baumannii
           AB058]
 gi|301595310|ref|ZP_07240318.1| cytochrome o ubiquinol oxidase subunit III [Acinetobacter baumannii
           AB059]
 gi|332850730|ref|ZP_08432977.1| cytochrome o ubiquinol oxidase, subunit III [Acinetobacter
           baumannii 6013150]
 gi|332866969|ref|ZP_08437286.1| cytochrome o ubiquinol oxidase, subunit III [Acinetobacter
           baumannii 6013113]
 gi|332873683|ref|ZP_08441626.1| cytochrome o ubiquinol oxidase, subunit III [Acinetobacter
           baumannii 6014059]
 gi|169148434|emb|CAM86300.1| cytochrome o ubiquinol oxidase subunit III [Acinetobacter baumannii
           AYE]
 gi|169152033|emb|CAP00913.1| cytochrome o ubiquinol oxidase subunit III [Acinetobacter
           baumannii]
 gi|183210285|gb|ACC57683.1| Heme/copper-type cytochrome/quinol oxidase, subunit 3
           [Acinetobacter baumannii ACICU]
 gi|193077737|gb|ABO12595.2| cytochrome o ubiquinol oxidase subunit III [Acinetobacter baumannii
           ATCC 17978]
 gi|213987145|gb|ACJ57444.1| cytochrome o ubiquinol oxidase, subunit III [Acinetobacter
           baumannii AB307-0294]
 gi|260411111|gb|EEX04408.1| cytochrome aa3 quinol oxidase, subunit III [Acinetobacter baumannii
           ATCC 19606]
 gi|322507499|gb|ADX02953.1| cyoC [Acinetobacter baumannii 1656-2]
 gi|323518605|gb|ADX92986.1| Heme/copper-type cytochrome/quinol oxidase, subunit 3
           [Acinetobacter baumannii TCDC-AB0715]
 gi|332730567|gb|EGJ61883.1| cytochrome o ubiquinol oxidase, subunit III [Acinetobacter
           baumannii 6013150]
 gi|332734298|gb|EGJ65426.1| cytochrome o ubiquinol oxidase, subunit III [Acinetobacter
           baumannii 6013113]
 gi|332738071|gb|EGJ68955.1| cytochrome o ubiquinol oxidase, subunit III [Acinetobacter
           baumannii 6014059]
          Length = 206

 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 93/184 (50%), Positives = 123/184 (66%), Gaps = 4/184 (2%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVF--DISGIFVSTIVLLLSSL 86
           T  GFW YLMSD ++F   F+ +AVL  +   G P+  D+F   +  +   T  LL+SS+
Sbjct: 24  TVFGFWTYLMSDLILFGSLFIAFAVLSSHVPPGTPSAYDLFHESLGYVLTETFALLISSV 83

Query: 87  SCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFF 146
           +  FA+LAS  K  +++ ++WL +T  FG  FI ME+YEF HL+     P  SAFLSSFF
Sbjct: 84  TFGFAVLASYKKN-VNQVITWLFITFLFGATFIGMELYEFHHLVEEGHGPTHSAFLSSFF 142

Query: 147 ALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
            LVG HG+HV  GL+W+ VL+ QI  KGL   N RRL CLS+FWHFLD++WICVFS VYL
Sbjct: 143 TLVGTHGIHVTSGLVWMLVLMYQIKTKGLTLPNTRRLACLSLFWHFLDIVWICVFSVVYL 202

Query: 207 MGVV 210
           +GV+
Sbjct: 203 LGVL 206


>gi|299067542|emb|CBJ38742.1| cytochrome o ubiquinol oxidase, subunit III [Ralstonia solanacearum
           CMR15]
          Length = 212

 Score =  178 bits (451), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 124/180 (68%), Gaps = 7/180 (3%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T LGFW+YLMSDCL+FAV F T+ VL  + A GP    +F++  +F  T++LL+SS +  
Sbjct: 33  TTLGFWLYLMSDCLIFAVLFATFGVLSGSTAGGPGGRQLFELPFVFAETMLLLVSSYTFG 92

Query: 90  FAML---ASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFF 146
            A+L   A A  R+    V WL VT   G +F+ ME+YEF+HL+   A P  SA+LS+FF
Sbjct: 93  IALLKQDADAAPRM----VRWLGVTFLLGALFVGMELYEFSHLLHEGAGPGVSAYLSAFF 148

Query: 147 ALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
            LVG HGLHV  GL+WL V++ Q+ + GL    +RRL CLS+FWHFLDL+WICVF+FVYL
Sbjct: 149 TLVGTHGLHVTAGLLWLAVMMHQVRRFGLDGVVRRRLACLSLFWHFLDLVWICVFTFVYL 208


>gi|319424517|gb|ADV52591.1| cytochrome o ubiquinol oxidase, subunit III [Shewanella
           putrefaciens 200]
          Length = 206

 Score =  178 bits (451), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 123/181 (67%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFWIYLM+DC++FA  F TYAVL  N   G +  D+F++  + + T  LL+SS++  
Sbjct: 27  TLFGFWIYLMTDCILFASVFATYAVLYMNTDGGVSGKDIFELDFVLIETAALLVSSITYG 86

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
            A++  A +     T  WL +T   G +FI ME+YEF HLI     PQRSAFLSSFF LV
Sbjct: 87  MALI-FAKRHNKAATFVWLAITFALGCVFIGMEVYEFHHLIEHGNGPQRSAFLSSFFTLV 145

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G+HGLHV  GLIW+ +++I++ K GL   +  RL CLS+FWHFLD++WICVF+ VYL+G 
Sbjct: 146 GMHGLHVTAGLIWMAIMMIEVAKTGLGHRSITRLSCLSLFWHFLDIVWICVFTVVYLLGA 205

Query: 210 V 210
           +
Sbjct: 206 L 206


>gi|94314710|ref|YP_587919.1| cytochrome o ubiquinol oxidase subunit III [Cupriavidus
           metallidurans CH34]
 gi|93358562|gb|ABF12650.1| cytochrome o ubiquinol oxidase subunit III [Cupriavidus
           metallidurans CH34]
          Length = 226

 Score =  177 bits (450), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 124/192 (64%), Gaps = 1/192 (0%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF 75
           +  D  +  V    T LGFW+YLMSDCL+FAV F T+ VL  N A GP   ++FD+  + 
Sbjct: 31  HGHDGHDDHVVQSRTTLGFWLYLMSDCLIFAVLFATFGVLVNNTAGGPGGRELFDLRFVL 90

Query: 76  VSTIVLLLSSLSCSFAMLA-SATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
             T++LL SSL+   AM+     K   ++ + W+++T   G  F+ MEI+EF  LI   A
Sbjct: 91  GETMLLLTSSLTFGVAMIKLEDGKANPNQVIRWIVLTFALGAAFVGMEIFEFMELIHEGA 150

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            P RSA+LS+FF LVG HGLHV  GL+W+ V+V QI   GL    +RRL CLS+FWHFLD
Sbjct: 151 GPGRSAYLSAFFMLVGTHGLHVTAGLLWIIVMVHQIQVFGLDGIVRRRLACLSLFWHFLD 210

Query: 195 LIWICVFSFVYL 206
           L+WICVFS VYL
Sbjct: 211 LVWICVFSIVYL 222


>gi|238920119|ref|YP_002933634.1| cytochrome o ubiquinol oxidase, subunit III, [Edwardsiella ictaluri
           93-146]
 gi|238869688|gb|ACR69399.1| cytochrome o ubiquinol oxidase, subunit III, putative [Edwardsiella
           ictaluri 93-146]
          Length = 205

 Score =  177 bits (449), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 96/178 (53%), Positives = 125/178 (70%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++FA  F TYAVL    A GP   ++FD+  + V T +LL SS++   A 
Sbjct: 28  GFWIYLMSDCILFAGLFATYAVLVNGTAGGPTGKEIFDLKFVLVETFLLLFSSITYGMA- 86

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           + +  K  +     WLL+T  FG+ F+ ME+YEF HLI+    P RS FLSSFFALVG H
Sbjct: 87  IGAMNKGSVGGVNVWLLLTFLFGLGFVSMEVYEFHHLITEGFGPDRSGFLSSFFALVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GL W+ V++IQI K GL + N+ RL+CLS+FWHFLD+IWIC+F+ VYL+GV+
Sbjct: 147 GLHVTAGLTWIVVMMIQISKFGLTAANKTRLMCLSLFWHFLDVIWICLFTAVYLLGVM 204


>gi|33595768|ref|NP_883411.1| cytochrome ubiquinol oxidase subunit III [Bordetella parapertussis
           12822]
 gi|33565847|emb|CAE36393.1| cytochrome ubiquinol oxidase subunit III [Bordetella parapertussis]
          Length = 173

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 98/173 (56%), Positives = 126/173 (72%), Gaps = 2/173 (1%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS-LSCSFAMLASAT 97
           MSDCL+FA  F TY V+G+NY  GP   ++FD+  + V+T +LLL S ++  FAML    
Sbjct: 1   MSDCLVFACLFATYGVVGRNYDGGPTGAELFDLPLVAVNTSLLLLLSSITYGFAMLEMRR 60

Query: 98  KRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVF 157
           +R I  T +WL VT   G  F+ +E+YEFAHLI   A PQRSAFLS+FF LVG HGLHV 
Sbjct: 61  QR-IGATQAWLAVTGLLGAGFLGLELYEFAHLIHQGAGPQRSAFLSAFFTLVGTHGLHVT 119

Query: 158 FGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           FG++WL  L++Q+ + GLI  N+R L+CLSMFWHFLDLIW+ VF+FVYLMGV+
Sbjct: 120 FGIVWLVTLMVQVSRHGLIPENRRCLMCLSMFWHFLDLIWVGVFTFVYLMGVL 172


>gi|296101551|ref|YP_003611697.1| cytochrome o ubiquinol oxidase subunit III [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
 gi|295056010|gb|ADF60748.1| cytochrome o ubiquinol oxidase subunit III [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
          Length = 171

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 117/172 (68%), Gaps = 1/172 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           MSDC++F   F TYAVL    A GP   D+F++  + V T +LL SS++   A +A   K
Sbjct: 1   MSDCILFCCLFATYAVLVNGTAGGPTGKDIFELPFVLVETALLLFSSITYGMAAIA-MYK 59

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
               + VSWL +T  FG  FI MEIYEF HLI     P RS FLS+FFALVG HGLHV  
Sbjct: 60  NNKSQVVSWLALTWLFGAGFIGMEIYEFHHLIMEGFGPDRSGFLSAFFALVGTHGLHVTS 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLIW+ VL+ QI ++GL S N+ R++CLS+FWHFLD++WICVFS VYLMG +
Sbjct: 120 GLIWMAVLMFQISRRGLTSTNRTRIMCLSLFWHFLDVVWICVFSVVYLMGAM 171


>gi|193212539|ref|YP_001998492.1| cytochrome o ubiquinol oxidase subunit III [Chlorobaculum parvum
           NCIB 8327]
 gi|193086016|gb|ACF11292.1| cytochrome o ubiquinol oxidase, subunit III [Chlorobaculum parvum
           NCIB 8327]
          Length = 201

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 130/193 (67%), Gaps = 6/193 (3%)

Query: 16  YVKDKKESCVDH-DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
           Y+ + KE   D  D   LGFWIYLMSD ++FA+ F T+ VLG+NYA GP P  +FD+  +
Sbjct: 9   YLAEWKEP--DRLDMQMLGFWIYLMSDLVIFAILFATFIVLGQNYAGGPGPKQLFDLPYL 66

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFF-GMIFIIMEIYEFAHLISME 133
           F  T++LL SS++  F M+A   ++   + V   LV AF  G  F++MEI+EF  LI   
Sbjct: 67  FGETMLLLTSSVAYGFGMVAMQKEK--RRAVLTGLVVAFLLGAGFVVMEIHEFHGLIMAG 124

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
             P  S FLSSFFALVG HG HV FGL+W+ V++IQ++ KG  +G + RL+ LS+FWHFL
Sbjct: 125 HGPANSGFLSSFFALVGTHGTHVSFGLLWMAVMMIQVMTKGFTAGVRSRLMRLSLFWHFL 184

Query: 194 DLIWICVFSFVYL 206
           D++W+ VF+ VYL
Sbjct: 185 DIVWVGVFTVVYL 197


>gi|254522775|ref|ZP_05134830.1| cytochrome o ubiquinol oxidase, subunit III [Stenotrophomonas sp.
           SKA14]
 gi|219720366|gb|EED38891.1| cytochrome o ubiquinol oxidase, subunit III [Stenotrophomonas sp.
           SKA14]
          Length = 212

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 92/181 (50%), Positives = 117/181 (64%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLMSDCL+FA  F TY VL      GP   D+F++  +   T +LL SSL+  
Sbjct: 33  TVFGFWVYLMSDCLIFASLFATYVVLSGGTDGGPGAKDLFELPFVAWETALLLTSSLTFG 92

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
             M+A   K++  +   WL +T   G  F+ ME++EF HLI     P RSAFLS+FFALV
Sbjct: 93  LGMIAMHRKQM-GQMYLWLAITWLLGFGFMCMEVWEFQHLIHQGYGPDRSAFLSAFFALV 151

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GL+WL V+ +Q+ K GL   N+ R+ CLS+FWHFLDLIWI VFS VYL G 
Sbjct: 152 GTHGLHVSAGLLWLLVMFVQLKKYGLTPTNKTRMACLSLFWHFLDLIWIGVFSVVYLNGA 211

Query: 210 V 210
           +
Sbjct: 212 L 212


>gi|299769503|ref|YP_003731529.1| cytochrome o ubiquinol oxidase subunit III [Acinetobacter sp. DR1]
 gi|298699591|gb|ADI90156.1| cytochrome o ubiquinol oxidase subunit III [Acinetobacter sp. DR1]
          Length = 206

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 122/184 (66%), Gaps = 4/184 (2%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVF--DISGIFVSTIVLLLSSL 86
           T  GFW YLMSD ++F   F+ +AVL  +   G P+   +F   +  +   T  LL+SS+
Sbjct: 24  TVFGFWTYLMSDLILFGSLFIAFAVLSSHVPEGTPSAYKLFHESLGYVLTETFALLISSV 83

Query: 87  SCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFF 146
           +  FA+LAS  K  +++ ++WL +T  FG  FI ME+YEF HL+     P  SAFLSSFF
Sbjct: 84  TFGFAVLASYKKN-VNQVITWLFITFLFGATFIGMELYEFHHLVEEGHGPTHSAFLSSFF 142

Query: 147 ALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
            LVG HG+HV  GL+W+ VL+ QI  KGL   N RRL CLS+FWHFLD++WICVFS VYL
Sbjct: 143 TLVGTHGIHVTSGLVWMLVLMYQIKTKGLTLPNTRRLACLSLFWHFLDIVWICVFSVVYL 202

Query: 207 MGVV 210
           +GV+
Sbjct: 203 LGVL 206


>gi|17546579|ref|NP_519981.1| transmembrane cytochrome O ubiquinol oxidase (subunit III)
           oxidoreductase [Ralstonia solanacearum GMI1000]
 gi|17428878|emb|CAD15562.1| probable transmembrane cytochrome o ubiquinol oxidase (subunit III)
           oxidoreductase protein [Ralstonia solanacearum GMI1000]
          Length = 208

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 125/196 (63%), Gaps = 10/196 (5%)

Query: 17  VKDKKESCVDHD---GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISG 73
             +       HD    T LGFW+YLMSDCL+FAV F T+ VL  + A GP    +F++  
Sbjct: 13  APEAAHPHPHHDTGFNTTLGFWLYLMSDCLIFAVLFATFGVLSGSTAGGPGGRQLFELPF 72

Query: 74  IFVSTIVLLLSSLSCSFAML---ASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
           +   T++LL+SS +   A+L   A A  R+    V WL VT   G +F+ ME+YEF+HL+
Sbjct: 73  VLAETMLLLVSSYTFGIALLKQDADAAPRM----VRWLGVTFLLGALFVGMELYEFSHLL 128

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
              A P  SA+LS+FF LVG HGLHV  GL+WL V++ Q+   GL    +RRL CLS+FW
Sbjct: 129 HEGAGPGVSAYLSAFFTLVGTHGLHVTAGLLWLAVMMHQVRHFGLDGVVRRRLACLSLFW 188

Query: 191 HFLDLIWICVFSFVYL 206
           HFLDL+WICVF+FVYL
Sbjct: 189 HFLDLVWICVFTFVYL 204


>gi|297620727|ref|YP_003708864.1| cytochrome o ubiquinol oxidase, subunit III [Waddlia chondrophila
           WSU 86-1044]
 gi|297376028|gb|ADI37858.1| cytochrome o ubiquinol oxidase, subunit III [Waddlia chondrophila
           WSU 86-1044]
          Length = 209

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 131/203 (64%), Gaps = 6/203 (2%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPID 67
            +PN S   V D  +        ++GFW+YLM+DC++FA  F+T+AVL  N   GP+  D
Sbjct: 13  PNPNTS---VPDPHQDYFSMR--FIGFWVYLMTDCILFATLFITHAVLQANTFGGPSSKD 67

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
           +FD+   F  T VLL+SS++C  A+LA+  +RL   ++++L  T   G+ F+ MEI EF 
Sbjct: 68  LFDLRLAFGETFVLLISSVTCGLAVLAAVHQRL-RTSIAFLGATIALGLSFLTMEISEFH 126

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
           H IS       SAFLSSFFALVG HGLH+ FGLIW   ++ Q+   GL     RRL+  S
Sbjct: 127 HFISEGHSWTVSAFLSSFFALVGTHGLHITFGLIWASAMICQLFYYGLTIDTFRRLVLFS 186

Query: 188 MFWHFLDLIWICVFSFVYLMGVV 210
           +FWHFLDLIWI +F+FVYL+GV+
Sbjct: 187 LFWHFLDLIWIFIFTFVYLIGVI 209


>gi|194364920|ref|YP_002027530.1| cytochrome o ubiquinol oxidase subunit III [Stenotrophomonas
           maltophilia R551-3]
 gi|194347724|gb|ACF50847.1| cytochrome o ubiquinol oxidase, subunit III [Stenotrophomonas
           maltophilia R551-3]
          Length = 212

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 92/181 (50%), Positives = 117/181 (64%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLMSDCL+FA  F TY VL      GP   D+F++  +   T +LL SSL+  
Sbjct: 33  TVFGFWVYLMSDCLIFASLFATYVVLAGGTDGGPTAKDLFELPFVAWETALLLTSSLTFG 92

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
             M+A   K++  +   WL +T   G  F+ ME++EF HLI     P RSAFLS+FFALV
Sbjct: 93  LGMIAMHRKQM-GQMYLWLGITWLLGFGFMCMEVWEFQHLIHQGYGPDRSAFLSAFFALV 151

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GL+WL V+ +Q+ K GL   N+ R+ CLS+FWHFLDLIWI VFS VYL G 
Sbjct: 152 GTHGLHVSAGLLWLLVMFVQLKKYGLTPTNKTRMACLSLFWHFLDLIWIGVFSVVYLNGA 211

Query: 210 V 210
           +
Sbjct: 212 L 212


>gi|190573373|ref|YP_001971218.1| putative quinol oxidase subunit 3 [Stenotrophomonas maltophilia
           K279a]
 gi|30351179|gb|AAP22950.1| cytochrome oxidase subunit III [Rhizobium arachis]
 gi|190011295|emb|CAQ44908.1| putative quinol oxidase subunit 3 [Stenotrophomonas maltophilia
           K279a]
          Length = 212

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 92/181 (50%), Positives = 117/181 (64%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLMSDCL+FA  F TY VL      GP   D+F++  +   T +LL SSL+  
Sbjct: 33  TVFGFWVYLMSDCLIFASLFATYVVLAGGTDGGPTAKDLFELPFVAWETALLLTSSLTFG 92

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
             M+A   K++  +   WL +T   G  F+ ME++EF HLI     P RSAFLS+FFALV
Sbjct: 93  LGMIAMHRKQM-GQMYLWLGITWLLGFGFMCMEVWEFQHLIHQGYGPDRSAFLSAFFALV 151

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GL+WL V+ +Q+ K GL   N+ R+ CLS+FWHFLDLIWI VFS VYL G 
Sbjct: 152 GTHGLHVSAGLLWLLVMFVQLKKYGLTPTNKTRMACLSLFWHFLDLIWIGVFSVVYLNGA 211

Query: 210 V 210
           +
Sbjct: 212 L 212


>gi|296115137|ref|ZP_06833778.1| cytochrome o ubiquinol oxidase subunit III [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295978238|gb|EFG84975.1| cytochrome o ubiquinol oxidase subunit III [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 201

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 90/181 (49%), Positives = 123/181 (67%), Gaps = 6/181 (3%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLM+DC++F   F  +AVL   +  GP   +VF++SG+ + T +LL SS++  F M
Sbjct: 24  GFWLYLMTDCIIFGTLFAVFAVLRTQFNGGPNGHEVFELSGVGIETAILLFSSITYGFGM 83

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A+   ++    V WL VT   G+ F+ MEI EF+H+I+    P RSAFLSSFF LVG H
Sbjct: 84  IAAHANKISTMRV-WLGVTFLLGLGFLFMEIREFSHMIAEGNGPDRSAFLSSFFTLVGTH 142

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQR---RLICLSMFWHFLDLIWICVFSFVYLMGV 209
           GLHV  GL+W+ VL+ Q   K  +  N+R   +L CLS+FWHFLD++WICVF+FVYLM V
Sbjct: 143 GLHVTCGLLWMAVLLFQTAGKTEL--NERMIGKLTCLSLFWHFLDIVWICVFTFVYLMSV 200

Query: 210 V 210
           V
Sbjct: 201 V 201


>gi|294649994|ref|ZP_06727382.1| cytochrome o ubiquinol oxidase subunit III [Acinetobacter
           haemolyticus ATCC 19194]
 gi|292824087|gb|EFF82902.1| cytochrome o ubiquinol oxidase subunit III [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 206

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 125/184 (67%), Gaps = 4/184 (2%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVFDISGIFV--STIVLLLSSL 86
           T  GFW YLMSD ++F   F+ +AVL  +   G P+  D+F  S  FV   T  LL+SS+
Sbjct: 24  TVFGFWTYLMSDLILFGSLFIAFAVLSSHIPPGTPSAYDLFHDSLGFVLAETFALLISSV 83

Query: 87  SCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFF 146
           +  FA+LAS  K  +++ + WL+VT  FG  FI MEIYEF HL+     P +SAFLS+FF
Sbjct: 84  TFGFAVLASYKKN-VNQVLLWLIVTFIFGATFIGMEIYEFHHLVHEGYGPTKSAFLSAFF 142

Query: 147 ALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
            LVG HG+HV  GL+W+ VL+ QI + GL   N RRL CLS+FWHFLD++WICVFS VYL
Sbjct: 143 TLVGTHGIHVTSGLVWMAVLMYQIKQNGLTLPNTRRLACLSLFWHFLDIVWICVFSVVYL 202

Query: 207 MGVV 210
           +GV+
Sbjct: 203 LGVL 206


>gi|71892024|ref|YP_277754.1| cytochrome o ubiquinol oxidase, subunit III [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
 gi|71796130|gb|AAZ40881.1| cytochrome o ubiquinol oxidase, subunit III [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
          Length = 195

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 92/181 (50%), Positives = 120/181 (66%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+Y+MSDC++FA  F  Y+VL  N A   +  D+F +  +F+ T  LLLSSL+  
Sbjct: 16  TIFGFWLYIMSDCILFASLFAIYSVLCNNTADCSSGKDIFSLPFVFIETCCLLLSSLTHC 75

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
             M+    K    +   W+ +T   G+ FI MEIYEF HLI +   P RSAFLSSFF LV
Sbjct: 76  KVMIY-VEKSCTKQINIWMGITFLLGLCFISMEIYEFYHLIKLGNNPCRSAFLSSFFTLV 134

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GLIW+ V++I I+ +GL   N  R+ CLS+FWHFLD+IWICVF+ VYL+GV
Sbjct: 135 GTHGLHVMAGLIWIAVMIIHIVYQGLTYTNYIRMQCLSLFWHFLDVIWICVFTEVYLLGV 194

Query: 210 V 210
           +
Sbjct: 195 L 195


>gi|50085512|ref|YP_047022.1| cytochrome o ubiquinol oxidase subunit III [Acinetobacter sp. ADP1]
 gi|49531488|emb|CAG69200.1| cytochrome o ubiquinol oxidase subunit III [Acinetobacter sp. ADP1]
          Length = 206

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 95/184 (51%), Positives = 121/184 (65%), Gaps = 4/184 (2%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVFDISGIFV--STIVLLLSSL 86
           T  GFW YLMSD ++F   F+ +AVL  +   G P   D+F  S  FV   T  LL+SS+
Sbjct: 24  TVFGFWTYLMSDLILFGTLFIAFAVLSSHVPPGTPTAHDLFSESLGFVLTETFALLISSV 83

Query: 87  SCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFF 146
           +  FA+LAS  K  +++ + WL +T  FG  FI ME+YEF HL+     P  SAFLS+FF
Sbjct: 84  TFGFAVLASYKKN-VNQVIMWLFITFVFGATFIGMELYEFHHLVHSGHGPGTSAFLSAFF 142

Query: 147 ALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
            LVG HG+HV  GL+W+ VL+ QI  KGL     RRL CLS+FWHFLD++WICVFS VYL
Sbjct: 143 TLVGTHGIHVTSGLVWMLVLIYQIKTKGLTLPTTRRLACLSLFWHFLDIVWICVFSVVYL 202

Query: 207 MGVV 210
           MGV+
Sbjct: 203 MGVL 206


>gi|332143298|ref|YP_004429036.1| cytochrome o ubiquinol oxidase subunit III (Ubiquinol oxidase chain
           C) [Alteromonas macleodii str. 'Deep ecotype']
 gi|327553320|gb|AEB00039.1| cytochrome o ubiquinol oxidase subunit III (Ubiquinol oxidase chain
           C) [Alteromonas macleodii str. 'Deep ecotype']
          Length = 171

 Score =  174 bits (441), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 89/172 (51%), Positives = 121/172 (70%), Gaps = 1/172 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           M+DCL+FA FF TYAVL  N A G +  D+F+++ + V T  LLLSS++  FAM+  A +
Sbjct: 1   MTDCLLFASFFATYAVLFMNTAGGVSGKDIFELNFVAVETAALLLSSITFGFAMIC-AHR 59

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
           +     ++WL VT   G  FI ME+YEF HLI     PQ+SAFL++FF+LVGLHGLHV  
Sbjct: 60  QNKSGALAWLAVTWALGACFIGMEVYEFHHLIEHGNGPQQSAFLTAFFSLVGLHGLHVTA 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLIW+ ++ I++ ++GL      RL CLS+FWHFLD++WICVF+ VYLMG +
Sbjct: 120 GLIWMTIMFIEVTRRGLGEQTVTRLSCLSLFWHFLDIVWICVFTVVYLMGAM 171


>gi|325275994|ref|ZP_08141819.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas sp.
           TJI-51]
 gi|324098875|gb|EGB96896.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas sp.
           TJI-51]
          Length = 171

 Score =  174 bits (440), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 117/172 (68%), Gaps = 1/172 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           M+DC++FA  F TYAVL  ++A GP+  D+F +  + V T+ LLLSS++  FAML     
Sbjct: 1   MTDCILFASLFATYAVLSGSFAGGPSGHDIFQLDFVAVETLFLLLSSITFGFAMLKMFDG 60

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
           +     + WL VT  FG  FI MEIYEF HLI     PQRS FLS FFALVG HGLHV  
Sbjct: 61  KKA-GVLGWLAVTFLFGAGFIAMEIYEFHHLIGEGFGPQRSGFLSGFFALVGTHGLHVTA 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLIW+ +++ QI K G+    + R+ CLS+FWHFLD++WICVF+ VYL+GV+
Sbjct: 120 GLIWMAIMMYQINKHGITPTAKTRMSCLSLFWHFLDVVWICVFTVVYLLGVL 171


>gi|226952680|ref|ZP_03823144.1| cytochrome o ubiquinol oxidase subunit III [Acinetobacter sp. ATCC
           27244]
 gi|226836586|gb|EEH68969.1| cytochrome o ubiquinol oxidase subunit III [Acinetobacter sp. ATCC
           27244]
          Length = 206

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 95/184 (51%), Positives = 125/184 (67%), Gaps = 4/184 (2%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVFDISGIFV--STIVLLLSSL 86
           T  GFW YLMSD ++F   F+ +AVL  +   G P+  D+F  S  FV   T  LL+SS+
Sbjct: 24  TVFGFWTYLMSDLILFGSLFIAFAVLSSHIPPGTPSAYDLFHDSLGFVLAETFALLISSV 83

Query: 87  SCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFF 146
           +  FA+LAS  K  +++ + WL+VT  FG  FI MEIYEF HL+     P +SAFLS+FF
Sbjct: 84  TFGFAVLASYKKN-VNQVLLWLIVTFIFGATFIGMEIYEFHHLVHEGYGPTKSAFLSAFF 142

Query: 147 ALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
            LVG HG+HV  GL+W+ VL+ QI + GL   N RRL CLS+FWHFLD++WICVFS V+L
Sbjct: 143 TLVGTHGIHVTSGLVWMAVLMYQIKQNGLTLPNTRRLACLSLFWHFLDIVWICVFSVVHL 202

Query: 207 MGVV 210
           +GV+
Sbjct: 203 LGVL 206


>gi|32490898|ref|NP_871152.1| hypothetical protein WGLp149 [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|25166104|dbj|BAC24295.1| cyoC [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 205

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 91/191 (47%), Positives = 123/191 (64%), Gaps = 1/191 (0%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTI 79
             ES        LGFW+YLMSDC++FA  F TY VL  N A GP+  ++F+I  +F+ TI
Sbjct: 15  NNESNNHEKTKILGFWVYLMSDCILFATLFATYFVLKDNVANGPSGKEIFEIPLVFLETI 74

Query: 80  VLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS 139
           +LL SS++CS A  +      I KT  WL +T   G+IFI +EI EF  LI     P RS
Sbjct: 75  ILLSSSMTCSIASFSIKKNNKI-KTNIWLFITVILGIIFINIEISEFYSLICKNYGPDRS 133

Query: 140 AFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWIC 199
           AFLS FF +VG HG+HV  G+IW+ V++IQI   G    N+ RL  LS+FW+FL++IWI 
Sbjct: 134 AFLSIFFTIVGTHGVHVISGIIWMIVIMIQIYFYGCDKINKIRLKLLSLFWYFLEIIWIF 193

Query: 200 VFSFVYLMGVV 210
           VF+ +YL+G++
Sbjct: 194 VFNVIYLLGII 204


>gi|304414865|ref|ZP_07395783.1| cytochrome o ubiquinol oxidase subunit III [Candidatus Regiella
           insecticola LSR1]
 gi|304283134|gb|EFL91548.1| cytochrome o ubiquinol oxidase subunit III [Candidatus Regiella
           insecticola LSR1]
          Length = 210

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 125/178 (70%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWIYLMSDC++FA  F  YAVL    A GP+  D+FD+  + + T +LLLSS++   AM
Sbjct: 34  GFWIYLMSDCILFAALFANYAVLVNGIADGPSGKDIFDLRFVLIETFLLLLSSITYGIAM 93

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           L    K   ++    L +T   G+ F+ MEI+EF  LI+    P RSAFLSSFFALV  H
Sbjct: 94  LG-INKGCKNQVNISLALTFILGLGFVAMEIFEFHELIAEGYGPDRSAFLSSFFALVATH 152

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           G+HV  GLIW+ +++IQ++++GL + NQ RL+CLS+FWHFLD++WICVF+ VYL+G +
Sbjct: 153 GIHVSAGLIWIIIMIIQVMRRGLNTTNQTRLMCLSLFWHFLDVVWICVFTIVYLLGAM 210


>gi|300702889|ref|YP_003744490.1| cytochrome o ubiquinol oxidase subunit III [Ralstonia solanacearum
           CFBP2957]
 gi|299070551|emb|CBJ41846.1| cytochrome o ubiquinol oxidase, subunit III [Ralstonia solanacearum
           CFBP2957]
          Length = 211

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 120/178 (67%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSD ++FA  F T+ VL    A GP   ++FD+S + + T +LL+SS++    M
Sbjct: 35  GFWVYLMSDLILFASLFATFCVLRSATAGGPNGKELFDLSYVLIETGILLVSSITYGMVM 94

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +   + R   + + WL +T   G  F+ MEI EF HLI+  A P RSAFLSSFF LVG H
Sbjct: 95  IGLQSGR-KDQVMLWLGITFLLGAAFVGMEINEFHHLIAEGAGPSRSAFLSSFFTLVGTH 153

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GL+W+ VL+ QI +KGL + N  RL CLS+FWHFLD++WI VF+ VYL+G +
Sbjct: 154 GLHVASGLLWIAVLMWQISRKGLTATNSTRLACLSLFWHFLDVVWIGVFTVVYLLGAM 211


>gi|83747512|ref|ZP_00944550.1| Cytochrome O ubiquinol oxidase subunit III [Ralstonia solanacearum
           UW551]
 gi|83725826|gb|EAP72966.1| Cytochrome O ubiquinol oxidase subunit III [Ralstonia solanacearum
           UW551]
          Length = 211

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 120/178 (67%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSD ++FA  F T+ VL    A GP   ++FD+S + + T +LL+SS++    M
Sbjct: 35  GFWVYLMSDLILFASLFATFCVLRSATAGGPNGKELFDLSYVLIETGILLVSSITYGMVM 94

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +   + R   + + WL +T   G  F+ MEI EF HLI+  A P RSAFLSSFF LVG H
Sbjct: 95  IGLQSGR-KDQVMLWLGITFLLGAAFVGMEINEFHHLIAEGAGPSRSAFLSSFFTLVGTH 153

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GL+W+ VL+ QI +KGL + N  RL CLS+FWHFLD++WI VF+ VYL+G +
Sbjct: 154 GLHVASGLLWIAVLMWQISRKGLTATNSTRLACLSLFWHFLDVVWIGVFTVVYLLGAM 211


>gi|328470436|gb|EGF41347.1| cytochrome o ubiquinol oxidase subunit III [Vibrio parahaemolyticus
           10329]
          Length = 171

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 115/172 (66%), Gaps = 1/172 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           MSDC++FA  F TYAVL  N  AGP   ++F++  +FV T++LL SS++  F ++A   +
Sbjct: 1   MSDCVLFATLFATYAVLSSNSIAGPTGKEIFELPFVFVETMLLLFSSITFGFGIIA-MKR 59

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
             +     W+LVT   G+ FI ME+YEF HLI     PQ SAFLS+FF LVG HGLHV F
Sbjct: 60  NDVAGLKRWMLVTFALGLGFICMEVYEFHHLIKEGYGPQTSAFLSAFFTLVGTHGLHVTF 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLIWL V   Q+  KGL      R  CLS+FWHFLD++WICVF+ VYLMGV+
Sbjct: 120 GLIWLVVAYHQLSTKGLNDNMAMRFNCLSLFWHFLDIVWICVFTIVYLMGVM 171


>gi|300690264|ref|YP_003751259.1| cytochrome o ubiquinol oxidase, subunit III [Ralstonia solanacearum
           PSI07]
 gi|299077324|emb|CBJ49950.1| cytochrome o ubiquinol oxidase, subunit III [Ralstonia solanacearum
           PSI07]
          Length = 211

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 119/178 (66%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSD ++FA  F T+ VL    A GP   ++FD+S + + T +LL+SS++    M
Sbjct: 35  GFWVYLMSDLILFASLFATFCVLRSATAGGPDGKELFDLSYVLIETGILLVSSITYGMVM 94

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +     R   + + WL +T   G  F+ MEI EF HLI+  A P RSAFLSSFF LVG H
Sbjct: 95  IGLQAGR-KDQVMLWLGITFLLGAAFVGMEINEFHHLIAEGAGPSRSAFLSSFFTLVGTH 153

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GL+W+ VL+ QI +KGL + N  RL CLS+FWHFLD++WI VF+ VYL+G +
Sbjct: 154 GLHVASGLLWIAVLMWQISRKGLTATNSTRLACLSLFWHFLDVVWIGVFTVVYLLGAM 211


>gi|299065535|emb|CBJ36706.1| cytochrome o ubiquinol oxidase, subunit III [Ralstonia solanacearum
           CMR15]
          Length = 211

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 89/176 (50%), Positives = 118/176 (67%), Gaps = 1/176 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSD ++FA  F T+ VL    A GP   ++FD+S + + T +LL+SS++    M
Sbjct: 35  GFWVYLMSDLIIFASLFATFCVLRSATAGGPDGKELFDLSYVLIETGILLVSSITYGMVM 94

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +     R   + + WL +T   G  F+ MEI EF HLI+  A P RSAFLSSFF LVG H
Sbjct: 95  VGLQAGR-KDQVLLWLGITFLLGAAFVGMEINEFHHLIAEGAGPNRSAFLSSFFTLVGTH 153

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           GLHV  GL+W+ VL+ QI +KGL + N  RL CLS+FWHFLD++WI VF+ VYL+G
Sbjct: 154 GLHVASGLLWIAVLMWQISRKGLTTTNSTRLACLSLFWHFLDVVWIGVFTVVYLLG 209


>gi|254524322|ref|ZP_05136377.1| cytochrome o ubiquinol oxidase, subunit III [Stenotrophomonas sp.
           SKA14]
 gi|219721913|gb|EED40438.1| cytochrome o ubiquinol oxidase, subunit III [Stenotrophomonas sp.
           SKA14]
          Length = 211

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 89/176 (50%), Positives = 117/176 (66%), Gaps = 1/176 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           G W+YLMSD ++F   F +YAVL   YA GP   D+F +  +   T +LL+SS++   A+
Sbjct: 35  GMWVYLMSDLVLFGSLFASYAVLSTAYAGGPTGKDLFSLPFVMAETFLLLVSSITYGQAV 94

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           LA   +      + WL VT   G  FI MEIYEF+HLI   A P  SA+LS+FFALV  H
Sbjct: 95  LA-MHRHDASAVLRWLGVTFVLGASFIGMEIYEFSHLIHEGAGPSTSAYLSAFFALVATH 153

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           GLHV  GLIW+ V++ Q+ ++GL   N  R+ CLS+FWHFLDL+WICVF+FVYL+G
Sbjct: 154 GLHVASGLIWMAVVMHQVYRRGLTPTNITRVSCLSLFWHFLDLVWICVFTFVYLIG 209


>gi|212638123|ref|YP_002314643.1| cytochrome aa3 quinol oxidase subunit III [Anoxybacillus
           flavithermus WK1]
 gi|212559603|gb|ACJ32658.1| Cytochrome aa3 quinol oxidase subunit III [Anoxybacillus
           flavithermus WK1]
          Length = 201

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 82/179 (45%), Positives = 120/179 (67%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F  Y VLG  YA GP P D+F ++ + + T++LL SS +C  A
Sbjct: 23  LGFWIFLGAEIVLFATLFAVYGVLGHRYAGGPTPSDIFKLNDVLIETLLLLTSSFTCGLA 82

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +     +R + K + WL++T   G  F+ MEI EF H +   A  Q SAFLSSFF L+G 
Sbjct: 83  VFF-MRQRDMKKLLVWLIITLLLGAGFLFMEIREFIHYVHEGATMQTSAFLSSFFVLLGT 141

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV FG+IW  +L+IQ+L++GL     R++  +S++WHFLD++WI +F+FVYL G+V
Sbjct: 142 HGAHVTFGIIWAVMLIIQLLQRGLTPMTARKMFIISLYWHFLDVVWIFIFTFVYLKGMV 200


>gi|17547634|ref|NP_521036.1| transmembrane cytochrome O ubiquinol oxidase (subunit III)
           oxidoreductase [Ralstonia solanacearum GMI1000]
 gi|17429938|emb|CAD16622.1| probable transmembrane cytochrome o ubiquinol oxidase (subunit III)
           oxidoreductase protein [Ralstonia solanacearum GMI1000]
          Length = 211

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 89/176 (50%), Positives = 118/176 (67%), Gaps = 1/176 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSD ++FA  F T+ VL    A GP   ++FD+S + + T +LL+SS++    M
Sbjct: 35  GFWVYLMSDLIIFASLFATFCVLRSATAGGPDGKELFDLSYVLIETGILLVSSITYGMVM 94

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +     R   + + WL +T   G  F+ MEI EF HLI+  A P RSAFLSSFF LVG H
Sbjct: 95  VGLQAGR-KDQVMLWLGITFLLGAAFVGMEINEFHHLIAEGAGPSRSAFLSSFFTLVGTH 153

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           GLHV  GL+W+ VL+ QI +KGL + N  RL CLS+FWHFLD++WI VF+ VYL+G
Sbjct: 154 GLHVASGLLWIAVLMWQISRKGLTTTNSTRLACLSLFWHFLDVVWIGVFTVVYLLG 209


>gi|225626591|ref|ZP_03784630.1| cytochrome o ubiquinol oxidase, subunit III [Brucella ceti str.
           Cudo]
 gi|225618248|gb|EEH15291.1| cytochrome o ubiquinol oxidase, subunit III [Brucella ceti str.
           Cudo]
          Length = 171

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 116/172 (67%), Gaps = 1/172 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           MSDC++F+  F TYAVL   +A GP   ++FD+  + V T++LL+SSL+   A L S  K
Sbjct: 1   MSDCILFSGLFATYAVLAHQFAGGPTGRELFDLQFVLVETMLLLVSSLTYGLATL-SMYK 59

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
                 + WL VT   G  F+ MEIYEF HLI   A P RS+FLS+FF LVG HGLH+  
Sbjct: 60  NNRSGVLGWLGVTFLLGAAFLAMEIYEFHHLIVEGAGPDRSSFLSAFFTLVGTHGLHITS 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLIW+ VL   +L+ GL   N+ R++CLS+FWHFLD+IWI VF+ VYL+GV+
Sbjct: 120 GLIWILVLSAMLLRDGLTERNRTRVMCLSLFWHFLDIIWIGVFTLVYLLGVL 171


>gi|194367565|ref|YP_002030175.1| cytochrome o ubiquinol oxidase subunit III [Stenotrophomonas
           maltophilia R551-3]
 gi|194350369|gb|ACF53492.1| cytochrome o ubiquinol oxidase, subunit III [Stenotrophomonas
           maltophilia R551-3]
          Length = 211

 Score =  171 bits (432), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 89/176 (50%), Positives = 116/176 (65%), Gaps = 1/176 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           G W+YLMSD ++F   F +YAVL   YA GP   D+F +  +   T +LL+SS++   A+
Sbjct: 35  GMWVYLMSDLVLFGSLFASYAVLSTAYAGGPTGKDLFSLPFVMAETFLLLVSSITYGQAV 94

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           LA   +      + WL VT   G  FI MEIYEF+HLI   A P  SA+LS+FFALV  H
Sbjct: 95  LA-MHRHDTSAVLRWLGVTFVLGASFIGMEIYEFSHLIHEGAGPSTSAYLSAFFALVATH 153

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           GLHV  GLIW+ V++ Q+  +GL   N  R+ CLS+FWHFLDL+WICVF+FVYL+G
Sbjct: 154 GLHVASGLIWMAVVMHQVYSRGLTPTNITRVSCLSLFWHFLDLVWICVFTFVYLIG 209


>gi|332992079|gb|AEF02134.1| cytochrome o ubiquinol oxidase subunit III [Alteromonas sp. SN2]
          Length = 171

 Score =  171 bits (432), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 88/170 (51%), Positives = 118/170 (69%), Gaps = 1/170 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           M+DCL+FA F  TYAVL  N A G +  D+F+++ + V T  LL+SS++  FAM+  A K
Sbjct: 1   MTDCLLFASFLATYAVLFMNTAGGVSGKDIFELNFVAVETAALLVSSITFGFAMIC-AHK 59

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
           +     ++WL +T   G  FI ME+YEF HLI     PQ SAFL++FF+LVGLHGLHV  
Sbjct: 60  QNKSGALAWLAITWVLGATFIGMEVYEFHHLIVHGNGPQESAFLTAFFSLVGLHGLHVTS 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           GLIW+ +L I++ ++GL      RL CLS+FWHFLD++WICVF+ VYLMG
Sbjct: 120 GLIWMTILFIEVSRRGLPEKTVTRLSCLSLFWHFLDIVWICVFTVVYLMG 169


>gi|319778051|ref|YP_004134481.1| cytochrome c oxidase subunit iii [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317171770|gb|ADV15307.1| cytochrome c oxidase subunit III [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 228

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 116/177 (65%), Gaps = 1/177 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWI+L+SD ++F+ FF  YAVL K  A GP   D+F+ + + V T +LL SS +   A 
Sbjct: 51  GFWIFLLSDIIIFSAFFAAYAVLAKATAGGPTGKDLFEPTRVAVQTGLLLTSSFTGGLAT 110

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           LA+  +R +  T +WLLVT   G  F+ +E+ EFA +I  +A P RSAFLS+FFALVG H
Sbjct: 111 LAT-HRRSMAATQAWLLVTGLLGAAFLFLEVQEFAAMIGEQAGPSRSAFLSAFFALVGCH 169

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HV  GL+WL  ++ Q+  KG  S   RRL C  +FWH LD+IW+ +F+ VYL+G 
Sbjct: 170 GTHVGLGLLWLGTMMAQLWVKGFRSDILRRLHCFGLFWHALDIIWVAIFTLVYLLGA 226


>gi|190576213|ref|YP_001974058.1| putative cytochrome o ubiquinol oxidase subunit III
           [Stenotrophomonas maltophilia K279a]
 gi|190014135|emb|CAQ47774.1| putative cytochrome o ubiquinol oxidase subunit III
           [Stenotrophomonas maltophilia K279a]
          Length = 211

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 117/176 (66%), Gaps = 1/176 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           G W+YLMSD ++F   F +YAVL   YA GP   ++F +  +   T +LL+SS++   A+
Sbjct: 35  GMWVYLMSDLVLFGSLFASYAVLSTAYAGGPTGKELFSLPFVMAETFLLLVSSITYGQAV 94

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           LA   +      + WL VT   G  FI MEIYEF+HLI   A P  SA+LS+FFALV  H
Sbjct: 95  LA-MHRHDTSAVLRWLGVTFVLGASFIGMEIYEFSHLIHEGAGPSTSAYLSAFFALVATH 153

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           GLHV  GLIW+ V++ Q+ ++GL   N  R+ CLS+FWHFLDL+WICVF+FVYL+G
Sbjct: 154 GLHVASGLIWMAVVMHQVYRRGLTPTNITRVSCLSLFWHFLDLVWICVFTFVYLIG 209


>gi|90579541|ref|ZP_01235350.1| Cytochrome c oxidase, subunit III [Vibrio angustum S14]
 gi|90439115|gb|EAS64297.1| Cytochrome c oxidase, subunit III [Vibrio angustum S14]
          Length = 214

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 86/181 (47%), Positives = 117/181 (64%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFWIY++SDCL+F   F  +AV   ++A    P ++F+++ +   T +LLLSS +  
Sbjct: 35  TIFGFWIYILSDCLLFGTLFAVFAVFSNSFAGQIEPTELFNLTFVAGETALLLLSSFTFG 94

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
            AML  A K  +   + WL +T   G+ F++ME+YEF H  +  A    SA+ SSF+ALV
Sbjct: 95  MAML-KANKEDMKGMLKWLGITFALGLSFLVMELYEFWHFSNEGATFHSSAYWSSFYALV 153

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
             HGLHVF GLIW+ VL +   + G    N+ RL CLS+FWHFLD+IWICVFS VYLMGV
Sbjct: 154 ATHGLHVFAGLIWMIVLFVHFKRDGFSEDNKTRLACLSLFWHFLDVIWICVFSVVYLMGV 213

Query: 210 V 210
           +
Sbjct: 214 L 214


>gi|258510523|ref|YP_003183957.1| cytochrome c oxidase subunit III [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257477249|gb|ACV57568.1| cytochrome c oxidase subunit III [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 202

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 118/178 (66%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW++L +D L+F   F TY VL  +   GP PI +FDI G  + T  LL SS +   A 
Sbjct: 24  GFWVFLATDMLLFGCLFATYLVLRTHTDGGPTPIQIFDIPGFTLETFFLLTSSFTGGIAT 83

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
            A  + R   +TVSW+LVT  FG+ FI++E  EFAH +++ A   RSAFLS+FF LVG H
Sbjct: 84  WAMRSGRQ-KQTVSWMLVTMMFGLAFILLEATEFAHDVTVGATIGRSAFLSAFFTLVGTH 142

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           G HV  GL+W+F+ ++Q+LK G+     R++  ++++WHFLD++W+ +F+ VYL GVV
Sbjct: 143 GSHVSIGLVWMFLTMLQVLKHGITPQTARKVFVVNLYWHFLDVVWVFIFTVVYLSGVV 200


>gi|260459334|ref|ZP_05807589.1| cytochrome c oxidase subunit III [Mesorhizobium opportunistum
           WSM2075]
 gi|259034888|gb|EEW36144.1| cytochrome c oxidase subunit III [Mesorhizobium opportunistum
           WSM2075]
          Length = 228

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 116/177 (65%), Gaps = 1/177 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWI+L+SD ++F+ FF  YAVL K  A GP   ++F+ + + V T +LL SS +   A 
Sbjct: 51  GFWIFLLSDIIIFSAFFAAYAVLAKATAGGPTGKELFEPTRVAVQTGLLLTSSFTGGLAT 110

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           LA+  +R +  T +WLLVT   G  F+ +E+ EFA +I  +A P RSAFLS+FFALVG H
Sbjct: 111 LAT-DRRSMAATQAWLLVTGLLGAAFLFLEVQEFAAMIGEQAGPSRSAFLSAFFALVGCH 169

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HV  GL+WL  ++ Q+  KG  S   RRL C  +FWH LD+IW+ +F+ VYL+G 
Sbjct: 170 GTHVGLGLLWLGTMMAQLWVKGFRSDILRRLHCFGLFWHALDIIWVAIFTLVYLLGA 226


>gi|254472596|ref|ZP_05085995.1| Cytochrome o ubiquinol oxidase subunit 3 [Pseudovibrio sp. JE062]
 gi|211958060|gb|EEA93261.1| Cytochrome o ubiquinol oxidase subunit 3 [Pseudovibrio sp. JE062]
          Length = 202

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 121/179 (67%), Gaps = 5/179 (2%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFW+YLM+D ++F++ F TY V+ +N A GP PI+VFDI  +F  T+ LL SS++  FA
Sbjct: 24  LGFWLYLMTDAIIFSLLFATYVVMFQNTATGPLPIEVFDIKHVFGETMFLLFSSVTFGFA 83

Query: 92  MLASATKRLIHKT--VSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
            LAS  +   HK+  V WL+VT   G+ FI +E+ EF  +I   A PQ S FL++FF LV
Sbjct: 84  SLASVRE---HKSQAVFWLIVTIVLGLGFISLEVIEFIGMIQSGAGPQTSGFLTAFFTLV 140

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           G HG HV  G+I + V++ QIL KGL S  + RL  L MFWHFLD++WI +FS VY+ G
Sbjct: 141 GTHGAHVSLGMIGILVMIFQILIKGLTSPVKSRLHRLGMFWHFLDIVWIGIFSIVYMPG 199


>gi|330957414|gb|EGH57674.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. maculicola str. ES4326]
          Length = 171

 Score =  168 bits (426), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 89/172 (51%), Positives = 118/172 (68%), Gaps = 1/172 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           M+DC++FA FF  YAV+  + A GP+  D+F +  + V T  LL+SS++  FAMLA   K
Sbjct: 1   MTDCVLFASFFAVYAVMVNSVAGGPSGQDIFLLPFVAVETAFLLVSSITYGFAMLA-LYK 59

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
               + + WL +T   G  FI MEIYEF HLI     P RS FLS+FFALVGLHG+HV  
Sbjct: 60  GKKSQVLGWLALTFLCGAAFIGMEIYEFHHLIEEGFGPSRSGFLSAFFALVGLHGVHVTS 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLIW+ +++ Q+ KKGL + N+ RL CLS+FWHFLD++WI VF+ VYLMG +
Sbjct: 120 GLIWMAIMMFQVQKKGLTNTNKTRLSCLSLFWHFLDVVWIGVFTVVYLMGAL 171


>gi|58040343|ref|YP_192307.1| cytochrome o ubiquinol oxidase subunit III [Gluconobacter oxydans
           621H]
 gi|58002757|gb|AAW61651.1| Cytochrome o ubiquinol oxidase subunit III [Gluconobacter oxydans
           621H]
          Length = 205

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 125/192 (65%), Gaps = 8/192 (4%)

Query: 26  DHDGTY------LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTI 79
           DH G +       GFW+YLM+DC++F   F  +AVL   +A GP+  ++FD++ + + T 
Sbjct: 15  DHHGEHHESPNVFGFWLYLMTDCVLFGSIFAAFAVLRNQFAGGPSGKELFDLTNVGIETA 74

Query: 80  VLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS 139
           +LL SS++  FA L +  K      + WL VT   G+ F+ +E+ EF+ +I+    P RS
Sbjct: 75  ILLFSSITYGFASLNALAKN-KKMVLLWLAVTFVLGVSFVGLELNEFSSMIAEGNGPDRS 133

Query: 140 AFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGN-QRRLICLSMFWHFLDLIWI 198
           AFLS+FF LVG HGLHV  GLIW+ VL++Q++    +S     +L CLS+FWHFLD++WI
Sbjct: 134 AFLSAFFTLVGTHGLHVTCGLIWMVVLMVQMMGPQDLSERMMNKLACLSLFWHFLDIVWI 193

Query: 199 CVFSFVYLMGVV 210
           CVFSFVYL GV+
Sbjct: 194 CVFSFVYLAGVM 205


>gi|330873014|gb|EGH07163.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. morsprunorum str. M302280PT]
 gi|330963122|gb|EGH63382.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. actinidiae str. M302091]
          Length = 171

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 89/172 (51%), Positives = 118/172 (68%), Gaps = 1/172 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           M+DC++FA FF  YAV+  + A GP+  D+F +  + V T  LL+SS++  FAMLA   K
Sbjct: 1   MTDCVLFASFFAVYAVMVNSVAGGPSGQDIFLLPFVAVETAFLLVSSITYGFAMLA-LYK 59

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
               + + WL +T   G  FI MEIYEF HLI     P RS FLS+FFALVGLHG+HV  
Sbjct: 60  GKKSQVLGWLALTFLCGAAFIGMEIYEFHHLIHEGYGPSRSGFLSAFFALVGLHGVHVTS 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLIW+ +++ Q+ KKGL + N+ RL CLS+FWHFLD++WI VF+ VYLMG +
Sbjct: 120 GLIWMAIMMFQVQKKGLTNTNKTRLSCLSLFWHFLDVVWIGVFTVVYLMGAL 171


>gi|329114806|ref|ZP_08243563.1| Ubiquinol oxidase subunit III [Acetobacter pomorum DM001]
 gi|326695937|gb|EGE47621.1| Ubiquinol oxidase subunit III [Acetobacter pomorum DM001]
          Length = 201

 Score =  168 bits (425), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 82/179 (45%), Positives = 120/179 (67%), Gaps = 2/179 (1%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLM+DC++F   F  +AVL   +  GP   ++F+  G+ + T +LL+SS++  F M
Sbjct: 24  GFWVYLMTDCIIFGTLFAVFAVLRNQFNGGPTGHELFEFGGLGLETALLLVSSITYGFGM 83

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A A K  + K + WL VT   G+ F+ +E+ EFAH+I+  A P RSAFLS+FF LV  H
Sbjct: 84  IA-AHKSQVSKVILWLGVTFLLGLGFVGLELREFAHMIAEGAGPDRSAFLSAFFTLVSTH 142

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGN-QRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+  L++Q++    I      +L CLS+FWHFLD++WICVF++VYL  ++
Sbjct: 143 GLHVTCGLIWIVTLIVQLMGTTEIPERMMNKLTCLSLFWHFLDIVWICVFTYVYLASMI 201


>gi|330969179|gb|EGH69245.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. aceris str. M302273PT]
          Length = 171

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 89/172 (51%), Positives = 117/172 (68%), Gaps = 1/172 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           M+DC++FA FF  YAV+  + A GP+  D+F +  + V T  LL+SS++  FAMLA   K
Sbjct: 1   MTDCVLFASFFAVYAVMVNSVAGGPSGQDIFLLPFVAVETAFLLVSSITYGFAMLA-LYK 59

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
               + + WL +T   G  FI MEIYEF HLI     P RS FLS+FFALVGLHG HV  
Sbjct: 60  GNKSQVLGWLALTFLCGAAFIGMEIYEFHHLIEEGYGPSRSGFLSAFFALVGLHGAHVTS 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLIW+ +++ Q+ KKGL + N+ RL CLS+FWHFLD++WI VF+ VYLMG +
Sbjct: 120 GLIWMAIMMFQVQKKGLTNTNKARLSCLSLFWHFLDVVWIGVFTVVYLMGAL 171


>gi|330870267|gb|EGH04976.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. aesculi str. 0893_23]
 gi|330874427|gb|EGH08576.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. glycinea str. race 4]
 gi|330890460|gb|EGH23121.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. mori str. 301020]
 gi|330988097|gb|EGH86200.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. lachrymans str. M301315]
 gi|331009079|gb|EGH89135.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. tabaci ATCC 11528]
          Length = 171

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 89/172 (51%), Positives = 117/172 (68%), Gaps = 1/172 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           M+DC++FA FF  YAV+  + A GP+  D+F +  + V T  LL+SS++  FAMLA   K
Sbjct: 1   MTDCVLFASFFAVYAVMVNSVAGGPSGQDIFLLPFVAVETAFLLVSSITYGFAMLA-LYK 59

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
               + + WL +T   G  FI MEIYEF HLI     P RS FLS+FFALVGLHG HV  
Sbjct: 60  GKKSQVLGWLALTFLCGAAFIGMEIYEFHHLIHEGYGPSRSGFLSAFFALVGLHGAHVTS 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLIW+ +++ Q+ KKGL + N+ RL CLS+FWHFLD++WI VF+ VYLMG +
Sbjct: 120 GLIWMAIMMFQVQKKGLTNTNKTRLSCLSLFWHFLDVVWIGVFTVVYLMGAL 171


>gi|20378345|gb|AAM20916.1|AF439739_3 cytochrome bo subunit C [Vitreoscilla sp. C1]
          Length = 210

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 123/182 (67%), Gaps = 4/182 (2%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVF-DISG-IFVSTIVLLLSSLSCS 89
           LGFWIY+M+D ++F   F+ + VL ++ A G    ++F D  G +FV TIVLL SS +  
Sbjct: 29  LGFWIYIMTDLILFCTLFIGFQVLREHSAGGATEYEIFKDTLGFVFVETIVLLASSFTFG 88

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
            A  A A K  + K   WL+ T   G IFI ME+YEF+HLI     PQ SAFL+S+F+LV
Sbjct: 89  MAHFAQAQKN-VAKLQFWLIATFVLGAIFIGMEVYEFSHLIHAGHTPQSSAFLTSYFSLV 147

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLIS-GNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           G HGLHV  GLIWL VL++Q+ K GL +    RRL+ LS+FWHFLD++W+CV++ VYL+G
Sbjct: 148 GTHGLHVTSGLIWLAVLIVQVGKFGLDNPAVNRRLMMLSIFWHFLDIVWVCVYTEVYLLG 207

Query: 209 VV 210
            +
Sbjct: 208 AI 209


>gi|330895788|gb|EGH28077.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. japonica str. M301072PT]
 gi|330939015|gb|EGH42487.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. pisi str. 1704B]
          Length = 171

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 118/172 (68%), Gaps = 1/172 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           M+DC++FA FF  YAV+  + A GP+  D+F +  + V T  LL+SS++  FAMLA   K
Sbjct: 1   MTDCVLFASFFAVYAVMVNSVAGGPSGQDIFLLPFVAVETAFLLVSSITYGFAMLA-LYK 59

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
               + + WL +T   G  FI ME+YEF HLI     P RS FLS+FFALVGLHG+HV  
Sbjct: 60  GNKSQVLGWLALTFLCGAAFIGMEVYEFHHLIEEGFGPSRSGFLSAFFALVGLHGVHVTS 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLIW+ +++ Q+ KKGL + N+ RL CLS+FWHFLD++WI VF+ VYLMG +
Sbjct: 120 GLIWMAIMMFQVQKKGLTNTNKTRLSCLSLFWHFLDVVWIGVFTVVYLMGAL 171


>gi|89073978|ref|ZP_01160484.1| ubiquinol oxidase subunit III [Photobacterium sp. SKA34]
 gi|89050306|gb|EAR55810.1| ubiquinol oxidase subunit III [Photobacterium sp. SKA34]
          Length = 214

 Score =  167 bits (424), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 85/181 (46%), Positives = 116/181 (64%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFWIY++SDCL+F   F  +AV   ++A    P ++F+++ +   T +LLLSS +  
Sbjct: 35  TIFGFWIYILSDCLLFGTLFAVFAVFSNSFAGQIEPTELFNLTFVAGETALLLLSSFTFG 94

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
            AML  A    +   + WL +T   G+ F++ME+YEF H  +  A    SA+ SSF+ALV
Sbjct: 95  MAML-KANNENMKGMLKWLGITFALGLSFLVMELYEFWHFSNEGATFHSSAYWSSFYALV 153

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
             HGLHVF GLIW+ VL +   + G    N+ RL CLS+FWHFLD+IWICVFS VYLMGV
Sbjct: 154 ATHGLHVFAGLIWMTVLFVHFKRDGFSEDNKTRLACLSLFWHFLDVIWICVFSVVYLMGV 213

Query: 210 V 210
           +
Sbjct: 214 L 214


>gi|303246929|ref|ZP_07333205.1| cytochrome o ubiquinol oxidase, subunit III [Desulfovibrio
           fructosovorans JJ]
 gi|302491636|gb|EFL51519.1| cytochrome o ubiquinol oxidase, subunit III [Desulfovibrio
           fructosovorans JJ]
          Length = 204

 Score =  167 bits (424), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 124/189 (65%), Gaps = 6/189 (3%)

Query: 26  DHDGT---YLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLL 82
           DHD      LGFW+YLM+D ++F+  F TY VL  N A GP+  ++F +  +FV T++LL
Sbjct: 17  DHDAPGLHALGFWLYLMTDLIVFSALFATYVVLAPNTAGGPSARELFHLPEVFVETMLLL 76

Query: 83  LSSLSCSFAMLA-SATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAF 141
            SS+   +A LA  A K+ +   ++ L +T   G+ FI+ME+ EF  LI   A PQRS F
Sbjct: 77  TSSVVFGYASLALGAGKKGL--GLAGLALTFLLGLGFIVMELGEFHRLILAGAGPQRSGF 134

Query: 142 LSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVF 201
           LS+FF LVG HG HV  GL+WL V++ QIL KGL    + RL  L MFWHFLD+IWI +F
Sbjct: 135 LSAFFTLVGTHGAHVTVGLLWLAVMMGQILTKGLTVPVRSRLARLGMFWHFLDIIWIGLF 194

Query: 202 SFVYLMGVV 210
           + VYLMGV+
Sbjct: 195 TVVYLMGVM 203


>gi|330950893|gb|EGH51153.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           Cit 7]
          Length = 171

 Score =  167 bits (423), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 117/172 (68%), Gaps = 1/172 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           M+DC++FA FF  YAV+  + A GP+  D+F +  + V T  LL+SS++  FAMLA   K
Sbjct: 1   MTDCVLFASFFAVYAVMVNSVAGGPSGQDIFLLPFVAVETAFLLVSSITYGFAMLA-LYK 59

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
               + + WL +T   G  FI MEIYEF HLI     P RS FLS+FFALVGLHG HV  
Sbjct: 60  GNKSQVLGWLALTFLCGAAFIGMEIYEFHHLIEEGYGPSRSGFLSAFFALVGLHGAHVTS 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLIW+ +++ Q+ K+GL + N+ RL CLS+FWHFLD++WI VF+ VYLMG +
Sbjct: 120 GLIWMAIMMFQVQKRGLTNTNKTRLSCLSLFWHFLDVVWIGVFTVVYLMGAL 171


>gi|226314760|ref|YP_002774656.1| quinol oxidase polypeptide III [Brevibacillus brevis NBRC 100599]
 gi|226097710|dbj|BAH46152.1| quinol oxidase polypeptide III [Brevibacillus brevis NBRC 100599]
          Length = 198

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/177 (46%), Positives = 119/177 (67%), Gaps = 3/177 (1%)

Query: 34  FWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAML 93
           FWIYLM+D ++FA  F TY VL  +   GP P D+F +SGI+ ST +LL SS +   A+L
Sbjct: 23  FWIYLMTDVILFATLFATYIVLQGSTDGGPGPKDLFQMSGIYASTFILLTSSFTSGLAIL 82

Query: 94  A-SATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           A +   RL    ++WL VT F G  F+ +EI EF H++S  A    SAFL++F+ LVG H
Sbjct: 83  AMNKGNRL--ALMNWLGVTVFLGASFLFLEINEFIHMVSEGATIGTSAFLTAFYTLVGTH 140

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           GLHV  G+ W+ ++++QI K G+    +R++  +S+FWHFLD++WI VF+ VY+MGV
Sbjct: 141 GLHVTLGMGWMIIVIMQIAKHGITPVTKRKVNIISLFWHFLDVVWIFVFTIVYVMGV 197


>gi|258541196|ref|YP_003186629.1| cytochrome o ubiquinol oxidase subunit III [Acetobacter
           pasteurianus IFO 3283-01]
 gi|21321321|dbj|BAB97175.1| ubiquinol oxidase subunit III [Acetobacter pasteurianus]
 gi|256632274|dbj|BAH98249.1| cytochrome o ubiquinol oxidase subunit III [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256635331|dbj|BAI01300.1| cytochrome o ubiquinol oxidase subunit III [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256638386|dbj|BAI04348.1| cytochrome o ubiquinol oxidase subunit III [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256641440|dbj|BAI07395.1| cytochrome o ubiquinol oxidase subunit III [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256644495|dbj|BAI10443.1| cytochrome o ubiquinol oxidase subunit III [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256647550|dbj|BAI13491.1| cytochrome o ubiquinol oxidase subunit III [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256650603|dbj|BAI16537.1| cytochrome o ubiquinol oxidase subunit III [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256653594|dbj|BAI19521.1| cytochrome o ubiquinol oxidase subunit III [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 201

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 82/179 (45%), Positives = 119/179 (66%), Gaps = 2/179 (1%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLM+DC++F   F  +AVL   +  GP   ++F+  G+ + T +LL+SS++  F M
Sbjct: 24  GFWVYLMTDCIIFGTLFAVFAVLRNQFNGGPTGHELFEFGGLGLETALLLVSSITYGFGM 83

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A A K  + K + WL VT   G+ F+ +E+ EFAH+I+  A P RSAFLS+FF LV  H
Sbjct: 84  IA-AHKSQVSKVILWLGVTFLLGLGFVGLELREFAHMIAEGAGPDRSAFLSAFFTLVSTH 142

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGN-QRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+  L+ Q++    I      +L CLS+FWHFLD++WICVF++VYL  ++
Sbjct: 143 GLHVTCGLIWIVTLIAQLMGTTEIPERMMNKLTCLSLFWHFLDIVWICVFTYVYLASMI 201


>gi|118591210|ref|ZP_01548609.1| Heme/copper-type cytochrome/quinol oxidase subunit 3-like protein
           [Stappia aggregata IAM 12614]
 gi|118436286|gb|EAV42928.1| Heme/copper-type cytochrome/quinol oxidase subunit 3-like protein
           [Stappia aggregata IAM 12614]
          Length = 197

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 128/196 (65%), Gaps = 10/196 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           ++++    H   + GFWIYLM+D ++FA+ F +YAVL +N AAGP   D+FD+S   + T
Sbjct: 8   EEEQKHALHSREF-GFWIYLMTDAVIFALLFASYAVLAENSAAGPTSNDLFDLSRTAIET 66

Query: 79  IVLLLSSLSCSFAMLASATKRLIH----KTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            +LL+SSL+   A +A     L+H    + V WL VT   G+ F+ ME+ EF  +I   A
Sbjct: 67  GLLLVSSLTFGMASIA-----LMHDQKGRVVQWLFVTLLLGLAFLAMEMGEFGGMIEKGA 121

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            P+ S FLS+FF LVG HGLHV FG + + V++ Q+L KGL +  + RL+ L +FWHFLD
Sbjct: 122 GPEVSGFLSAFFTLVGTHGLHVAFGSLGIVVMIGQVLVKGLTAPVRSRLMRLGLFWHFLD 181

Query: 195 LIWICVFSFVYLMGVV 210
           ++WI +FS VYL GV+
Sbjct: 182 IVWIGIFSAVYLPGVL 197


>gi|315616630|gb|EFU97247.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli 3431]
          Length = 163

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 86/160 (53%), Positives = 110/160 (68%), Gaps = 1/160 (0%)

Query: 49  FVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWL 108
           F TYAVL    A GP   D+F++  + V T +LL SS++   A +A   K    + +SWL
Sbjct: 2   FATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIA-MYKNNKSQVISWL 60

Query: 109 LVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVI 168
            +T  FG  FI MEIYEF HLI     P RS FLS+FFALVG HGLHV  GLIW+ VL++
Sbjct: 61  ALTWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMV 120

Query: 169 QILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           QI ++GL S N+ R++CLS+FWHFLD++WICVF+ VYLMG
Sbjct: 121 QIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMG 160


>gi|331092960|ref|ZP_04588387.2| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. oryzae str. 1_6]
 gi|331022781|gb|EGI02838.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. oryzae str. 1_6]
          Length = 171

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 118/172 (68%), Gaps = 1/172 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           M+DC++FA FF  YAV+  + A GP+  D+F +  + V T  LL+SS++  FAMLA   K
Sbjct: 1   MTDCVLFASFFAVYAVMVNSVAGGPSGHDIFLLPFVAVETAFLLVSSITYGFAMLA-LYK 59

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
               + + WL +T   G  FI ME+YEF HLI     P RS FLS+FFALVGLHG+HV  
Sbjct: 60  GNKSQVLGWLALTFLCGASFIGMEVYEFHHLIHEGFGPSRSGFLSAFFALVGLHGVHVTS 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLIW+ +++ Q+ KKGL + N+ RL CLS+FWHFLD++WI VF+ VYLMG +
Sbjct: 120 GLIWMAIMMFQVQKKGLTNTNKTRLSCLSLFWHFLDVVWIGVFTVVYLMGAL 171


>gi|70732059|ref|YP_261815.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas fluorescens
           Pf-5]
 gi|68346358|gb|AAY93964.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas
           fluorescens Pf-5]
          Length = 204

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 92/177 (51%), Positives = 124/177 (70%), Gaps = 1/177 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLM+DC++FA  F +YAVL  + A GP+ +DVF++  +   T++LLLSS++  FAM
Sbjct: 28  GFWVYLMTDCILFATLFASYAVLRDSVAGGPSTMDVFELPYVLAETLLLLLSSITYGFAM 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           LA    +   + + WL +TA  G+ F+ MEI EF  LIS    P RS FLS+FF LVG H
Sbjct: 88  LAMNRDQRT-QVLRWLGLTALLGLGFVAMEINEFHQLISEGHGPDRSGFLSAFFTLVGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           GLHV  GL+W+ VL+ Q+  +GL +    RL CLS+FWHFLD+IWICVF+ VYL+GV
Sbjct: 147 GLHVACGLVWMAVLMWQVHSRGLGAIQATRLSCLSLFWHFLDVIWICVFTVVYLLGV 203


>gi|126642213|ref|YP_001085197.1| cytochrome o ubiquinol oxidase subunit III [Acinetobacter baumannii
           ATCC 17978]
 gi|213158553|ref|YP_002319851.1| cytochrome O ubiquinol oxidase, subunit III [Acinetobacter
           baumannii AB0057]
 gi|213057713|gb|ACJ42615.1| cytochrome O ubiquinol oxidase, subunit III [Acinetobacter
           baumannii AB0057]
          Length = 174

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 87/175 (49%), Positives = 117/175 (66%), Gaps = 4/175 (2%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVF--DISGIFVSTIVLLLSSLSCSFAMLAS 95
           MSD ++F   F+ +AVL  +   G P+  D+F   +  +   T  LL+SS++  FA+LAS
Sbjct: 1   MSDLILFGSLFIAFAVLSSHVPPGTPSAYDLFHESLGYVLTETFALLISSVTFGFAVLAS 60

Query: 96  ATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLH 155
             K  +++ ++WL +T  FG  FI ME+YEF HL+     P  SAFLSSFF LVG HG+H
Sbjct: 61  YKKN-VNQVITWLFITFLFGATFIGMELYEFHHLVEEGHGPTHSAFLSSFFTLVGTHGIH 119

Query: 156 VFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           V  GL+W+ VL+ QI  KGL   N RRL CLS+FWHFLD++WICVFS VYL+GV+
Sbjct: 120 VTSGLVWMLVLMYQIKTKGLTLPNTRRLACLSLFWHFLDIVWICVFSVVYLLGVL 174


>gi|241664395|ref|YP_002982755.1| cytochrome o ubiquinol oxidase subunit III [Ralstonia pickettii
           12D]
 gi|240866422|gb|ACS64083.1| cytochrome o ubiquinol oxidase, subunit III [Ralstonia pickettii
           12D]
          Length = 213

 Score =  166 bits (419), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 116/176 (65%), Gaps = 1/176 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSD ++FA  F T+ VL    A GP   ++FD+S + + T +LL+SS++    M
Sbjct: 37  GFWVYLMSDLIIFASLFATFCVLRGATAGGPTGKELFDLSYVAIETGILLVSSITYGMVM 96

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           ++    R   + + WL +T   G  F+ MEI EF HLI+  A P RSAFLSSFF LVG H
Sbjct: 97  ISLQNGRK-DQVMLWLGITLLLGAAFVGMEINEFHHLIAEGAGPSRSAFLSSFFLLVGTH 155

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           GLHV  G++W+ VL+ QI  KGL      RL CLS+FWHFLD++WI VF+ VYL+G
Sbjct: 156 GLHVASGMLWIIVLMWQIGAKGLTPTQSTRLSCLSLFWHFLDVVWIGVFTVVYLLG 211


>gi|187930228|ref|YP_001900715.1| cytochrome o ubiquinol oxidase subunit III [Ralstonia pickettii
           12J]
 gi|187727118|gb|ACD28283.1| cytochrome o ubiquinol oxidase, subunit III [Ralstonia pickettii
           12J]
          Length = 209

 Score =  166 bits (419), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 116/176 (65%), Gaps = 1/176 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSD ++FA  F T+ VL    A GP   ++FD+S + + T +LL+SS++    M
Sbjct: 33  GFWVYLMSDLIIFASLFATFCVLRGATAGGPTGKELFDLSYVAIETGILLVSSITYGMVM 92

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           ++    R   + + WL +T   G  F+ MEI EF HLI+  A P RSAFLSSFF LVG H
Sbjct: 93  ISLQNGRK-DQVMLWLGITLLLGAAFVGMEINEFHHLIAEGAGPSRSAFLSSFFLLVGTH 151

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           GLHV  G++W+ VL+ QI  KGL      RL CLS+FWHFLD++WI VF+ VYL+G
Sbjct: 152 GLHVASGMLWIIVLMWQIGAKGLTPTQSTRLSCLSLFWHFLDVVWIGVFTVVYLLG 207


>gi|309782936|ref|ZP_07677656.1| cytochrome o ubiquinol oxidase, subunit III [Ralstonia sp.
           5_7_47FAA]
 gi|308918360|gb|EFP64037.1| cytochrome o ubiquinol oxidase, subunit III [Ralstonia sp.
           5_7_47FAA]
          Length = 213

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 116/176 (65%), Gaps = 1/176 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSD ++FA  F T+ VL    A GP   ++FD+S + + T +LL+SS++    M
Sbjct: 37  GFWVYLMSDLIIFASLFATFCVLRGATAGGPTGKELFDLSYVAIETGILLVSSITYGMVM 96

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           ++    R   + + WL +T   G  F+ MEI EF HLI+  A P RSAFLSSFF LVG H
Sbjct: 97  ISLQNGRK-DQVMLWLGITLVLGAAFVGMEINEFHHLIAEGAGPSRSAFLSSFFLLVGTH 155

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           GLHV  G++W+ VL+ QI  KGL      RL CLS+FWHFLD++WI VF+ VYL+G
Sbjct: 156 GLHVASGMLWIIVLMWQIGAKGLTPTQSTRLSCLSLFWHFLDVVWIGVFTVVYLLG 211


>gi|330502491|ref|YP_004379360.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas mendocina
           NK-01]
 gi|328916777|gb|AEB57608.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas mendocina
           NK-01]
          Length = 208

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 119/180 (66%), Gaps = 3/180 (1%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFD--ISGIFVSTIVLLLSSLSCSF 90
           GFW+YLM+D L+FA  F T+AVL  ++A GP   ++    +  + V T  LL SS++   
Sbjct: 30  GFWVYLMTDLLIFATVFATFAVLSNSFAGGPTAKEMLGGGLHLVLVETFALLFSSITYGM 89

Query: 91  AMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVG 150
           AMLA+  +      + WL +T  FG  FI +E+YEF HLI   A PQ SA+ S+FF LVG
Sbjct: 90  AMLATY-RGDKGAVLRWLGITFLFGAAFISIELYEFRHLIHEGAGPQVSAYWSAFFTLVG 148

Query: 151 LHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
            HGLHV  GL+W+ VL+ Q+  +GL   N+ R+  LS+FWHFLD++WICVF+ VYLMGV+
Sbjct: 149 THGLHVSAGLLWMLVLMFQVGSRGLTDTNKTRVGLLSLFWHFLDVVWICVFTVVYLMGVL 208


>gi|207744472|ref|YP_002260864.1| transmembrane cytochrome o ubiquinol oxidase (subunit III) protein
           [Ralstonia solanacearum IPO1609]
 gi|206595878|emb|CAQ62805.1| transmembrane cytochrome o ubiquinol oxidase (subunit III) protein
           [Ralstonia solanacearum IPO1609]
          Length = 211

 Score =  164 bits (414), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 116/176 (65%), Gaps = 1/176 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSD ++FA  F T+ VL    A GP   ++FD+S + + T +LL+SS++    M
Sbjct: 35  GFWVYLMSDLILFASLFATFCVLRSATAGGPNGKELFDLSYVLIETGILLVSSITYGMVM 94

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +   + R   + + WL +T   G  F+ MEI EF HLI+  A P RSAF SSFF LVG H
Sbjct: 95  IGLQSGRK-DQVMLWLGITFLLGAAFVGMEINEFHHLIAEGAGPSRSAFPSSFFTLVGPH 153

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           G+HV  GL+W+ VL+ QI +KGL + N  RL CLS+ WHFL ++WI VF+ VYL+G
Sbjct: 154 GVHVAIGLLWIAVLMWQISRKGLTATNSTRLACLSLLWHFLHVVWIGVFTVVYLLG 209


>gi|284006412|emb|CBA71648.1| cytochrome O ubiquinol oxidase subunit III [Arsenophonus nasoniae]
          Length = 172

 Score =  163 bits (412), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 87/172 (50%), Positives = 118/172 (68%), Gaps = 1/172 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           MSD ++FA  F TY VL    A GP   D+F+++ + + T +LL SS++  FAMLA   K
Sbjct: 1   MSDLILFACLFATYVVLVNGTAGGPTGKDIFNLNFVLIETFLLLFSSITYGFAMLA-MYK 59

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFF 158
           + I+    WLL+T   G+ F+IMEIYEF  LI+    P RSAFLS+FF LV  HG+HV F
Sbjct: 60  QKINLVKLWLLITFLLGLGFVIMEIYEFHELIAEGYGPDRSAFLSAFFTLVSTHGIHVSF 119

Query: 159 GLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GL W+ +++I I + GL + NQ RL CLS+FWHFLD++WICVF+ VYL+G +
Sbjct: 120 GLAWIIIMIIHISRHGLTAVNQTRLSCLSLFWHFLDVVWICVFTVVYLLGAL 171


>gi|296444725|ref|ZP_06886688.1| cytochrome c oxidase subunit III [Methylosinus trichosporium OB3b]
 gi|296257673|gb|EFH04737.1| cytochrome c oxidase subunit III [Methylosinus trichosporium OB3b]
          Length = 219

 Score =  162 bits (410), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 118/176 (67%), Gaps = 2/176 (1%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWI+L+SD +MF+ FF  +AVL      GPA  D+FD + + + T VLLLSS +C  + 
Sbjct: 43  GFWIFLLSDIVMFSAFFAAHAVLQNATDGGPAGRDLFDPTRVAIQTGVLLLSSFTCGVSA 102

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A+  +  +  T + LL T   G +F+++E +EFA +I+  A PQRSAFLSSFFALVGLH
Sbjct: 103 VATNARSHV-WTQAALLATGLLGAVFLLLEAHEFAGMIASGAGPQRSAFLSSFFALVGLH 161

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           G HV  GL+WL  ++ Q+  KG       RLIC +++WH LD+IW+ +F+ VYL+G
Sbjct: 162 GAHVGVGLLWLGTMMAQLFVKGFTP-ILYRLICFNLYWHVLDIIWVAIFTVVYLIG 216


>gi|226310781|ref|YP_002770675.1| quinol oxidase polypeptide III [Brevibacillus brevis NBRC 100599]
 gi|226093729|dbj|BAH42171.1| quinol oxidase polypeptide III [Brevibacillus brevis NBRC 100599]
          Length = 202

 Score =  162 bits (409), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 120/179 (67%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI++++DC++F   F TYAV+  ++A GP   ++F + G+  ST +LL SS +   A
Sbjct: 25  LGFWIFVVTDCVLFGTLFATYAVMMNSFAGGPTGQELFQLPGVIASTFILLTSSFTSGLA 84

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +LA   K  + + + WL VT   G+ F+++E+ EF HL+S  A    S + S+F+ LVG 
Sbjct: 85  VLA-MNKGNVKQLIGWLAVTGLLGLSFVVLEVTEFMHLMSEGATMATSGYWSAFYTLVGT 143

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG+HV  GL W+  L+IQ+ ++G+ +  +R++   S++WHFLD++WI +F+ VYLMGV+
Sbjct: 144 HGVHVTVGLFWMTALMIQLKRRGISAVTRRKITNFSLYWHFLDVVWIFLFTVVYLMGVM 202


>gi|110635862|ref|YP_676070.1| cytochrome c oxidase, subunit III [Mesorhizobium sp. BNC1]
 gi|110286846|gb|ABG64905.1| cytochrome bo3 quinol oxidase subunit 3 [Chelativorans sp. BNC1]
          Length = 201

 Score =  162 bits (409), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 116/178 (65%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSD ++FA+ F TY V+  N A  P P   FD++ +F  T++LL SS++  FA 
Sbjct: 24  GFWLYLMSDAIIFALLFATYVVMAGNVADAPPPHSQFDLTHVFAETMILLASSITFGFAT 83

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A  T R     + WLLVT   G+ F++ME+ EF  +I+  A P +S  LS+FF LVG H
Sbjct: 84  VAIGTGRRPAVQL-WLLVTFALGLGFVLMELTEFRSMIAAGAGPDQSGALSAFFTLVGTH 142

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GL+W+ V++ Q+  KGL      RL  L +FWHFLD+IWI +FS VYL G++
Sbjct: 143 GLHVSIGLVWILVMMAQVALKGLSVPVVSRLERLGLFWHFLDIIWIGIFSVVYLPGLI 200


>gi|283850556|ref|ZP_06367844.1| cytochrome o ubiquinol oxidase, subunit III [Desulfovibrio sp.
           FW1012B]
 gi|283574127|gb|EFC22099.1| cytochrome o ubiquinol oxidase, subunit III [Desulfovibrio sp.
           FW1012B]
          Length = 205

 Score =  160 bits (405), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 115/180 (63%), Gaps = 5/180 (2%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSD ++F+  F TY VL  NYA GP   ++F + G  + TI+LL SS +   A 
Sbjct: 28  GFWLYLMSDLILFSGLFATYVVLSHNYAGGPTGKELFHLPGALLETILLLCSSAAYGLAT 87

Query: 93  LA--SATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVG 150
           +A     K L+   ++ L  T   G+ F+ ME  EF  +I   A PQRS FLS+FF LVG
Sbjct: 88  VAMHKGRKDLL---LAGLGATFLLGLGFLAMEAAEFRQMILDGAGPQRSGFLSAFFTLVG 144

Query: 151 LHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
            HG HV  GL+WL V++ Q+  KGL +  Q RL+ L MFWHFLD++WI +FS VYLMGV+
Sbjct: 145 THGAHVACGLVWLVVMMGQVAAKGLTTPVQGRLMRLGMFWHFLDIVWIGLFSVVYLMGVM 204


>gi|311087360|gb|ADP67440.1| cytochrome O ubiquinol oxidase subunit III [Buchnera aphidicola
           str. JF99 (Acyrthosiphon pisum)]
 gi|311087858|gb|ADP67937.1| cytochrome O ubiquinol oxidase subunit III [Buchnera aphidicola
           str. JF98 (Acyrthosiphon pisum)]
          Length = 215

 Score =  160 bits (405), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 92/210 (43%), Positives = 131/210 (62%), Gaps = 2/210 (0%)

Query: 2   SRQKIGKSP-NFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           SR K+ ++  N ++          +       G WIYLMSDC+MFAV F  YA++  N +
Sbjct: 7   SRFKMIENKFNNTILNSNSSTHDKISETKKLFGLWIYLMSDCIMFAVLFAVYAIVSSNIS 66

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
                  +F++S I + T +LLLSSLSC F ++A   KR I    S+L +T  FG+IF++
Sbjct: 67  INLISNKIFNLSSILLETFLLLLSSLSCGFVVIAMNQKR-IKMIYSFLTITFIFGLIFLL 125

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           ME++EF  LI     P ++AF S FF LV  HG+H+FFGLI +  ++ QI K GL +  +
Sbjct: 126 MEVHEFYELIIENFGPDKNAFFSIFFTLVATHGVHIFFGLILILSILYQIKKLGLTNSIR 185

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
            R++C S+FWHFLD+IWICVF+FVYL G +
Sbjct: 186 TRILCFSVFWHFLDIIWICVFTFVYLNGAI 215


>gi|308070784|ref|YP_003872389.1| Quinol oxidase polypeptide III (Quinol oxidase aa3-600, subunit
           qoxC) [Paenibacillus polymyxa E681]
 gi|305860063|gb|ADM71851.1| Quinol oxidase polypeptide III (Quinol oxidase aa3-600, subunit
           qoxC) [Paenibacillus polymyxa E681]
          Length = 202

 Score =  160 bits (405), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 118/179 (65%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L++D ++F+  F T+ VL  N A GP   ++F+++G+ + T +LL SS +   A
Sbjct: 25  LGFWIFLVTDVILFSTLFATFVVLRNNTAGGPGGAELFNMTGVIIETFLLLTSSFTSGLA 84

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +LA   K  +   ++WL+VTA  G+ FI  E+YEF  L+   A    SAFLS+FF LVG 
Sbjct: 85  VLA-MNKGSMKGLINWLIVTAILGLGFIGFEVYEFVELVHEGANYGTSAFLSAFFTLVGT 143

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HGLHV  GL+W+  L+ Q+ K+GL    + ++  LS++WHFLD +WI + + VYLMGV+
Sbjct: 144 HGLHVSLGLVWMIGLMFQLKKRGLTPETKGKVSALSLYWHFLDAVWIFLLTVVYLMGVM 202


>gi|148254208|ref|YP_001238793.1| cytochrome o ubiquinol oxidase subunit III [Bradyrhizobium sp.
           BTAi1]
 gi|146406381|gb|ABQ34887.1| cytochrome bb3 quinol oxidase subunit 3 [Bradyrhizobium sp. BTAi1]
          Length = 213

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 86/215 (40%), Positives = 127/215 (59%), Gaps = 12/215 (5%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDG-------TYLGFWIYLMSDCLMFAVFFVTYA 53
           MS   + ++P     Y         +HDG       T  GFWI+L+SD +MF+ FF ++A
Sbjct: 1   MSVSAVEQAPA----YADPHHLRAAEHDGPAPKRIVTGYGFWIFLLSDIVMFSCFFASFA 56

Query: 54  VLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAF 113
           VL K  A GP   ++FDI  + + T +LL+SS +C  A +A+     +   V+ +  T  
Sbjct: 57  VLSKATAGGPGGAELFDIRNVAIETALLLVSSFACGMASIAAERHSALWFQVA-MAATGL 115

Query: 114 FGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKK 173
            G  F+++E  EF  L+     P RSAFLS+FF LVG HGLHV  GL+WL  ++ Q++ K
Sbjct: 116 LGAGFLLLEAREFTDLVGRGDGPSRSAFLSAFFTLVGCHGLHVGAGLLWLLTMMAQVMTK 175

Query: 174 GLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           G  +  +RR++C ++FWH LD+IW+ VFS VYL+G
Sbjct: 176 GFRADIERRILCFALFWHALDIIWVAVFSVVYLLG 210


>gi|304407876|ref|ZP_07389527.1| cytochrome o ubiquinol oxidase, subunit III [Paenibacillus
           curdlanolyticus YK9]
 gi|304343359|gb|EFM09202.1| cytochrome o ubiquinol oxidase, subunit III [Paenibacillus
           curdlanolyticus YK9]
          Length = 206

 Score =  159 bits (403), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 81/181 (44%), Positives = 118/181 (65%), Gaps = 4/181 (2%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+LM+D ++F   F  Y VL  N A GP   ++F + G+   T +LL SS +   A
Sbjct: 28  LGFWIFLMTDVIIFGCLFAVYVVLRNNTAGGPTAEELFKMPGVIAETFILLTSSFTSGLA 87

Query: 92  MLA-SATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME-AVPQRSAFLSSFFALV 149
           +LA  A K+  ++ ++WL VTA  G  FI +E+YEF  +++ E A    S FLS FF LV
Sbjct: 88  VLAMHAGKK--NQLITWLGVTAALGAAFIFLEVYEFVDMVNHEGATIATSGFLSGFFTLV 145

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GL+W+  L++Q+ K+G+    +R++  LS++WHFLD++WI V + VYLMGV
Sbjct: 146 GTHGLHVSIGLVWMIGLMLQLRKRGITPVTKRKVEVLSLYWHFLDVVWIFVLTVVYLMGV 205

Query: 210 V 210
           +
Sbjct: 206 M 206


>gi|310644020|ref|YP_003948778.1| transmembrane cytochrome o ubiquinol oxidase (subunit iii)
           oxidoreductase protein [Paenibacillus polymyxa SC2]
 gi|309248970|gb|ADO58537.1| Probable transmembrane cytochrome O ubiquinol oxidase (Subunit III)
           oxidoreductase protein [Paenibacillus polymyxa SC2]
          Length = 202

 Score =  159 bits (403), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 118/179 (65%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L++D ++F+  F T+ VL  N A GP   ++F+++G+ + T +LL SS +   A
Sbjct: 25  LGFWIFLVTDVILFSTLFATFVVLRNNTAGGPGGAELFNMTGVIIETFLLLTSSFTSGLA 84

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +LA   K  +   +SWL+VTA  G+ FI  E+YEF  ++   A    SAFLS+FF LVG 
Sbjct: 85  VLA-MNKGSMKGLISWLIVTAILGLGFIGFEVYEFVEMVHEGANFGTSAFLSAFFTLVGT 143

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HGLHV  GL+W+  L+ Q+ K+GL    + ++  LS++WHFLD +WI + + VYLMGV+
Sbjct: 144 HGLHVSLGLVWMIGLMFQLKKRGLTPETKGKVSALSLYWHFLDAVWIFLLTVVYLMGVM 202


>gi|15617068|ref|NP_240281.1| cytochrome O ubiquinol oxidase subunit III [Buchnera aphidicola
           str. APS (Acyrthosiphon pisum)]
 gi|219681820|ref|YP_002468206.1| cytochrome O ubiquinol oxidase subunit III [Buchnera aphidicola
           str. 5A (Acyrthosiphon pisum)]
 gi|219682375|ref|YP_002468759.1| cytochrome O ubiquinol oxidase subunit III [Buchnera aphidicola
           str. Tuc7 (Acyrthosiphon pisum)]
 gi|257471522|ref|ZP_05635521.1| cytochrome O ubiquinol oxidase subunit III [Buchnera aphidicola
           str. LSR1 (Acyrthosiphon pisum)]
 gi|11386747|sp|P57542|CYOC_BUCAI RecName: Full=Cytochrome o ubiquinol oxidase subunit 3; AltName:
           Full=Cytochrome o ubiquinol oxidase subunit III
 gi|25285512|pir||G84984 cytochrome o ubiquinol oxidase subunit III [imported] - Buchnera
           sp. (strain APS)
 gi|10039133|dbj|BAB13167.1| cytochrome o ubiquinol oxidase subunit III [Buchnera aphidicola
           str. APS (Acyrthosiphon pisum)]
 gi|219622108|gb|ACL30264.1| cytochrome O ubiquinol oxidase subunit III [Buchnera aphidicola
           str. Tuc7 (Acyrthosiphon pisum)]
 gi|219624663|gb|ACL30818.1| cytochrome O ubiquinol oxidase subunit III [Buchnera aphidicola
           str. 5A (Acyrthosiphon pisum)]
 gi|311086196|gb|ADP66278.1| cytochrome O ubiquinol oxidase subunit III [Buchnera aphidicola
           str. LL01 (Acyrthosiphon pisum)]
 gi|311086772|gb|ADP66853.1| cytochrome O ubiquinol oxidase subunit III [Buchnera aphidicola
           str. TLW03 (Acyrthosiphon pisum)]
          Length = 205

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 90/205 (43%), Positives = 126/205 (61%), Gaps = 1/205 (0%)

Query: 6   IGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAP 65
           I    N ++          +       G WIYLMSDC+MFAV F  YA++  N +     
Sbjct: 2   IENKFNNTILNSNSSTHDKISETKKLFGLWIYLMSDCIMFAVLFAVYAIVSSNISINLIS 61

Query: 66  IDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYE 125
             +F++S I + T +LLLSSLSC F ++A   KR I    S+L +T  FG+IF++ME++E
Sbjct: 62  NKIFNLSSILLETFLLLLSSLSCGFVVIAMNQKR-IKMIYSFLTITFIFGLIFLLMEVHE 120

Query: 126 FAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLIC 185
           F  LI     P ++AF S FF LV  HG+H+FFGLI +  ++ QI K GL +  + R++C
Sbjct: 121 FYELIIENFGPDKNAFFSIFFTLVATHGVHIFFGLILILSILYQIKKLGLTNSIRTRILC 180

Query: 186 LSMFWHFLDLIWICVFSFVYLMGVV 210
            S+FWHFLD+IWICVF+FVYL G +
Sbjct: 181 FSVFWHFLDIIWICVFTFVYLNGAI 205


>gi|332187386|ref|ZP_08389124.1| cytochrome c oxidase subunit III family protein [Sphingomonas sp.
           S17]
 gi|332012547|gb|EGI54614.1| cytochrome c oxidase subunit III family protein [Sphingomonas sp.
           S17]
          Length = 211

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 88/216 (40%), Positives = 125/216 (57%), Gaps = 14/216 (6%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTY-------LGFWIYLMSDCLMFAVFFVTYA 53
           MS+      PN      K  + +  + DG          GFWI+L+SD ++F+ FF  YA
Sbjct: 1   MSQTAKAHDPN------KLGRATEPNPDGPAPKRIIVSYGFWIFLLSDFILFSCFFAAYA 54

Query: 54  VLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAF 113
           VL    A GP+  D+F++  +   T +LLLSS +C  A +A+  + +    ++ + VTA 
Sbjct: 55  VLHDATAGGPSGKDLFELPLVETETALLLLSSFACGLAGIATLARNMRWFQIA-MAVTAL 113

Query: 114 FGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKK 173
            G  F+ +E +EF HLI     P RSAFLS+FFALVG HG HV  GL+WL  ++ Q   K
Sbjct: 114 LGAGFLALEAHEFLHLIGEGNGPGRSAFLSAFFALVGCHGFHVTLGLLWLTTMMAQTWAK 173

Query: 174 GLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G      RR++C S+FWH LD+IW+ +F+ VYLMGV
Sbjct: 174 GFREDILRRILCFSLFWHALDIIWVALFTMVYLMGV 209


>gi|94498640|ref|ZP_01305193.1| cytochrome o ubiquinol oxidase subunit III [Sphingomonas sp. SKA58]
 gi|94421935|gb|EAT06983.1| cytochrome o ubiquinol oxidase subunit III [Sphingomonas sp. SKA58]
          Length = 161

 Score =  159 bits (402), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 103/156 (66%), Gaps = 1/156 (0%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPID 67
            +P     Y   ++    +   T LGFW+YLMSDCL+FA+ F TYAVLG +YA GP P D
Sbjct: 7   NAPTEPRAYHLPEEPHLHEGHSTMLGFWMYLMSDCLIFAILFATYAVLGGSYAGGPGPKD 66

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
           +FD++ I ++T +LL SS++  FAMLA    R I  T  WL VT  FG  F+ +E+YEF+
Sbjct: 67  LFDLNLIALNTAMLLFSSITYGFAMLAMEKNR-ISATQGWLFVTLLFGGAFLFIELYEFS 125

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWL 163
           HLI   A P RSAFLSSFF LVG HGLHV FG IWL
Sbjct: 126 HLIHEGAGPTRSAFLSSFFTLVGTHGLHVTFGSIWL 161


>gi|218288764|ref|ZP_03493027.1| cytochrome c oxidase subunit III [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218241122|gb|EED08298.1| cytochrome c oxidase subunit III [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 211

 Score =  158 bits (399), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 84/211 (39%), Positives = 124/211 (58%), Gaps = 9/211 (4%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           M     G +   +L Y   +  + +      LGFWI+L +D ++F   F TY VL  +  
Sbjct: 8   MEDTGGGGARALALEYTHAEDRTRI------LGFWIFLATDMILFGCLFATYLVLRTHTD 61

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVS-WLLVTAFFGMIFI 119
            GP P  +FD+ G    T+ LL SS +   A L+    R   K+V+ W+ VT   G+ F+
Sbjct: 62  GGPTPATLFDMKGFGAETLALLTSSFTGGLATLSMRDGR--QKSVAFWMSVTIVLGLTFL 119

Query: 120 IMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGN 179
            +E  EFAH   + AV QRSAFLSSFF LVG HG HV FG++W+ V + Q+L++GL    
Sbjct: 120 SIEASEFAHDAFIGAVWQRSAFLSSFFTLVGTHGCHVTFGVLWMLVTLYQVLRRGLTPRT 179

Query: 180 QRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
            R++  ++++WHFLD++WI +F+ VYL G+V
Sbjct: 180 ARKVFVVNLYWHFLDVVWIFIFTVVYLTGMV 210


>gi|27377827|ref|NP_769356.1| cytochrome O ubiquinol oxidase subunit III [Bradyrhizobium
           japonicum USDA 110]
 gi|7432917|pir||JC5901 bo-type ubiquinol oxidase (EC 1.10.3.-) chain III - Bradyrhizobium
           japonicum
 gi|27350972|dbj|BAC47981.1| cytochrome O ubiquinol oxidase subunit III [Bradyrhizobium
           japonicum USDA 110]
          Length = 213

 Score =  157 bits (398), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 119/191 (62%), Gaps = 8/191 (4%)

Query: 25  VDHDG-------TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
           V+H G       T  GFW++L+SD +MF+ FF  YAVL    A GP   ++F+   + + 
Sbjct: 21  VEHPGPASKRIVTAYGFWVFLLSDIVMFSCFFAAYAVLSGQTADGPKGSEIFEQRNVAIE 80

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T+ LLLSS +C  A +A+  +      +  + VT   G+IF+ +E  EFA L++    P 
Sbjct: 81  TVCLLLSSFTCGMASIAADVRNRFWFYLG-MAVTCVLGLIFLTIEFREFADLVARGYGPS 139

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
           RSAFL+SFF+LVG HGLHV  G++WL  ++ Q+  KG  +   RR++C ++FWH LD+IW
Sbjct: 140 RSAFLTSFFSLVGCHGLHVSAGVLWLLTMMAQVFAKGFRADVLRRMMCFALFWHALDIIW 199

Query: 198 ICVFSFVYLMG 208
           + VFS VYL+G
Sbjct: 200 VGVFSVVYLLG 210


>gi|196020025|ref|XP_002119092.1| hypothetical protein TRIADDRAFT_35138 [Trichoplax adhaerens]
 gi|190577011|gb|EDV18422.1| hypothetical protein TRIADDRAFT_35138 [Trichoplax adhaerens]
          Length = 203

 Score =  157 bits (398), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 87/198 (43%), Positives = 120/198 (60%), Gaps = 6/198 (3%)

Query: 17  VKDKKESCVD-HDGTY----LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDI 71
           V  + E   D H G Y     GFW+YL+SD ++FA  F  YAVL      GP   D+F+I
Sbjct: 6   VNIQDERFPDTHRGVYSKTIFGFWVYLLSDFMLFATLFAAYAVLRNATYGGPTAKDLFNI 65

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               + T+VLL +SL+     + +  +R I   + + L T   G++F+ ME  EF HLI+
Sbjct: 66  HYTLIQTVVLLCASLTAGMGGVFAHKRRKIPTIICFTL-TFIVGLVFMAMEWGEFTHLIA 124

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +  QRSAFLSS+F +VG HGLHV F L+W+ VL+  + K GL   N RRL CL MFW 
Sbjct: 125 SGSGWQRSAFLSSYFTVVGTHGLHVIFALLWVIVLLPPVFKDGLNPVNIRRLTCLRMFWQ 184

Query: 192 FLDLIWICVFSFVYLMGV 209
           FL+++WI +F+ +YLMGV
Sbjct: 185 FLNVVWIFIFTIIYLMGV 202


>gi|433188|dbj|BAA02482.1| ubiquinol oxidase subunit III precursor [Acetobacter aceti]
 gi|229365479|dbj|BAH57987.1| ubiquinol oxidase subunit III [Acetobacter lovaniensis]
          Length = 201

 Score =  155 bits (393), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 120/179 (67%), Gaps = 2/179 (1%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLM+DC++F   F  +AVL   +  GP   ++F+  G+ + T +LL+SS++  F M
Sbjct: 24  GFWVYLMTDCIIFGTLFAAFAVLHNQFNGGPTGHELFEFGGLGLETALLLVSSITYGFGM 83

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A A K  + K + WL +T   G+ F+ +E+ EFAH+I+  A P RSAFLS+FF LV  H
Sbjct: 84  IA-AHKSQVSKVILWLGLTFLLGLGFVGLELREFAHMIAEGAGPDRSAFLSAFFTLVSTH 142

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGN-QRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHV  GLIW+  L++Q++    I      +L CLS+FWHFLD++WICVF++VYL  ++
Sbjct: 143 GLHVTCGLIWIVTLIVQLMGTTEIPERMMNKLTCLSLFWHFLDIVWICVFTYVYLASMI 201


>gi|261420866|ref|YP_003254548.1| cytochrome aa3 quinol oxidase subunit III [Geobacillus sp.
           Y412MC61]
 gi|297531651|ref|YP_003672926.1| cytochrome aa3 quinol oxidase subunit III [Geobacillus sp. C56-T3]
 gi|319768537|ref|YP_004134038.1| cytochrome aa3 quinol oxidase subunit III [Geobacillus sp.
           Y412MC52]
 gi|261377323|gb|ACX80066.1| cytochrome aa3 quinol oxidase, subunit III [Geobacillus sp.
           Y412MC61]
 gi|297254903|gb|ADI28349.1| cytochrome aa3 quinol oxidase, subunit III [Geobacillus sp. C56-T3]
 gi|317113403|gb|ADU95895.1| cytochrome aa3 quinol oxidase, subunit III [Geobacillus sp.
           Y412MC52]
          Length = 204

 Score =  155 bits (393), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 114/179 (63%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++  +FA  F TY VL +   +GP   ++F++  + + T++LL SS +C  A
Sbjct: 26  LGFWIFLGAEVALFATLFATYLVLFQRTGSGPTAGELFEVKDVLIETLLLLTSSFTCGLA 85

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +      R I   ++WLLVT   G  FI  EI EF H +   A  Q SAFLSSFF LVG 
Sbjct: 86  IFEMRRGR-ISGLIAWLLVTLLLGAGFITFEIREFIHYVHEGATMQTSAFLSSFFVLVGT 144

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+ W+ +++IQ+L++G      R++  +S++WHFLD++WI +F+ VYL+G+V
Sbjct: 145 HGAHVSLGIGWMILIIIQLLQRGFTPKTARKVFIVSLYWHFLDVVWIFIFTLVYLLGMV 203


>gi|149182657|ref|ZP_01861125.1| cytochrome aa3 quinol oxidase subunit III [Bacillus sp. SG-1]
 gi|148849626|gb|EDL63808.1| cytochrome aa3 quinol oxidase subunit III [Bacillus sp. SG-1]
          Length = 201

 Score =  155 bits (391), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 113/179 (63%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++  +FA  F  YAVL + YA GP   D+F +  + V T++LL SS +C  A
Sbjct: 23  LGFWIFLGAEIALFATLFAVYAVLSQRYAGGPTHQDIFMMKEVMVQTVLLLTSSFTCGLA 82

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +       L    ++WL++T   G  F+ MEI EF H +   A  Q SAFLSS F L+G 
Sbjct: 83  IFEMRRGNL-KGLITWLIITLGLGAGFLYMEINEFIHYVHEGATMQTSAFLSSLFVLLGT 141

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV FG+ W  +++IQ++K+GL     R++  + ++WHFLD++WI +F+FVYL G++
Sbjct: 142 HGAHVTFGIFWAVMVIIQLVKRGLTPVTARKVFIIGLYWHFLDVVWIFIFTFVYLKGMM 200


>gi|114330710|ref|YP_746932.1| cytochrome c oxidase, subunit III [Nitrosomonas eutropha C91]
 gi|114307724|gb|ABI58967.1| cytochrome bo3 quinol oxidase subunit 3 [Nitrosomonas eutropha C91]
          Length = 223

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 116/192 (60%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           +  ++    + T  GFW++LMSD ++F + F TYA L    A  P P +++ +  IF+ T
Sbjct: 32  EHSDAHTQAEATVFGFWVFLMSDAIIFGMAFATYATLLHGTADSPGPRELYHLGPIFIET 91

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           ++LL SS +   A +A   K    + V WLL+T   G++F+ ME+ +F  + +   +P +
Sbjct: 92  LLLLTSSFTFGMASIAMKYKHPTSRLVGWLLITLVLGVVFLGMELNDFRAMFAAGGLPTQ 151

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           S FLS FF LV LHGLHV  G IWL  ++ QI   GL S  +  L+ L++FWHFLD++WI
Sbjct: 152 SGFLSGFFGLVPLHGLHVMAGCIWLVCMLGQIAVHGLDSETKLGLLRLALFWHFLDIVWI 211

Query: 199 CVFSFVYLMGVV 210
            +FS VYL G+ 
Sbjct: 212 FIFSVVYLAGLA 223


>gi|218289389|ref|ZP_03493623.1| cytochrome c oxidase subunit III [Alicyclobacillus acidocaldarius
           LAA1]
 gi|258510663|ref|YP_003184097.1| cytochrome c oxidase subunit III [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|218240495|gb|EED07676.1| cytochrome c oxidase subunit III [Alicyclobacillus acidocaldarius
           LAA1]
 gi|257477389|gb|ACV57708.1| cytochrome c oxidase subunit III [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 211

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 120/204 (58%), Gaps = 11/204 (5%)

Query: 9   SPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDV 68
            PN  L Y +++    +       GFW++L  D ++F+  F TY V+    A GP    +
Sbjct: 16  DPNVPLEYHEEENSLRIT------GFWLFLGQDMILFSSLFATYIVMHGRVAGGPTSQQL 69

Query: 69  FDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKT--VSWLLVTAFFGMIFIIMEIYEF 126
           FD++G  + TI LL SS +C    LA+   R  H+   + W+LVT   G++F+  E+ EF
Sbjct: 70  FDVTGFTIETIALLFSSFTCG---LATYEMRRGHRNAVIGWILVTMALGLVFLGFEVTEF 126

Query: 127 AHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
            H + + A  QRS FLS+F+ LVG HG HV  GL+W+ +L+ Q+L++G+     R++   
Sbjct: 127 IHDVGIGATLQRSGFLSAFYILVGTHGSHVTVGLLWVTLLIFQLLRRGITPVTARKVFLW 186

Query: 187 SMFWHFLDLIWICVFSFVYLMGVV 210
           S++WHFLD +WI +F+ VYL G V
Sbjct: 187 SIYWHFLDAVWIFIFTVVYLTGKV 210


>gi|218514776|ref|ZP_03511616.1| putative cytochrome o ubiquinol oxidase subunit III [Rhizobium etli
           8C-3]
          Length = 130

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 95/130 (73%), Gaps = 1/130 (0%)

Query: 81  LLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA 140
           +L SS++  FAML    +    +T+ WL VT  FG  FI +E+YEF HLI   A P RSA
Sbjct: 1   MLFSSITYGFAML-QMERNAKAETLFWLGVTGLFGAAFIGLELYEFIHLIHEGAGPTRSA 59

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICV 200
           FLSSFF LVG HGLHV FG+IWL  L++Q+   GLI  N+RRL+CLSMFWHFLD++WI V
Sbjct: 60  FLSSFFTLVGTHGLHVTFGIIWLITLMVQVSMHGLIEANRRRLMCLSMFWHFLDVVWIGV 119

Query: 201 FSFVYLMGVV 210
           FSFVYL+GV+
Sbjct: 120 FSFVYLLGVL 129


>gi|21672719|ref|NP_660786.1| cytochrome O ubiquinol oxidase C [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
 gi|25008332|sp|Q8K995|CYOC_BUCAP RecName: Full=Cytochrome o ubiquinol oxidase subunit 3; AltName:
           Full=Cytochrome o ubiquinol oxidase subunit III
 gi|21623362|gb|AAM67997.1| cytochrome o ubiquinol oxidase C [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
          Length = 189

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 120/184 (65%), Gaps = 1/184 (0%)

Query: 27  HDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSL 86
            +    G WIYLMSDC++FAV F  YA++  N++       +F++S +F+ T++LLLSSL
Sbjct: 7   RNNKLFGLWIYLMSDCIIFAVLFAVYAIISSNFSTNLINHKIFNLSYVFLETLILLLSSL 66

Query: 87  SCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFF 146
           S    +     K  I     +LL+T F G+ F++ME+ EF  LI     P + AF S FF
Sbjct: 67  SSG-MLTIQKNKNNIKIIYFYLLLTFFLGLSFLLMEVNEFYKLILENCSPSQHAFFSIFF 125

Query: 147 ALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
            +VG+HG+HVFFGLI++  ++ Q+   G+ +  + R++C S+FWHFLD+IWICVF+FVYL
Sbjct: 126 TIVGVHGIHVFFGLIFILSILYQLFYLGITNTIRIRILCFSLFWHFLDIIWICVFTFVYL 185

Query: 207 MGVV 210
            GV+
Sbjct: 186 NGVI 189


>gi|260773171|ref|ZP_05882087.1| cytochrome O ubiquinol oxidase subunit III [Vibrio metschnikovii
           CIP 69.14]
 gi|260612310|gb|EEX37513.1| cytochrome O ubiquinol oxidase subunit III [Vibrio metschnikovii
           CIP 69.14]
          Length = 202

 Score =  147 bits (372), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 112/178 (62%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+Y++SDCL+F   F  +AV   ++A    P  +FD+  +  +T +LLLSSL+   AM
Sbjct: 26  GFWVYILSDCLLFGTLFAVFAVFSNSFAGMVEPSALFDLWFVAGTTALLLLSSLTFGMAM 85

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           L      +     +WL +T   G  F+IME+YEF HL    A    SA+ SSF+ALV  H
Sbjct: 86  LKQNAHDM-KGMATWLGITFALGFGFLIMELYEFHHLSLAGATFSTSAYWSSFYALVATH 144

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           GLHVF GLIW+ +L     + G  + N+ RL  LS+FWHFLD+IWICVFS VYLMGV+
Sbjct: 145 GLHVFAGLIWMIILFFHFKRDGFTTANKTRLALLSLFWHFLDIIWICVFSVVYLMGVM 202


>gi|146339412|ref|YP_001204460.1| cytochrome o ubiquinol oxidase subunit III [Bradyrhizobium sp.
           ORS278]
 gi|146192218|emb|CAL76223.1| cytochrome o ubiquinol oxidase, subunit III [Bradyrhizobium sp.
           ORS278]
          Length = 213

 Score =  147 bits (371), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 86/215 (40%), Positives = 127/215 (59%), Gaps = 12/215 (5%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDG-------TYLGFWIYLMSDCLMFAVFFVTYA 53
           MS   + ++P     Y         +H G       T  GFWI+L+SD +MF+ FF ++A
Sbjct: 1   MSVTSVEQAPA----YADPHHLRVTEHPGPAPKRIVTGFGFWIFLLSDIVMFSCFFASFA 56

Query: 54  VLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAF 113
           VL    A GP    +FDI  + + T +LLLSS +C  A +A+     +   V+ + VT  
Sbjct: 57  VLSGGTAGGPGGAQLFDIRNVAIETALLLLSSFTCGMASIAADRHNALWFQVA-MAVTGL 115

Query: 114 FGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKK 173
            G  F+++E+ EFA L+     P RSAFLS+FF LVG HGLHV  G++WL  ++ Q++ K
Sbjct: 116 LGAAFLLLEVREFADLVGRGDGPSRSAFLSAFFTLVGCHGLHVAAGILWLLTMMAQVVAK 175

Query: 174 GLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           G  +  +RR++C ++FWH LD+IW+ VFS VYL+G
Sbjct: 176 GFRADIERRILCFALFWHALDIIWVAVFSVVYLLG 210


>gi|296284678|ref|ZP_06862676.1| cytochrome c oxidase, subunit III [Citromicrobium bathyomarinum
           JL354]
          Length = 208

 Score =  147 bits (371), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 115/188 (61%), Gaps = 2/188 (1%)

Query: 22  ESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA--VLGKNYAAGPAPIDVFDISGIFVSTI 79
           E+  D + T  GFW++LMSD ++F + F +YA  +     A GP P D+FD++ + + T 
Sbjct: 18  EAHEDAEKTVFGFWVFLMSDLIIFGILFASYASYLDPIGMAGGPGPKDLFDLTSVAIQTA 77

Query: 80  VLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS 139
            LL+  ++ +   LA    +   K ++WLLV A  G  F+  E+ +F        VPQ S
Sbjct: 78  FLLVGGIAYAGVSLALKYDQGREKIIAWLLVCAVLGAGFLFFEVKDFIAQAGEGGVPQAS 137

Query: 140 AFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWIC 199
            +LSS++ALVGLHG+HVF G++W+F  + QI  +GL    + RL  L +FWHFLDLIW+ 
Sbjct: 138 GWLSSYWALVGLHGIHVFSGILWIFATIGQIATRGLDDVVKVRLSMLGVFWHFLDLIWVG 197

Query: 200 VFSFVYLM 207
           +FS V+L+
Sbjct: 198 IFSLVFLV 205


>gi|294498632|ref|YP_003562332.1| cytochrome o quinol oxidase subunit III [Bacillus megaterium QM
           B1551]
 gi|294348569|gb|ADE68898.1| cytochrome o quinol oxidase, subunit III [Bacillus megaterium QM
           B1551]
          Length = 199

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 73/180 (40%), Positives = 114/180 (63%), Gaps = 1/180 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T +GFW++L++DC++F   F TYAVL  + A+G    + F++ G    T +LL SS +  
Sbjct: 20  TVMGFWLFLVTDCILFGALFATYAVLVNHTASGLTGKEFFEVPGFVSETFILLTSSFTSG 79

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
            A+L S  K  I   + WL+VT   GM F+ +EI+EF  ++   A    SAF ++F+ LV
Sbjct: 80  LAVL-SMHKGKIKPLIGWLIVTLLLGMCFVGLEIHEFQTMVHEGATISTSAFFTAFYTLV 138

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
             HGLHV  G+IW+  + IQ+ + G+ S  +R++  +S++WHFLD +WI +++ VYLMGV
Sbjct: 139 STHGLHVSVGIIWMISITIQLKRYGITSVTKRKVTIISLYWHFLDAVWIFLYTVVYLMGV 198


>gi|56964156|ref|YP_175887.1| cytochrome caa3 oxidase subunit III CoxC [Bacillus clausii KSM-K16]
 gi|56910399|dbj|BAD64926.1| cytochrome caa3 oxidase subunit III CoxC [Bacillus clausii KSM-K16]
          Length = 207

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 74/191 (38%), Positives = 117/191 (61%), Gaps = 2/191 (1%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTI 79
            + + ++    +LGFW +L  + +MFA FF TY  L      GPA  D+F +  +F+ T+
Sbjct: 15  PERATLEGKNKFLGFWFFLGGETIMFATFFGTYLGLRNGVGNGPASTDLFTLPLVFLMTM 74

Query: 80  VLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI-SMEAVPQR 138
           +LL SS++  FAM A   K    + ++W+++T   G+ F+ +EIYEF H +   E     
Sbjct: 75  LLLTSSMTSVFAMFA-MKKNKFKQMMTWMIITVVLGLAFLGLEIYEFQHYVHDYEFGFTT 133

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF S+F+ LVGLHG HV FGL W+ +L+I+  + G+   N  +    S++WHF+D++W+
Sbjct: 134 SAFSSAFYTLVGLHGAHVLFGLGWITLLIIRNFRAGITLTNAPKFYVASLYWHFIDVVWV 193

Query: 199 CVFSFVYLMGV 209
            +F+ VYLMGV
Sbjct: 194 FIFTVVYLMGV 204


>gi|294498140|ref|YP_003561840.1| cytochrome c oxidase subunit III [Bacillus megaterium QM B1551]
 gi|295703491|ref|YP_003596566.1| cytochrome c oxidase subunit III [Bacillus megaterium DSM 319]
 gi|294348077|gb|ADE68406.1| cytochrome c oxidase, subunit III [Bacillus megaterium QM B1551]
 gi|294801150|gb|ADF38216.1| cytochrome c oxidase, subunit III [Bacillus megaterium DSM 319]
          Length = 206

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 116/192 (60%), Gaps = 1/192 (0%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
             +++ ++    + GFW++L  + ++FA  F TY  L  +  +GP P ++FDI  +F +T
Sbjct: 15  SPEKATLEGKNKFTGFWLFLGGETVLFASLFATYLALRNSTMSGPKPEELFDIKLVFAAT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           ++LL SSL+  +AM          K   WL VT   G+ F+ +EIYEF H +        
Sbjct: 75  MILLTSSLTSVYAMYHMKNFEF-KKMQLWLGVTWLLGLAFLGLEIYEFRHYVHEGHTFTS 133

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF SSF+ALVG HG HV FGL+W+  L+I+  K+GL   N  +    S++WHF+D++W+
Sbjct: 134 SAFGSSFYALVGTHGAHVTFGLLWIGSLMIRNAKRGLNLYNAPKYYVASLYWHFIDVVWV 193

Query: 199 CVFSFVYLMGVV 210
            +F+ VYLMG+V
Sbjct: 194 FIFTVVYLMGMV 205


>gi|254512910|ref|ZP_05124976.1| Cytochrome o ubiquinol oxidase subunit 3 [Rhodobacteraceae
           bacterium KLH11]
 gi|221532909|gb|EEE35904.1| Cytochrome o ubiquinol oxidase subunit 3 [Rhodobacteraceae
           bacterium KLH11]
          Length = 210

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 77/205 (37%), Positives = 118/205 (57%), Gaps = 3/205 (1%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTYL---GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPA 64
           ++P+ S   +   +     H  + +   GFW++LMSD + F + F  Y  +      GP 
Sbjct: 3   RAPSHSYPGINLGEGHASAHKASEVVTFGFWVFLMSDLVYFGLMFAIYITMIDAQVGGPG 62

Query: 65  PIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIY 124
           P ++FD+  IF  T++LL SSL+   AMLA        + V W  VT   G+ F+++EI 
Sbjct: 63  PHELFDLKSIFAQTLILLTSSLTVGLAMLALKYNLPRARIVLWFGVTLVLGLSFLVLEIR 122

Query: 125 EFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLI 184
           +F ++  +  +PQRS FLS+++ LV LHGLHV  G IWL VL +Q+   G+      R++
Sbjct: 123 DFINMAELGGMPQRSGFLSAYYGLVPLHGLHVAAGCIWLIVLGLQLRIMGMTDLVISRVV 182

Query: 185 CLSMFWHFLDLIWICVFSFVYLMGV 209
            L++FWHFLDLIWI + + VY  G+
Sbjct: 183 RLALFWHFLDLIWIGIITIVYFGGL 207


>gi|56421992|ref|YP_149310.1| cytochrome aa3 quinol oxidase subunit III [Geobacillus kaustophilus
           HTA426]
 gi|56381834|dbj|BAD77742.1| cytochrome aa3 quinol oxidase subunit III [Geobacillus kaustophilus
           HTA426]
          Length = 204

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 115/179 (64%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++  +FA  F TY VL +   +GP   ++F++  + + T++LL SS +C  A
Sbjct: 26  LGFWIFLGAEVALFATLFATYLVLFQRTGSGPTAGELFEVKDVLIETLLLLTSSFTCGLA 85

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +      R I   ++WLLVT   G+ FI  EI EF H +   A  Q SAFLSSFF LVG 
Sbjct: 86  IFEMRRGR-ISGLIAWLLVTLLLGVGFITFEIREFIHYVHEGATMQTSAFLSSFFVLVGT 144

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+ W+ +++IQ+L++G      R++  +S++WHFLD++WI +F+ VYL+G+V
Sbjct: 145 HGAHVSVGIGWMILIIIQLLQRGFTPKTARKVFIVSLYWHFLDVVWIFIFTLVYLLGMV 203


>gi|295703991|ref|YP_003597066.1| cytochrome o quinol oxidase subunit III [Bacillus megaterium DSM
           319]
 gi|294801650|gb|ADF38716.1| cytochrome o quinol oxidase, subunit III [Bacillus megaterium DSM
           319]
          Length = 199

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 112/178 (62%), Gaps = 1/178 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           +GFW++L++DC++F   F TYAVL  + A G    + F++ G    T +LL SS +   A
Sbjct: 22  IGFWLFLVTDCILFGALFATYAVLVNHTAGGLTGKEFFEVPGFVSETFILLTSSFTSGLA 81

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +L S  K  I   + WL+VT   GM F+ +EI+EF  ++   A    SAF ++F+ LV  
Sbjct: 82  VL-SMHKGKIKPLIGWLIVTLLLGMCFVGLEIHEFQTMVHEGATISTSAFFTAFYTLVST 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           HGLHV  G+IW+  + IQ+ + G+ S  +R++  +S++WHFLD +WI +++ VYLMGV
Sbjct: 141 HGLHVSVGIIWMISITIQLKRYGITSVTKRKVTIISLYWHFLDAVWIFLYTVVYLMGV 198


>gi|251794162|ref|YP_003008893.1| cytochrome o ubiquinol oxidase subunit III [Paenibacillus sp.
           JDR-2]
 gi|247541788|gb|ACS98806.1| cytochrome o ubiquinol oxidase, subunit III [Paenibacillus sp.
           JDR-2]
          Length = 208

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 112/180 (62%), Gaps = 5/180 (2%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFW++L++D ++F   F T++VL  +   GP P ++F++ G+   T +LL SS +   A
Sbjct: 31  LGFWMFLITDVILFGTLFATFSVLHNSTNGGPTPHEMFEMPGVIAETFILLTSSFTSGIA 90

Query: 92  MLA--SATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           +L      K+ +   + WL++TA  G  FI +E+ EF  ++        S + S+FF LV
Sbjct: 91  VLQMHKGNKKGL---IGWLIITALLGASFIFLEVSEFIKMVDEGVTIGTSGYWSAFFTLV 147

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GL W+  L+IQI K+G+    +R++  +S++WHFLD++WI V + VYLMGV
Sbjct: 148 GTHGLHVSVGLCWMVGLMIQIGKRGITPVTKRKVTIVSLYWHFLDVVWIFVLTVVYLMGV 207


>gi|319652992|ref|ZP_08007097.1| cytochrome aa3 quinol oxidase subunit III [Bacillus sp. 2_A_57_CT2]
 gi|317395341|gb|EFV76074.1| cytochrome aa3 quinol oxidase subunit III [Bacillus sp. 2_A_57_CT2]
          Length = 201

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 73/179 (40%), Positives = 109/179 (60%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFW++L ++ ++FA  F  Y VL + +A GP   D+F I  + + T++LL SS +   A
Sbjct: 23  LGFWVFLGAEIVLFATLFGVYGVLYERFAGGPTHKDIFVIKDVMIQTVLLLTSSFTMGIA 82

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +       L    ++WL++T   G  F+ MEI EF H     A  Q SAFLSS F L+G 
Sbjct: 83  IFEMRRHNL-KGLITWLVITLALGAGFLFMEINEFIHYAHEGATMQTSAFLSSLFVLLGT 141

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+ W  +++IQ+LK+GL     R+   + ++WHFLD++WI +F+FVYL G+V
Sbjct: 142 HGAHVTLGIGWATMVIIQLLKRGLTPTTARKTFIIGLYWHFLDVVWIFIFTFVYLKGLV 200


>gi|260430583|ref|ZP_05784556.1| CytOchrome o ubiquinol oxidase subunit 3 [Citreicella sp. SE45]
 gi|260418612|gb|EEX11869.1| CytOchrome o ubiquinol oxidase subunit 3 [Citreicella sp. SE45]
          Length = 209

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 122/212 (57%), Gaps = 6/212 (2%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKN 58
           MS   +    N    + K  + +    +    GFWI+LMSD ++F + F +Y  A     
Sbjct: 1   MSGGNLHPGLNLGDHHGKAHRGA----EAVVFGFWIFLMSDVVIFGLVFASYLTAANPMG 56

Query: 59  YAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIF 118
            A G  P + FD+  +F  T++LL SSL+  FA LA   +        WL V+   G+ F
Sbjct: 57  MAGGTGPAEAFDLGSVFAQTVILLASSLTFGFATLALRHEDGRRAIARWLAVSLLLGLGF 116

Query: 119 IIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISG 178
           + +E+ +FAH+I + AVPQRS + S+F+ LV LHGLH+  G +W+ V++ Q+   GL+  
Sbjct: 117 LTLEMRDFAHMIEVGAVPQRSGYWSAFWGLVPLHGLHLAAGCLWIVVMLAQMATLGLVPA 176

Query: 179 NQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
            + RL+ L +FWH LDLIW+ VFS VYL G++
Sbjct: 177 VKTRLLRLGLFWHCLDLIWVAVFSIVYLGGLM 208


>gi|138897018|ref|YP_001127471.1| cytochrome aa3 quinol oxidase polypeptide III [Geobacillus
           thermodenitrificans NG80-2]
 gi|134268531|gb|ABO68726.1| Cytochrome aa3 quinol oxidase polypeptide III [Geobacillus
           thermodenitrificans NG80-2]
          Length = 204

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 75/179 (41%), Positives = 112/179 (62%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F TY VL +   +GP   ++F +  + + T++LL SS +C  A
Sbjct: 26  LGFWIFLGAEVVLFATLFATYLVLFQRTGSGPTAQELFQVKDVLIETLLLLTSSFTCGLA 85

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +      RL       LLVT   G+ FI  E+ EF H +   A  Q SAFLSSFF LVG 
Sbjct: 86  IFEMRRGRLAGLLAW-LLVTLLLGIGFITFEVREFIHYVHEGATMQTSAFLSSFFVLVGT 144

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+ W+  ++IQ+L++GL     R++  +S++WHFLD++WI +F+ VYL+G+V
Sbjct: 145 HGAHVSLGIGWMIFIIIQLLQRGLTVKTARKVFIVSLYWHFLDVVWIFIFTLVYLLGMV 203


>gi|229541705|ref|ZP_04430765.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus coagulans
           36D1]
 gi|229326125|gb|EEN91800.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus coagulans
           36D1]
          Length = 202

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 108/181 (59%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW++L ++  +FA  F TY  L    A GP   D+F++ G+ + T VLL SS +C 
Sbjct: 22  TIFGFWVFLAAEITLFATLFATYFTLQHQTAGGPVQQDIFELKGVLIETFVLLTSSFTCG 81

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
            A+  +   R     + W +VT   G+ F+  EI EF   I   A    SAFLS+F+ L+
Sbjct: 82  IAIF-NMRNRNKGAMLGWFIVTLLLGLTFVGFEINEFVTYIHDGATLPTSAFLSAFYVLL 140

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HG HV  G++W   ++IQ++++GL     R+   +S++WHFLD++WI +F+FVYL G+
Sbjct: 141 GTHGCHVSLGILWGISIIIQLIRRGLTPMTARKFFVVSIYWHFLDVVWIFIFTFVYLGGL 200

Query: 210 V 210
           +
Sbjct: 201 M 201


>gi|62263648|gb|AAX78180.1| unknown protein [synthetic construct]
          Length = 235

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 85/185 (45%), Positives = 118/185 (63%), Gaps = 1/185 (0%)

Query: 26  DHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS 85
           D      GFWIY+MSDC++FA  F T+AV  K+   GP   ++F +  +FV T++LL+SS
Sbjct: 43  DGSKNVFGFWIYIMSDCVLFATLFATFAVFHKHTFGGPGAQELFSLPYVFVETMLLLISS 102

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSF 145
            +   AML   ++ + H  + +L +T F G+ FIIME++EF  L         SAFLSSF
Sbjct: 103 FTFGLAMLNRNSENINH-VIKFLWITFFLGLGFIIMEVHEFYELAIEGHTWSSSAFLSSF 161

Query: 146 FALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
           F LVG HGLHV  GLIW+  ++ Q+ K G+    + +L  LS+FWHFLD++WI VFS VY
Sbjct: 162 FTLVGTHGLHVSMGLIWIVSMIFQLKKYGMNPMAKTKLTYLSLFWHFLDIVWIFVFSIVY 221

Query: 206 LMGVV 210
           L+G V
Sbjct: 222 LLGAV 226


>gi|56707437|ref|YP_169333.1| cytochrome O ubiquinol oxidase, subunit III [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|110669908|ref|YP_666465.1| cytochrome O ubiquinol oxidase, subunit III [Francisella tularensis
           subsp. tularensis FSC198]
 gi|224456517|ref|ZP_03664990.1| cytochrome O ubiquinol oxidase, subunit III [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|254370870|ref|ZP_04986875.1| cytochrome bo terminal oxidase subunit III [Francisella tularensis
           subsp. tularensis FSC033]
 gi|254874274|ref|ZP_05246984.1| cytochrome bo terminal oxidase subunit III [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|56603929|emb|CAG44916.1| Cytochrome O ubiquinol oxidase, subunit III [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|110320241|emb|CAL08299.1| Cytochrome O ubiquinol oxidase, subunit III [Francisella tularensis
           subsp. tularensis FSC198]
 gi|151569113|gb|EDN34767.1| cytochrome bo terminal oxidase subunit III [Francisella tularensis
           subsp. tularensis FSC033]
 gi|254840273|gb|EET18709.1| cytochrome bo terminal oxidase subunit III [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|282158579|gb|ADA77970.1| Cytochrome O ubiquinol oxidase, subunit III [Francisella tularensis
           subsp. tularensis NE061598]
          Length = 200

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 85/185 (45%), Positives = 118/185 (63%), Gaps = 1/185 (0%)

Query: 26  DHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS 85
           D      GFWIY+MSDC++FA  F T+AV  K+   GP   ++F +  +FV T++LL+SS
Sbjct: 17  DGSKNVFGFWIYIMSDCVLFATLFATFAVFHKHTFGGPGAQELFSLPYVFVETMLLLISS 76

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSF 145
            +   AML   ++ + H  + +L +T F G+ FIIME++EF  L         SAFLSSF
Sbjct: 77  FTFGLAMLNRNSENINH-VIKFLWITFFLGLGFIIMEVHEFYELAIEGHTWSSSAFLSSF 135

Query: 146 FALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
           F LVG HGLHV  GLIW+  ++ Q+ K G+    + +L  LS+FWHFLD++WI VFS VY
Sbjct: 136 FTLVGTHGLHVSMGLIWIVSMIFQLKKYGMNPMAKTKLTYLSLFWHFLDIVWIFVFSIVY 195

Query: 206 LMGVV 210
           L+G V
Sbjct: 196 LLGAV 200


>gi|213857961|ref|ZP_03384932.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhi str. M223]
          Length = 132

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 74/133 (55%), Positives = 95/133 (71%), Gaps = 1/133 (0%)

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T +LL SS++   A +A   K    + +SWL +T  FG  FI MEIYEF HLI     P 
Sbjct: 1   TFLLLFSSITYGMAAIA-MHKNNKSQVISWLALTFLFGAGFIGMEIYEFHHLIVNGMGPD 59

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
           RS FLS+FFALVG HGLHV  GLIW+ VL++Q+ ++GL S N+ R++CLS+FWHFLD+IW
Sbjct: 60  RSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQVARRGLTSTNRTRIMCLSLFWHFLDVIW 119

Query: 198 ICVFSFVYLMGVV 210
           ICVF+ VYLMG +
Sbjct: 120 ICVFTVVYLMGAM 132


>gi|126730196|ref|ZP_01746008.1| cytochrome o ubiquinol oxidase subunit III [Sagittula stellata
           E-37]
 gi|126709576|gb|EBA08630.1| cytochrome o ubiquinol oxidase subunit III [Sagittula stellata
           E-37]
          Length = 211

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 116/209 (55%), Gaps = 2/209 (0%)

Query: 2   SRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAA 61
           S       P  +L     +     D +    GFWI+LMSD + FA+FF TYA      A 
Sbjct: 4   STANANSHPGLNLGPAHGQAHK--DAETVVFGFWIFLMSDLVTFAMFFATYAASIHATAG 61

Query: 62  GPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIM 121
           GP   D+ D++ I + T  LL+SSL    A +A         T+ WLL +  FG+ F+ +
Sbjct: 62  GPGNADIVDVTSIGLQTGALLISSLLFGIATVAMKHGSSPRSTILWLLASLAFGLCFLGL 121

Query: 122 EIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQR 181
           E+ +F       AVP RS +LS+++ALVGLHGLHV  G + + V+ +QI   G     + 
Sbjct: 122 EVRDFIDAAEKGAVPMRSGYLSAYWALVGLHGLHVTVGSLMILVVCVQIAIFGFADDVKT 181

Query: 182 RLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           R++ L ++WHFLD+IWI +FS V+L G++
Sbjct: 182 RVLRLGLYWHFLDIIWIGIFSVVFLPGLL 210


>gi|319760378|ref|YP_004124316.1| cytochrome o ubiquinol oxidase, subunit III [Candidatus Blochmannia
           vafer str. BVAF]
 gi|318039092|gb|ADV33642.1| cytochrome o ubiquinol oxidase, subunit III [Candidatus Blochmannia
           vafer str. BVAF]
          Length = 198

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 118/181 (65%), Gaps = 4/181 (2%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAA---GPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           GFW+Y+MSDC++FA  F  + VL K+            +F+++ IF  T++LLLSSL+C 
Sbjct: 19  GFWLYIMSDCILFASLFAMHIVLSKHLNITVFDDHNNSIFNLNFIFSETVLLLLSSLACC 78

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
            +M     K    K + W+ +T   G+ FII+EIYEF HLI     P  +AF SSFF L+
Sbjct: 79  KSMFY-INKTWAQKFMQWICITELLGLCFIILEIYEFFHLIHHGYTPCYNAFFSSFFILI 137

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HG+HV  GLIW+ +++IQ+   GL   N  RL CLS+FWHFLD++WICVF+ VYL+G+
Sbjct: 138 GTHGIHVIVGLIWIIIMIIQLTLNGLTQTNLIRLQCLSLFWHFLDIVWICVFTIVYLIGI 197

Query: 210 V 210
           +
Sbjct: 198 L 198


>gi|289606612|emb|CBI61109.1| unnamed protein product [Sordaria macrospora]
          Length = 118

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 66/107 (61%), Positives = 86/107 (80%)

Query: 104 TVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWL 163
           T+ WL +T  FG+ F+ +E+YEF+HLI   A PQRSAFLSSFF LVG HGLHV FG++WL
Sbjct: 12  TLRWLAITGVFGLCFLGIELYEFSHLIHEGAGPQRSAFLSSFFTLVGTHGLHVTFGIVWL 71

Query: 164 FVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
             L++Q+ K GL + N RRL+CLS+FWHFLD++WI VF+FVYL+GV+
Sbjct: 72  VTLMVQVAKFGLGAANMRRLMCLSLFWHFLDVVWIGVFTFVYLLGVL 118


>gi|238783617|ref|ZP_04627638.1| Cytochrome o ubiquinol oxidase subunit 3 [Yersinia bercovieri ATCC
           43970]
 gi|238715495|gb|EEQ07486.1| Cytochrome o ubiquinol oxidase subunit 3 [Yersinia bercovieri ATCC
           43970]
          Length = 139

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 71/135 (52%), Positives = 97/135 (71%), Gaps = 1/135 (0%)

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           + V T +LL SS++   AML    K   ++  +WL +T  FG+ F+ MEIYEF HLI+  
Sbjct: 4   VLVETFLLLFSSITYGVAMLG-MNKGNKNQVNTWLGLTFLFGLGFVAMEIYEFHHLIAEG 62

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
             P RSAFLSSFFALV  HG+HV  GL+W+ +++IQ+ K+GL   N+ RL+CLS+FWHFL
Sbjct: 63  YGPDRSAFLSSFFALVATHGIHVTAGLVWIIIMMIQVAKRGLNEMNRTRLMCLSLFWHFL 122

Query: 194 DLIWICVFSFVYLMG 208
           D++WICVF+ VYL+G
Sbjct: 123 DVVWICVFTVVYLLG 137


>gi|311029888|ref|ZP_07707978.1| cytochrome c oxidase, subunit III [Bacillus sp. m3-13]
          Length = 207

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 120/194 (61%), Gaps = 3/194 (1%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG--KNYAAGPAPIDVFDISGIFV 76
             +++ ++    +LGFW++L  + ++FA  F TY  L    +  +GP   ++FD++ +F 
Sbjct: 15  SPEKATLEGKNKFLGFWLFLGGETVLFASLFATYLALSGPDSIVSGPDQKELFDLALVFA 74

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
           +T++LL SSL+  +AM          K   W+ +T   G+ F+I+EIYEF H I +    
Sbjct: 75  ATMILLTSSLTSVYAMYHMKNFNF-KKMQLWMGITWLLGLSFLILEIYEFNHYIHLGHTI 133

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
             SAF S+F+ LVG HG HVFFGL+W+  L+I+ +++GL   N  +    S++WHF+D++
Sbjct: 134 TSSAFGSAFYVLVGTHGAHVFFGLLWIGTLLIRNMRRGLDLYNAPKFYVASLYWHFIDVV 193

Query: 197 WICVFSFVYLMGVV 210
           W+ +F+ VYLMG+V
Sbjct: 194 WLFIFTVVYLMGLV 207


>gi|94495038|ref|ZP_01301619.1| cytochrome o ubiquinol oxidase subunit III [Sphingomonas sp. SKA58]
 gi|94425304|gb|EAT10324.1| cytochrome o ubiquinol oxidase subunit III [Sphingomonas sp. SKA58]
          Length = 208

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 119/203 (58%), Gaps = 2/203 (0%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPID 67
           K    +L     K  +  +H     GFWI+LMSD ++FA+ F TY V+    A GP P  
Sbjct: 7   KHAGLNLGGTDAKTHAEAEH--AIFGFWIFLMSDAVIFALLFATYGVMLPATAGGPTPTS 64

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
           VF I   F  T++LL SSL+   A +A      +     WL VT   G+IF+  E ++F+
Sbjct: 65  VFKIGPTFAETLLLLTSSLTYGMASVAMKHGSPLGGIHRWLAVTLLLGLIFLAFEWHDFS 124

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
            + +  A P RS FLS+FF LV LHGLHV  G++W+ V+++Q+   GL +  +  L+ L 
Sbjct: 125 DMFAQGAYPTRSGFLSAFFGLVPLHGLHVIAGIVWILVMMVQLRVFGLDARVKINLLRLG 184

Query: 188 MFWHFLDLIWICVFSFVYLMGVV 210
           +FWHFLD++WI +FS VYL G++
Sbjct: 185 LFWHFLDIVWIAIFSTVYLPGLL 207


>gi|118496811|ref|YP_897861.1| cytochrome bo terminal oxidase subunit III [Francisella tularensis
           subsp. novicida U112]
 gi|134302623|ref|YP_001122594.1| cytochrome o ubiquinol oxidase subunit III [Francisella tularensis
           subsp. tularensis WY96-3418]
 gi|194324508|ref|ZP_03058280.1| cytochrome o ubiquinol oxidase subunit III [Francisella tularensis
           subsp. novicida FTE]
 gi|208780574|ref|ZP_03247913.1| cytochrome o ubiquinol oxidase subunit III [Francisella novicida
           FTG]
 gi|254372175|ref|ZP_04987667.1| hypothetical protein FTCG_01558 [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|254373656|ref|ZP_04989140.1| cytochrome o ubiquinol oxidase subunit III [Francisella novicida
           GA99-3548]
 gi|118422717|gb|ABK89107.1| cytochrome bo terminal oxidase subunit III [Francisella novicida
           U112]
 gi|134050400|gb|ABO47471.1| cytochrome o ubiquinol oxidase subunit III [Francisella tularensis
           subsp. tularensis WY96-3418]
 gi|151569905|gb|EDN35559.1| hypothetical protein FTCG_01558 [Francisella novicida GA99-3549]
 gi|151571378|gb|EDN37032.1| cytochrome o ubiquinol oxidase subunit III [Francisella novicida
           GA99-3548]
 gi|194321343|gb|EDX18829.1| cytochrome o ubiquinol oxidase subunit III [Francisella tularensis
           subsp. novicida FTE]
 gi|208743549|gb|EDZ89854.1| cytochrome o ubiquinol oxidase subunit III [Francisella novicida
           FTG]
 gi|328676273|gb|AEB27143.1| Cytochrome O ubiquinol oxidase subunit III [Francisella cf.
           novicida Fx1]
          Length = 200

 Score =  141 bits (355), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 117/185 (63%), Gaps = 1/185 (0%)

Query: 26  DHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS 85
           D      GFWIY+MSDC++FA  F T+AV  K+   GP   ++F +  +FV T++LL+SS
Sbjct: 17  DGSKNVFGFWIYIMSDCVLFATLFATFAVFHKHTFGGPGAQELFSLPYVFVETMLLLISS 76

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSF 145
            +   AML   ++ + H  + +L +T F G+ FIIME++EF  L         SAFLSSF
Sbjct: 77  FTFGLAMLNRNSENINH-VIKFLWITFFLGLGFIIMEVHEFYELAIEGHTWSSSAFLSSF 135

Query: 146 FALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
           F LVG HGLHV  GLIW+  ++ Q+ K G+    + +L  L +FWHFLD++WI VFS VY
Sbjct: 136 FTLVGTHGLHVSMGLIWIVSMIFQLKKYGMNPMAKTKLTYLGLFWHFLDIVWIFVFSIVY 195

Query: 206 LMGVV 210
           L+G V
Sbjct: 196 LLGAV 200


>gi|254486919|ref|ZP_05100124.1| Cytochrome o ubiquinol oxidase subunit 3 [Roseobacter sp. GAI101]
 gi|214043788|gb|EEB84426.1| Cytochrome o ubiquinol oxidase subunit 3 [Roseobacter sp. GAI101]
          Length = 211

 Score =  140 bits (354), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 116/209 (55%), Gaps = 2/209 (0%)

Query: 2   SRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAA 61
           S   +   P  +L     +     D +    GFWI+LMSD + FA+FF  YA   +  A 
Sbjct: 4   STSHLKSHPGLNLGAAHGQAHE--DAEPVVFGFWIFLMSDLVTFAMFFAVYATSLQATAG 61

Query: 62  GPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIM 121
           GP   D+ D++ I + T  LL+SSL    A +A          + WL+ +  FG+ F+ +
Sbjct: 62  GPGNADIVDVTSIALQTAALLVSSLLFGIATVAMKHGSAARTVIFWLIASLAFGLCFLGL 121

Query: 122 EIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQR 181
           E+ +F       AVP RS +LS+F+ALVGLHGLHV  G I + V+  QI   G  S  + 
Sbjct: 122 EVRDFIDAAEKGAVPMRSGYLSAFWALVGLHGLHVAVGSIMILVVCAQIAFFGFASDVKT 181

Query: 182 RLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           R++ L ++WHFLD+IWI +FS V+L G++
Sbjct: 182 RVLRLGLYWHFLDIIWIGIFSVVFLPGLL 210


>gi|49473794|ref|YP_031836.1| cytochrome o ubiquinol oxidase subunit III [Bartonella quintana
           str. Toulouse]
 gi|49239297|emb|CAF25623.1| Cytochrome o ubiquinol oxidase subunit III [Bartonella quintana
           str. Toulouse]
          Length = 221

 Score =  140 bits (354), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 115/198 (58%), Gaps = 21/198 (10%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+Y++SD ++F+  F ++AV   +Y  G    +  D++ + V T +LLLSS++  F M
Sbjct: 25  GFWVYILSDLILFSTLFSSFAVFSASYGGGKPGNEFIDLNFVLVETAILLLSSITYGFVM 84

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS----------MEAVPQR---- 138
           +  A K  I     W+ VT  FG  FI MEIYEF  L++              P +    
Sbjct: 85  V-QAHKGNISGVRLWMTVTFVFGFCFIGMEIYEFHELLNEVFYYDPGAYAGIDPAKGLKL 143

Query: 139 ------SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                 SA+ S+FFALVG HGLHV  GL+W+ V+   + ++GL   N+ RL CLS+FWH 
Sbjct: 144 FGREVLSAYWSAFFALVGTHGLHVSVGLLWMIVMFFHLRRRGLDQDNKTRLACLSIFWHL 203

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD++W+ VF+ VYL+G +
Sbjct: 204 LDIVWVGVFTMVYLLGAL 221


>gi|89255627|ref|YP_512988.1| cytochrome O ubiquinol oxidase, subunit III [Francisella tularensis
           subsp. holarctica LVS]
 gi|115314131|ref|YP_762854.1| cytochrome o ubiquinol oxidase subunit III [Francisella tularensis
           subsp. holarctica OSU18]
 gi|156501576|ref|YP_001427641.1| cytochrome C oxidase/ubiquinol oxidase subunit III [Francisella
           tularensis subsp. holarctica FTNF002-00]
 gi|167009931|ref|ZP_02274862.1| cytOchrome o ubiquinol oxidase subunit III [Francisella tularensis
           subsp. holarctica FSC200]
 gi|254367021|ref|ZP_04983057.1| cytochrome O ubiquinol oxidase subunit III [Francisella tularensis
           subsp. holarctica 257]
 gi|254368562|ref|ZP_04984578.1| hypothetical protein FTAG_01546 [Francisella tularensis subsp.
           holarctica FSC022]
 gi|290953474|ref|ZP_06558095.1| cytochrome o ubiquinol oxidase subunit III [Francisella tularensis
           subsp. holarctica URFT1]
 gi|295313272|ref|ZP_06803909.1| cytochrome o ubiquinol oxidase subunit III [Francisella tularensis
           subsp. holarctica URFT1]
 gi|89143458|emb|CAJ78634.1| Cytochrome O ubiquinol oxidase, subunit III [Francisella tularensis
           subsp. holarctica LVS]
 gi|115129030|gb|ABI82217.1| cytochrome o ubiquinol oxidase subunit III [Francisella tularensis
           subsp. holarctica OSU18]
 gi|134252847|gb|EBA51941.1| cytochrome O ubiquinol oxidase subunit III [Francisella tularensis
           subsp. holarctica 257]
 gi|156252179|gb|ABU60685.1| cytochrome C oxidase/ubiquinol oxidase, subunit III [Francisella
           tularensis subsp. holarctica FTNF002-00]
 gi|157121465|gb|EDO65656.1| hypothetical protein FTAG_01546 [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 200

 Score =  140 bits (354), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 117/185 (63%), Gaps = 1/185 (0%)

Query: 26  DHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS 85
           D      GFWIY+MSDC++FA  F T+AV  K+   GP   ++F +  +FV T++LL+SS
Sbjct: 17  DGSKNVFGFWIYIMSDCVLFATLFATFAVFHKHTFGGPGAQELFSLPYVFVETMLLLISS 76

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSF 145
            +   AML   ++ + H  + +L +T F G+ FIIME++EF  L         SAFLSSF
Sbjct: 77  FTFGLAMLNHNSENINH-VIKFLWITFFLGLGFIIMEVHEFYELAIEGHTWSSSAFLSSF 135

Query: 146 FALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
           F LVG HGLHV  GLIW+  ++ Q+ K G+    + +L  L +FWHFLD++WI VFS VY
Sbjct: 136 FTLVGTHGLHVSMGLIWIVSMIFQLKKYGMNPMAKTKLTYLGLFWHFLDIVWIFVFSIVY 195

Query: 206 LMGVV 210
           L+G V
Sbjct: 196 LLGAV 200


>gi|54113707|gb|AAV29487.1| NT02FT0910 [synthetic construct]
          Length = 200

 Score =  140 bits (354), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 118/185 (63%), Gaps = 1/185 (0%)

Query: 26  DHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS 85
           D      GFWIY+MSDC++FA  F T+AV  K+   GP   ++F +  +FV T++LL+SS
Sbjct: 17  DGSKNVFGFWIYIMSDCVLFATLFATFAVFHKHTFGGPGAQELFSLPYVFVETMLLLISS 76

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSF 145
            +   AML   ++ + H  + +L +T F G+ FIIME++EF  L         SAFLSSF
Sbjct: 77  FTFGLAMLNRNSENINH-VIKFLWITFFLGLGFIIMEVHEFYELAIEGHTWSSSAFLSSF 135

Query: 146 FALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
           F LVG HGLHV  GLIW+  ++ Q+ K G+    + +L  LS+FWHFLD++WI VFS V+
Sbjct: 136 FTLVGTHGLHVSMGLIWIVSMIFQLKKYGMNPMAKTKLTYLSLFWHFLDIVWIFVFSIVH 195

Query: 206 LMGVV 210
           L+G V
Sbjct: 196 LLGAV 200


>gi|328675365|gb|AEB28040.1| Cytochrome O ubiquinol oxidase subunit III [Francisella cf.
           novicida 3523]
          Length = 200

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 83/185 (44%), Positives = 117/185 (63%), Gaps = 1/185 (0%)

Query: 26  DHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS 85
           D      GFWIY+MSDC++FA  F T+AV  K+   GP   ++F +  +FV T++LL+SS
Sbjct: 17  DGSKNVFGFWIYIMSDCVLFATLFATFAVFHKHTFGGPGAQELFSLPYVFVETMLLLISS 76

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSF 145
            +   AML   ++ + H  + +L +T F G+ FI+ME++EF  L         SAFLSSF
Sbjct: 77  FTFGLAMLNRNSENINH-VIKFLWITFFLGLGFIVMEVHEFYELAIEGHTWSSSAFLSSF 135

Query: 146 FALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
           F LVG HGLHV  GLIW+  ++ Q+ K G+    + +L  L +FWHFLD++WI VFS VY
Sbjct: 136 FTLVGTHGLHVSMGLIWIVSMIFQLKKYGMNPMAKTKLTYLGLFWHFLDIVWIFVFSIVY 195

Query: 206 LMGVV 210
           L+G V
Sbjct: 196 LLGAV 200


>gi|27904894|ref|NP_778020.1| cytochrome O ubiquinol oxidase subunit III [Buchnera aphidicola
           str. Bp (Baizongia pistaciae)]
 gi|46395811|sp|Q89AA5|CYOC_BUCBP RecName: Full=Cytochrome o ubiquinol oxidase subunit 3; AltName:
           Full=Cytochrome o ubiquinol oxidase subunit III
 gi|27904292|gb|AAO27125.1| cytochrome O ubiquinol oxidase subunit III [Buchnera aphidicola
           str. Bp (Baizongia pistaciae)]
          Length = 194

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 122/194 (62%), Gaps = 4/194 (2%)

Query: 20  KKESCVDHD---GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
           KK+  +D +      LGFW+YLMSDC++F   F  Y +L  N A GP+  ++F  + I +
Sbjct: 2   KKKYKIDTNIFSKELLGFWLYLMSDCIIFCTLFSVYFILVDNVAQGPSGHNIFQNNLIII 61

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T +LL SS SC+  +     K L +    WL +T   G++F+ +E++EF HLI++   P
Sbjct: 62  ETFLLLFSSFSCNLVLFEMKNKNL-YMVFLWLGITFLLGLLFVFLELFEFFHLINLGFGP 120

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
            RS FLSSFF L+  HG+HV  GLIW+ V++  +    + +    R++CL++FWHFLD++
Sbjct: 121 TRSGFLSSFFVLIATHGIHVISGLIWIIVMIKYVYTFNITNLIYYRMLCLNLFWHFLDIV 180

Query: 197 WICVFSFVYLMGVV 210
           W+ +FSFVYL G+V
Sbjct: 181 WVFIFSFVYLFGMV 194


>gi|163867421|ref|YP_001608618.1| cytochrome o ubiquinol oxidase subunit III [Bartonella tribocorum
           CIP 105476]
 gi|161017065|emb|CAK00623.1| cytochrome o ubiquinol oxidase subunit III [Bartonella tribocorum
           CIP 105476]
          Length = 222

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 83/220 (37%), Positives = 121/220 (55%), Gaps = 27/220 (12%)

Query: 17  VKDKKESCVD---HDGTYL---GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFD 70
           V     S VD   HD + +   GFW+Y++SD ++F+  F ++AV   +Y  G A  +  D
Sbjct: 4   VTMNNASTVDELHHDSSSVMTFGFWVYILSDLILFSTLFSSFAVFSASYGGGKAGNEFID 63

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
           +  + V T  LL SS++  FAM+  A K  I     W+ +T  FG  FI ME+YEF  L+
Sbjct: 64  LKFVLVETAFLLFSSVTYGFAMV-QAHKNNISGVRLWMAITFVFGCCFIAMELYEFHELL 122

Query: 131 ------------------SMEAVPQR--SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQI 170
                              ++   +   SA+ S+FFALVG HGLHV  GL+W+ V+   +
Sbjct: 123 GEVFYYDPNAYAGIDPATGLQLFGREILSAYWSAFFALVGTHGLHVSVGLLWMVVMFFHL 182

Query: 171 LKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
            + GL   N+ RL CLS+FWH LD++WI VF+ VYL+G +
Sbjct: 183 RRNGLDQNNKTRLACLSIFWHLLDIVWIGVFTMVYLLGAL 222


>gi|319405034|emb|CBI78644.1| cytochrome o ubiquinol oxidase subunit III [Bartonella sp. AR 15-3]
          Length = 223

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 124/214 (57%), Gaps = 24/214 (11%)

Query: 20  KKESCVDHDGTYL---GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
             E   DH  + +   GFW+Y++SD ++F+  F ++AV   +Y  G A  +  +++ + V
Sbjct: 11  TDEYHHDHHNSSIMIFGFWVYILSDLILFSTLFSSFAVFSASYGGGKAGNEFINLNFVLV 70

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS----- 131
            T+VLL SS++  FAM+  A K  + K   W+ +T   G+ FI MEIYEF  L++     
Sbjct: 71  ETVVLLFSSITYGFAMVY-AHKGCLSKLRVWMAITFVLGLCFIGMEIYEFYELLNEVFYY 129

Query: 132 -------------MEAVPQR--SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLI 176
                        +++  +   SA+ S+FFALVG HGLHV  GL+W+ V+   + + GL 
Sbjct: 130 DPNAYAGVDPATGIKSFGKNVLSAYWSAFFALVGTHGLHVSVGLLWMVVMFFHLHRSGLD 189

Query: 177 SGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
             N+ RL CLS+FWH LD++WI VF+ VYL+G +
Sbjct: 190 QDNKTRLTCLSIFWHLLDIVWIGVFTMVYLLGAL 223


>gi|319403607|emb|CBI77192.1| cytochrome o ubiquinol oxidase subunit III [Bartonella rochalimae
           ATCC BAA-1498]
          Length = 223

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 120/198 (60%), Gaps = 21/198 (10%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+Y++SD ++F+  F ++AV   +Y  G A  +  +++ + V T +LLLSS++  FAM
Sbjct: 27  GFWVYILSDLVLFSTLFSSFAVFSASYGGGKAGNEFINLNFVLVETAILLLSSITYGFAM 86

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS------------------MEA 134
           +  A K  + K   W+ +T  FG+ F+ MEIYEF  L++                  +++
Sbjct: 87  V-YAHKGSLAKLRVWMAITFAFGLCFVGMEIYEFYELLNEVFYYDPNAYAGVDPTTGIKS 145

Query: 135 VPQR--SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
             +   SA+ S+FFALVG HGLHV  GL+W+ V+   + + GL   N+ RL CLS+FWH 
Sbjct: 146 FGRNVLSAYWSAFFALVGTHGLHVSVGLLWMVVMFFHLRRSGLDQDNKTRLTCLSIFWHL 205

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD++W+ VF+ VYL+G +
Sbjct: 206 LDIVWVGVFTMVYLLGAL 223


>gi|167463409|ref|ZP_02328498.1| cytochrome aa3 quinol oxidase (subunit III) [Paenibacillus larvae
           subsp. larvae BRL-230010]
          Length = 206

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 71/179 (39%), Positives = 109/179 (60%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++F+  F T+ VL    A GP P D+F+I G+ + T +LL SS +C  A
Sbjct: 28  LGFWIFLGAEIVLFSTLFATFMVLVNRVADGPTPQDLFEIKGVLIQTFLLLTSSFTCGIA 87

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +     +R +   V WL++T   G+ F+  EI EF   +   A    SAF SSFF L G 
Sbjct: 88  V-HELRRRNVKGLVLWLVITLALGLGFLGFEIKEFVEYVHEGATIGTSAFWSSFFVLAGT 146

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+ W+ +++ Q+LK+GL      ++  +S++WHFLD++WI +F+ VYL  +V
Sbjct: 147 HGAHVTLGIGWMILIIFQLLKRGLTPFTSSKVFIVSLYWHFLDVVWIFIFTVVYLARMV 205


>gi|121602479|ref|YP_989522.1| cytochrome o ubiquinol oxidase, subunit III [Bartonella
           bacilliformis KC583]
 gi|120614656|gb|ABM45257.1| cytochrome o ubiquinol oxidase, subunit III [Bartonella
           bacilliformis KC583]
          Length = 221

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 81/198 (40%), Positives = 114/198 (57%), Gaps = 21/198 (10%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+Y++SD + F+  F ++AV    Y  G A  +  +++ +   T VLLLSSL+  F M
Sbjct: 25  GFWVYILSDLVAFSTLFSSFAVFSAAYGGGKAGNEFINLNFVLAETAVLLLSSLTYGFVM 84

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL--------------ISMEAVPQ- 137
           +      L    + W+ VT   G+IFI MEIYEF  L              I +E   Q 
Sbjct: 85  IQVHKCNLAGVRL-WMAVTFVLGLIFIGMEIYEFHELLHEVYYYDATAYAGIDLETGKQI 143

Query: 138 -----RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                 SA+ S+FFALVG+HGLHV  GL+W+ V+ I + + GL   N+ RL CLS+FWH 
Sbjct: 144 FGREVLSAYWSAFFALVGMHGLHVSAGLLWMVVMFIHLRRNGLDQDNKTRLSCLSIFWHM 203

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD++WI VF+ VYL+G +
Sbjct: 204 LDIVWIGVFTMVYLLGAL 221


>gi|322382244|ref|ZP_08056156.1| cytochrome quinol oxidase-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321153792|gb|EFX46161.1| cytochrome quinol oxidase-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 191

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 71/179 (39%), Positives = 109/179 (60%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++F+  F T+ VL    A GP P D+F+I G+ + T +LL SS +C  A
Sbjct: 13  LGFWIFLGAEIVLFSTLFATFMVLVNRVADGPTPQDLFEIKGVLIQTFLLLTSSFTCGIA 72

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +     +R +   V WL++T   G+ F+  EI EF   +   A    SAF SSFF L G 
Sbjct: 73  V-HELRRRNVKGLVLWLVITLALGLGFLGFEIKEFVEYVHEGATIGTSAFWSSFFVLAGT 131

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+ W+ +++ Q+LK+GL      ++  +S++WHFLD++WI +F+ VYL  +V
Sbjct: 132 HGAHVTLGIGWMILIIFQLLKRGLTPFTSSKVFIVSLYWHFLDVVWIFIFTVVYLARMV 190


>gi|229086506|ref|ZP_04218678.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock3-44]
 gi|228696823|gb|EEL49636.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock3-44]
          Length = 207

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 73/194 (37%), Positives = 118/194 (60%), Gaps = 4/194 (2%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++    ++GFW++L  + ++FA  F TY  L  +   GP   ++F +  +F+ T
Sbjct: 15  EPEKATLEGKNKFVGFWLFLGGETVLFASLFGTYLALKNSTNGGPTSQEMFQMPLVFIMT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVS-WLLVTAFFGMIFIIMEIYEFAHLI-SMEAVP 136
           ++LL SSL+  +AM     K    K +  WL+VT   G+ F+  EIYEF H     +   
Sbjct: 75  MLLLTSSLTSVYAMYH--MKNFNFKQMQLWLIVTVLLGLGFLGFEIYEFYHYTHEFKHTM 132

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
           + SAF S+F+ALVG HGLHV FGL+W+  LV +  K+GL   N  +    S++WHF+D++
Sbjct: 133 RSSAFGSAFYALVGTHGLHVLFGLLWILTLVFRNAKRGLNLYNAPKFYVASIYWHFIDVV 192

Query: 197 WICVFSFVYLMGVV 210
           W+ +F+ VYLMG+V
Sbjct: 193 WVFIFTVVYLMGMV 206


>gi|187932182|ref|YP_001892167.1| cytochrome bo terminal oxidase subunit III [Francisella tularensis
           subsp. mediasiatica FSC147]
 gi|187713091|gb|ACD31388.1| cytochrome bo terminal oxidase subunit III [Francisella tularensis
           subsp. mediasiatica FSC147]
          Length = 200

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 116/185 (62%), Gaps = 1/185 (0%)

Query: 26  DHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS 85
           D      GFWIY+MSDC++FA  F T+AV  K+   GP   ++F +  +FV T++LL+SS
Sbjct: 17  DGSKNVFGFWIYIMSDCVLFATLFATFAVFHKHTFGGPGAQELFSLPYVFVETMLLLISS 76

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSF 145
                AML   ++ + H  + +L +T F G+ FIIME++EF  L         SAFLSSF
Sbjct: 77  FIFGLAMLNRNSENINH-VIKFLWITFFLGLGFIIMEVHEFYELAIEGHTWSSSAFLSSF 135

Query: 146 FALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
           F LVG HGLHV  GLIW+  ++ Q+ K G+    + +L  L +FWHFLD++WI VFS VY
Sbjct: 136 FTLVGTHGLHVSMGLIWIVSMIFQLKKYGMNPMAKTKLTYLGLFWHFLDIVWIFVFSIVY 195

Query: 206 LMGVV 210
           L+G V
Sbjct: 196 LLGAV 200


>gi|260430763|ref|ZP_05784735.1| CytOchrome o ubiquinol oxidase subunit 3 [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260418204|gb|EEX11462.1| CytOchrome o ubiquinol oxidase subunit 3 [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 184

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 76/177 (42%), Positives = 107/177 (60%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW++LMSD + F + F  Y  +    A GP P ++FD+  IF  T++LL SSL+   AM
Sbjct: 5   GFWVFLMSDLVYFGLMFGVYITMIDAQAGGPGPHELFDLYSIFAQTLILLTSSLTVGLAM 64

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           LA        + V W  VT   G+ F+++EI +F  +     +PQRS FLS+F+ LV LH
Sbjct: 65  LALKYNLPRGRIVLWFAVTLLLGLSFLVLEIRDFMSMADKGGIPQRSGFLSAFYGLVPLH 124

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           GLHV  G +WL VL IQ+   G+      R++ L++FWHFLDLIWI + + VY  G+
Sbjct: 125 GLHVAAGCVWLVVLGIQLRVMGMTDLVVSRMVRLALFWHFLDLIWIGIITIVYFGGL 181


>gi|52080094|ref|YP_078885.1| cytochrome caa3 oxidase subunit III [Bacillus licheniformis ATCC
           14580]
 gi|52785468|ref|YP_091297.1| CtaE [Bacillus licheniformis ATCC 14580]
 gi|319646131|ref|ZP_08000361.1| CtaE protein [Bacillus sp. BT1B_CT2]
 gi|52003305|gb|AAU23247.1| cytochrome caa3 oxidase (subunit III) [Bacillus licheniformis ATCC
           14580]
 gi|52347970|gb|AAU40604.1| CtaE [Bacillus licheniformis ATCC 14580]
 gi|317391881|gb|EFV72678.1| CtaE protein [Bacillus sp. BT1B_CT2]
          Length = 207

 Score =  139 bits (349), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 116/194 (59%), Gaps = 4/194 (2%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
             +++ ++    ++GFW++L  + ++FA  F TY  L  + A GP   ++FD+  +F++T
Sbjct: 15  SPEKATLEGKNKFIGFWLFLGGETVLFASLFATYLALKNSNAGGPKTTEMFDMGLVFLAT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVS-WLLVTAFFGMIFIIMEIYEFAHLISMEAVP- 136
           ++LL SSL+  +AM     K    K +  WL +T   G  F+ +EIYEF H I       
Sbjct: 75  MLLLTSSLTSVYAMYH--MKNFAFKKMQVWLGITVLLGAGFLALEIYEFTHYIHEYGFTI 132

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
           Q SA  S+F+ LVG HG HV FGL+W+  L+I+   +GL   N  +    S++WHF+D++
Sbjct: 133 QSSALGSAFYTLVGTHGAHVTFGLLWILSLMIRNAGRGLSLYNAPKFFVASLYWHFIDVV 192

Query: 197 WICVFSFVYLMGVV 210
           W+ +F+ VYLMG+V
Sbjct: 193 WVFIFTVVYLMGMV 206


>gi|294504896|ref|YP_003568958.1| cytochrome O ubiquinol oxidase subunit III [Yersinia pestis
           Z176003]
 gi|262362962|gb|ACY59683.1| cytochrome O ubiquinol oxidase subunit III [Yersinia pestis
           D106004]
 gi|262366881|gb|ACY63438.1| cytochrome O ubiquinol oxidase subunit III [Yersinia pestis
           D182038]
 gi|294355355|gb|ADE65696.1| cytochrome O ubiquinol oxidase subunit III [Yersinia pestis
           Z176003]
          Length = 139

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 96/137 (70%), Gaps = 1/137 (0%)

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           + V T +LL SS++   AML   +K  + +  +WL  T  FG+ FI ME+YEF  LI   
Sbjct: 4   VLVETFLLLFSSITYGVAMLG-MSKGSVKQVNTWLGFTFLFGLGFIAMELYEFHKLIEEG 62

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
             P RS FLS++FALVG HGLHV  GL W+ +++IQ+ ++GL S N+ RL+CLS+FWHFL
Sbjct: 63  YGPARSGFLSAYFALVGTHGLHVTAGLAWIIIMMIQVARRGLNSTNRTRLMCLSLFWHFL 122

Query: 194 DLIWICVFSFVYLMGVV 210
           D++WICVF+ VYL+G +
Sbjct: 123 DVVWICVFTVVYLLGAI 139


>gi|319898315|ref|YP_004158408.1| cytochrome o ubiquinol oxidase subunit III [Bartonella clarridgeiae
           73]
 gi|319402279|emb|CBI75818.1| cytochrome o ubiquinol oxidase subunit III [Bartonella clarridgeiae
           73]
          Length = 223

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 124/214 (57%), Gaps = 24/214 (11%)

Query: 20  KKESCVDHDGTYL---GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
             E   DH  + +   GFW+Y++SD ++F+  F ++AV   +Y  G A  +  +++ + V
Sbjct: 11  TNEYHHDHHNSSIMIFGFWVYILSDLILFSTLFSSFAVFSASYGGGKAGNEFINLNFVLV 70

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS----- 131
            T +LLLSS++  FAM+ +    L +  V W+ +T   G+ F+ ME+YEF  L++     
Sbjct: 71  ETTILLLSSITYGFAMVYAYKGSLANLRV-WMAITFALGLCFVGMELYEFHELLNEVFYY 129

Query: 132 -------------MEAVPQR--SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLI 176
                        +++  +   SA+ S+FFALVG HGLHV  GL+W+ V+   + + GL 
Sbjct: 130 DPNAYVGIDPATGIKSFGRNVLSAYWSAFFALVGTHGLHVSVGLLWMVVMFFHLRRSGLD 189

Query: 177 SGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
             N+ RL CLS+FWH LD++W+ VF+ VYL+G +
Sbjct: 190 QNNKTRLTCLSIFWHLLDIVWVGVFTMVYLLGAL 223


>gi|92118913|ref|YP_578642.1| cytochrome o ubiquinol oxidase subunit III [Nitrobacter
           hamburgensis X14]
 gi|91801807|gb|ABE64182.1| cytochrome bo3 quinol oxidase subunit 3 [Nitrobacter hamburgensis
           X14]
          Length = 205

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 111/184 (60%), Gaps = 2/184 (1%)

Query: 27  HDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSL 86
            + TY GFW+ LM D ++FA+ FV +  +  + A GPA   +F +  IF  T++LL SS 
Sbjct: 24  EEKTY-GFWLCLMGDAIVFALLFVIFVAMAHSTADGPAGHTLFRLPRIFAETMLLLASSA 82

Query: 87  SCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFF 146
           +  FA +A A  +   +TV WL VT   G  F+ MEI EF  +   +A P RS FLS+FF
Sbjct: 83  TFGFASVAIAAGQR-RRTVVWLGVTFLLGFGFVAMEISEFYSMAVADAGPWRSGFLSAFF 141

Query: 147 ALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
            LVG HG HV  GL+W+ +L  ++  +GL      RL  L +FWHFL ++W+ +FS VYL
Sbjct: 142 TLVGTHGAHVSIGLVWIVLLGCEVTVRGLTPFAASRLYRLGLFWHFLVIVWVNIFSLVYL 201

Query: 207 MGVV 210
            G++
Sbjct: 202 PGLL 205


>gi|319406524|emb|CBI80166.1| cytochrome o ubiquinol oxidase subunit III [Bartonella sp. 1-1C]
          Length = 223

 Score =  138 bits (347), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 119/198 (60%), Gaps = 21/198 (10%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+Y++SD ++F+  F ++AV   +Y  G A  +  +++ + V T +LLLSS++  FAM
Sbjct: 27  GFWVYILSDLILFSTLFSSFAVFSASYGGGKAGNEFINLNFVLVETAILLLSSITYGFAM 86

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS------------------MEA 134
           +  A K  + K   W+ +T   G+ F+ MEIYEF  L++                  +++
Sbjct: 87  V-YAHKGSLAKLRVWMAITFALGLCFVGMEIYEFYELLNEVFYYDPNAYAGVDPTTGIKS 145

Query: 135 VPQR--SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
             +   SA+ S+FFALVG HGLHV  GL+W+ V+   + + GL   N+ RL CLS+FWH 
Sbjct: 146 FGRNVLSAYWSAFFALVGTHGLHVSVGLLWMVVMFFHLRRSGLDQDNKTRLTCLSIFWHL 205

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD++W+ VF+ VYL+G +
Sbjct: 206 LDIVWVGVFTMVYLLGAL 223


>gi|23098894|ref|NP_692360.1| cytochrome c oxidase subunit III [Oceanobacillus iheyensis HTE831]
 gi|22777121|dbj|BAC13395.1| cytochrome c oxidase subunit III (aa3 type) [Oceanobacillus
           iheyensis HTE831]
          Length = 208

 Score =  137 bits (346), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 117/195 (60%), Gaps = 2/195 (1%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
            +D  ++ ++    +LG WI+L  + ++FA  F TY  L  + A GP+  D++ +  +F+
Sbjct: 14  TQDPSKATMEGKHKFLGLWIFLGGETVLFACLFGTYLALKDSTAGGPSTHDLYGLELVFL 73

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T++LL SSL+  +A+          K   W+ +TA  G+ F+  EIYEFAH I      
Sbjct: 74  MTVLLLTSSLTSVYAIYHMKNNDF-KKMQLWMGITAALGLAFLGFEIYEFAHYIHDYGFT 132

Query: 137 QRS-AFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
            RS AF S+F+ALVG HG HV FGL W+  L+++  K+GL   N  +    +++WHF+D+
Sbjct: 133 FRSSAFGSAFYALVGFHGGHVVFGLSWIITLMVRNAKRGLNLYNAPKYNTFALYWHFIDV 192

Query: 196 IWICVFSFVYLMGVV 210
           +W+ +F+ VYLMG+V
Sbjct: 193 VWVFIFTVVYLMGMV 207


>gi|326402945|ref|YP_004283026.1| cytochrome o ubiquinol oxidase subunit III [Acidiphilium multivorum
           AIU301]
 gi|325049806|dbj|BAJ80144.1| cytochrome o ubiquinol oxidase subunit III [Acidiphilium multivorum
           AIU301]
          Length = 204

 Score =  137 bits (346), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 82/201 (40%), Positives = 112/201 (55%), Gaps = 11/201 (5%)

Query: 16  YVKDKKESCVDHDG----TYLGFWIYLMSDCLMFAVFFVTYAVLGK--NYAAGPAPIDVF 69
           +V+ +  +   HD     TY GFW+Y+MSD L+FA  F +Y VL    N A GP    + 
Sbjct: 9   WVRGEPPA---HDAIGTQTY-GFWLYMMSDALIFAALFASYGVLDHAWNAAGGPTARAIV 64

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
                F  TI+L  + LS S AM A   +R       +LLV A  G  F+ +E+ +   L
Sbjct: 65  HPVEAFWQTILLFGAVLSGSLAM-AGMKRRSRPAAAGFLLVAALLGTGFVALELRDLVTL 123

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
           +     P+RSAFLS FF LV  HGLHV FGL+W+ V+++Q+L  G  +    RL+ + MF
Sbjct: 124 VMAGDTPERSAFLSMFFLLVATHGLHVIFGLLWMGVMIVQVLAFGFTAPVVTRLLNMQMF 183

Query: 190 WHFLDLIWICVFSFVYLMGVV 210
           W F   IW+CVF FVYL G +
Sbjct: 184 WQFQAAIWVCVFVFVYLQGAM 204


>gi|148260101|ref|YP_001234228.1| Heme/copper-type cytochrome/quinol oxidase subunit 3-like protein
           [Acidiphilium cryptum JF-5]
 gi|146401782|gb|ABQ30309.1| cytochrome bo3 quinol oxidase subunit 3 [Acidiphilium cryptum JF-5]
          Length = 204

 Score =  137 bits (345), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 82/201 (40%), Positives = 112/201 (55%), Gaps = 11/201 (5%)

Query: 16  YVKDKKESCVDHDG----TYLGFWIYLMSDCLMFAVFFVTYAVLGK--NYAAGPAPIDVF 69
           +V+ +  +   HD     TY GFW+Y+MSD L+FA  F +Y VL    N A GP    + 
Sbjct: 9   WVRGEPPA---HDAIGTQTY-GFWLYMMSDALIFAALFASYGVLDHAWNAAGGPTARAIV 64

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
                F  TI+L  + LS S AM A   +R       +LLV A  G  F+ +E+ +   L
Sbjct: 65  HPVEAFWQTILLFGAVLSGSLAM-AGMKRRSRPAAAGFLLVAALLGTGFVALELRDLVTL 123

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
           +     P+RSAFLS FF LV  HGLHV FGL+W+ V+++Q+L  G  +    RL+ + MF
Sbjct: 124 VMAGDTPERSAFLSMFFLLVATHGLHVIFGLLWMGVMIVQVLAFGFTAPVVTRLLNMQMF 183

Query: 190 WHFLDLIWICVFSFVYLMGVV 210
           W F   IW+CVF FVYL G +
Sbjct: 184 WQFQAAIWVCVFVFVYLQGAM 204


>gi|15615176|ref|NP_243479.1| cytochrome caa3 oxidase (subunit III) [Bacillus halodurans C-125]
 gi|10175234|dbj|BAB06332.1| cytochrome caa3 oxidase (subunit III) [Bacillus halodurans C-125]
          Length = 206

 Score =  137 bits (345), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 74/192 (38%), Positives = 113/192 (58%), Gaps = 2/192 (1%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTI 79
            + + ++    +LGFW +L  + ++FA FF TY  L    A GP P D+F +  +F+ T+
Sbjct: 15  PERATLEGKNKFLGFWFFLGGETILFATFFGTYLGLRSGTADGPLPQDIFALPLVFIMTM 74

Query: 80  VLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS-MEAVPQR 138
           +LL SSL+   AM A+  K        W+ +T   G+ F+  EIYEF   +   E     
Sbjct: 75  LLLTSSLTSVIAM-AAMKKNKFGAMKLWMWITVLLGLGFLGFEIYEFYEYVHHYELGFST 133

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF SSF++LVGLHG HV FGL W+  L+I+  + G+   N  +    S++WHF+D++W+
Sbjct: 134 SAFASSFYSLVGLHGAHVAFGLSWIITLLIRYNRSGITLTNAPKFYVASLYWHFIDVVWV 193

Query: 199 CVFSFVYLMGVV 210
            +F+ VYLMGV+
Sbjct: 194 FIFTVVYLMGVL 205


>gi|317129344|ref|YP_004095626.1| cytochrome-c oxidase [Bacillus cellulosilyticus DSM 2522]
 gi|315474292|gb|ADU30895.1| Cytochrome-c oxidase [Bacillus cellulosilyticus DSM 2522]
          Length = 205

 Score =  137 bits (345), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 71/192 (36%), Positives = 111/192 (57%), Gaps = 1/192 (0%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            + +++ ++    ++GFW +L  + ++FA  F TY  L      GP P D+F +  +F+ 
Sbjct: 13  PNPEKATLEGRNKFMGFWFFLGGETVLFASLFGTYLGLRGGTMNGPGPSDLFHLDLVFIM 72

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T++LL SSL+  FA++ S  K      ++W+ VT   G+ F+ MEIYEF           
Sbjct: 73  TMILLTSSLTSVFAVI-SMKKGNFKGLLAWMSVTVLLGLAFLGMEIYEFYDYYHKGLGYS 131

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
            SAF SSF+ LVG HG HV FG+ W+  L+I+  K GL   N  +     ++WHF+D++W
Sbjct: 132 TSAFASSFYTLVGTHGAHVAFGIGWITTLIIRYRKSGLTLTNAPKFYTAVLYWHFIDVVW 191

Query: 198 ICVFSFVYLMGV 209
           + +FS VYLMG+
Sbjct: 192 VFIFSVVYLMGI 203


>gi|254503727|ref|ZP_05115878.1| cytochrome o ubiquinol oxidase, subunit III [Labrenzia alexandrii
           DFL-11]
 gi|222439798|gb|EEE46477.1| cytochrome o ubiquinol oxidase, subunit III [Labrenzia alexandrii
           DFL-11]
          Length = 204

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 84/191 (43%), Positives = 115/191 (60%), Gaps = 1/191 (0%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTI 79
           ++E      G   GFW++LM D ++FA+ F TY VL  N AAGP    VFD+S   + T 
Sbjct: 15  EEEEHHSLRGREFGFWLFLMGDAVIFALLFATYVVLSGNSAAGPTSQQVFDLSHTAIETA 74

Query: 80  VLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS 139
           +LL+SSL+   A LA   K      + WLL+T   G+ F+ ME+ EF  +I   A P  S
Sbjct: 75  LLLVSSLTFGVASLA-MDKGHGRAVILWLLITLGLGLGFLAMEVLEFRGMILQGAGPDVS 133

Query: 140 AFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWIC 199
            F S+FF LVG+HG HV  G I + V++ Q++ KGL    + RL  L +FWHFLD++WI 
Sbjct: 134 GFFSAFFTLVGMHGAHVAMGSIGILVMIGQVMTKGLTLPVRSRLNRLGLFWHFLDIVWIG 193

Query: 200 VFSFVYLMGVV 210
           +FS VYL GV+
Sbjct: 194 IFSVVYLPGVM 204


>gi|240849795|ref|YP_002971183.1| cytochrome o ubiquinol oxidase subunit III [Bartonella grahamii
           as4aup]
 gi|240266918|gb|ACS50506.1| cytochrome o ubiquinol oxidase subunit III [Bartonella grahamii
           as4aup]
          Length = 222

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 81/220 (36%), Positives = 120/220 (54%), Gaps = 27/220 (12%)

Query: 17  VKDKKESCVD---HDGTYL---GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFD 70
           V     S VD   HD + +   GFW+Y++SD ++F+  F ++AV   +Y  G A  +  D
Sbjct: 4   VTINNVSAVDEHHHDNSSVMTFGFWVYILSDLILFSTLFSSFAVFSASYGGGKAGNEFID 63

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
           +  + V T  LL SS++  F M+  A K  I     W+ +T  FG  FI ME+YEF  L+
Sbjct: 64  LKFVLVETAFLLFSSVTYGFTMV-QAHKNNISGVRLWMAITFVFGCCFIGMELYEFHELL 122

Query: 131 S------------------MEAVPQR--SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQI 170
                              ++   +   SA+ S+FFALVG HGLHV  GL+W+ V+   +
Sbjct: 123 GEVFYYDPNAYAGIDPATGLQLFGREILSAYWSAFFALVGTHGLHVSVGLLWMVVMFFHL 182

Query: 171 LKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
            + GL   N+ RL CLS+FWH LD++W+ VF+ VYL+G +
Sbjct: 183 RRNGLDQNNKTRLACLSIFWHLLDIVWVGVFTMVYLLGAL 222


>gi|319407992|emb|CBI81646.1| cytochrome o ubiquinol oxidase subunit III [Bartonella
           schoenbuchensis R1]
          Length = 221

 Score =  136 bits (343), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 117/216 (54%), Gaps = 27/216 (12%)

Query: 21  KESCVD---HDGTYL---GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
              C D   HD + +   GFWIY++SD ++FA  F  +AV   +Y  G A  +   ++ +
Sbjct: 7   NNVCADEHHHDNSSVMIFGFWIYILSDLIVFATLFSGFAVFSASYGGGKAGSEFIHLNFV 66

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS--- 131
            V T +LLLSS++  F M+ +    L    + W+ +T   G  FI MEIYEF  L+S   
Sbjct: 67  LVETAILLLSSITYGFVMVQTHKGNLAGVRL-WMAITFVLGSCFIGMEIYEFRELLSEVY 125

Query: 132 -----------------MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG 174
                            +      SA+ S+FFALVG HGLHV  GL+W+ V+   + + G
Sbjct: 126 YYDAGAYAGVDLTTGTQLFGREVLSAYWSAFFALVGTHGLHVSVGLLWMIVMFFHLCRSG 185

Query: 175 LISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           L   N+ RL CLS+FWH LD++W+ VF+ VYL+G +
Sbjct: 186 LDQNNKTRLTCLSIFWHLLDIVWVGVFTMVYLLGAL 221


>gi|49474942|ref|YP_032983.1| cytochrome o ubiquinol oxidase subunit III [Bartonella henselae
           str. Houston-1]
 gi|49237747|emb|CAF26939.1| Cytochrome o ubiquinol oxidase subunit III [Bartonella henselae
           str. Houston-1]
          Length = 221

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 112/198 (56%), Gaps = 21/198 (10%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+Y++SD ++F+  F ++AV   +Y  G A  +  D++ + V T +LLLSS++  F M
Sbjct: 25  GFWVYILSDLILFSTLFSSFAVFSASYGGGKAGNEFIDLNFVLVETAILLLSSITYGFVM 84

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI--------------------SM 132
           +  A K  I     W+ +T   G+ FI MEIYEF  L+                     +
Sbjct: 85  I-QAHKGNIGGVRLWMTITFVLGLFFIGMEIYEFHELLKEVFYYDPGAYAGIDPATGLQL 143

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                 SA+ S+FFALVG HGLHV  GL+W+ V+   I   GL   N+ RL CLS+FWH 
Sbjct: 144 FGKEVLSAYWSAFFALVGTHGLHVSAGLLWMIVMFFHIHHCGLDQDNKTRLACLSIFWHL 203

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD++W+ VF+ VYL+G +
Sbjct: 204 LDIVWVGVFTMVYLLGAL 221


>gi|229083935|ref|ZP_04216238.1| Quinol oxidase subunit 3 [Bacillus cereus Rock3-44]
 gi|228699370|gb|EEL52052.1| Quinol oxidase subunit 3 [Bacillus cereus Rock3-44]
          Length = 200

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 108/179 (60%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F +Y VL    A GP P D+F++  + + T++LL SS +C   
Sbjct: 22  LGFWIFLGAEIMLFATLFASYLVLAGRTADGPTPADLFEVKTLLIQTLLLLTSSFTCGI- 80

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           ++    K      + W L T   G  F+  EI EF   +   A  Q SAFLS FF L+G 
Sbjct: 81  VIHEMRKNNQKAMLGWFLFTLLLGAGFLFFEIEEFIMYVGEGATLQTSAFLSGFFVLLGT 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+IW   ++IQILK+GL     R++  +S++WHFLDL+WI +++ VYL G+V
Sbjct: 141 HGAHVTGGIIWATCVIIQILKRGLTPVTARKVFIISLYWHFLDLVWIFIYTLVYLNGMV 199


>gi|308173456|ref|YP_003920161.1| cytochrome caa3 oxidase subunit III [Bacillus amyloliquefaciens DSM
           7]
 gi|307606320|emb|CBI42691.1| cytochrome caa3 oxidase (subunit III) [Bacillus amyloliquefaciens
           DSM 7]
 gi|328553615|gb|AEB24107.1| cytochrome c oxidase, subunit III [Bacillus amyloliquefaciens
           TA208]
 gi|328911591|gb|AEB63187.1| cytochrome caa3 oxidase (subunit III) [Bacillus amyloliquefaciens
           LL3]
          Length = 207

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 118/194 (60%), Gaps = 4/194 (2%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
             +++ ++    +LGFW++L  + ++FA  F T+  L ++ A GP+  D+F++  +F++T
Sbjct: 15  SPEKATLEGKNKFLGFWLFLGGETVLFASLFATFLALRESKAGGPSTADMFELPIVFIAT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVS-WLLVTAFFGMIFIIMEIYEFAHLISMEAVP- 136
           ++LL SSL+  +AM     K    K +  WLL+T   G  F+ +EIYEF H         
Sbjct: 75  MLLLTSSLTSVYAMYH--MKNFSFKKMQVWLLITVLLGAGFLGVEIYEFKHYTHEFGFTI 132

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
             SA  S+F+ LVG HG HV FGL+W+  L+I+  K+GL   N  +    S++WHF+D++
Sbjct: 133 TSSALGSAFYTLVGTHGAHVAFGLLWISALMIRNAKRGLSLYNAPKYYVASLYWHFIDVV 192

Query: 197 WICVFSFVYLMGVV 210
           W+ +F+ VYLMG+V
Sbjct: 193 WVFIFTVVYLMGMV 206


>gi|229016030|ref|ZP_04172986.1| Quinol oxidase subunit 3 [Bacillus cereus AH1273]
 gi|229022249|ref|ZP_04178794.1| Quinol oxidase subunit 3 [Bacillus cereus AH1272]
 gi|228739052|gb|EEL89503.1| Quinol oxidase subunit 3 [Bacillus cereus AH1272]
 gi|228745263|gb|EEL95309.1| Quinol oxidase subunit 3 [Bacillus cereus AH1273]
          Length = 200

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 111/179 (62%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C  A
Sbjct: 22  LGFWIFLGAEIMLFATLFASYLVLAGRTADGPTPAQLFEVKTLLIQTLLLLTSSFTCGIA 81

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
            +    K+     ++W ++T   G  F+  EI EF   +   A  Q SAFLS+FF L+G 
Sbjct: 82  -IHEMRKQNQKGMLAWFILTLLLGAGFLFFEIEEFILYVGEGATIQTSAFLSAFFVLLGT 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+IW   ++IQILK+GL     R++  +S++WHFLDL+W+ +++ VYL G+V
Sbjct: 141 HGAHVTGGIIWATCVIIQILKRGLTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMV 199


>gi|157692164|ref|YP_001486626.1| cytochrome-c oxidase subunit III [Bacillus pumilus SAFR-032]
 gi|194014225|ref|ZP_03052842.1| cytochrome c oxidase subunit 3 (cytochrome c oxidasepolypeptide
           III) (cytochrome aa3 subunit 3) ( subunit 3)(Oxidase
           aa(3) subunit 3) [Bacillus pumilus ATCC 7061]
 gi|157680922|gb|ABV62066.1| cytochrome-c oxidase subunit III [Bacillus pumilus SAFR-032]
 gi|194013251|gb|EDW22816.1| cytochrome c oxidase subunit 3 (cytochrome c oxidasepolypeptide
           III) (cytochrome aa3 subunit 3) ( subunit 3)(Oxidase
           aa(3) subunit 3) [Bacillus pumilus ATCC 7061]
          Length = 206

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 118/194 (60%), Gaps = 4/194 (2%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
             +++ ++    ++GFW++L  + ++FA  F TY  L  + A G    D+FD++ +F++T
Sbjct: 14  SPEKATLEGKNKFVGFWLFLGGETVLFASLFATYLALKNSNAGGAKTTDMFDLTLVFIAT 73

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVS-WLLVTAFFGMIFIIMEIYEFAHLI-SMEAVP 136
           ++LL SSL+  +AM     K    K +  WL VT   G  F+ +EIYEF H + + +   
Sbjct: 74  MLLLTSSLTSVYAMYH--MKNFAFKKMQLWLGVTVLLGASFLGVEIYEFYHYVHAYDFTI 131

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
             SA  SSF+ LVG HG HV FGL W+  L+I+ +++GL   N  +    S++WHF+D++
Sbjct: 132 TSSALGSSFYTLVGTHGAHVAFGLCWITALMIRNMRRGLDLYNAPKYYVASLYWHFIDVV 191

Query: 197 WICVFSFVYLMGVV 210
           W+ +F+ VYLMG+V
Sbjct: 192 WVFIFTVVYLMGMV 205


>gi|85717118|ref|ZP_01048078.1| cytochrome o ubiquinol oxidase subunit III [Nitrobacter sp.
           Nb-311A]
 gi|85696078|gb|EAQ33976.1| cytochrome o ubiquinol oxidase subunit III [Nitrobacter sp.
           Nb-311A]
          Length = 205

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 73/174 (41%), Positives = 108/174 (62%), Gaps = 1/174 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+ L+SD ++FA+ F  + V+ +N A   A   +F +  IF +T++LL SS +   A 
Sbjct: 29  GFWLCLISDAIIFALLFAIFVVMAQNTADASAGRTLFQLPRIFAATVLLLASSATFGLAS 88

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A A ++   + + WL +T  FG+ F+  EI EF  +   +A P R+ FLS+FFALVG H
Sbjct: 89  VAIAARQR-GRVIVWLGMTIMFGLGFVATEITEFHGMAVADAAPWRNGFLSAFFALVGTH 147

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
           G HV FGL+W+ +L  +I  +G       RL  L +FWHFL ++WI +FSFVYL
Sbjct: 148 GAHVSFGLVWIVLLGCEIALRGPTPIAASRLYRLGLFWHFLIIVWINIFSFVYL 201


>gi|327441188|dbj|BAK17553.1| heme/copper-type cytochrome/quinol oxidase, subunit 3 [Solibacillus
           silvestris StLB046]
          Length = 208

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 74/196 (37%), Positives = 119/196 (60%), Gaps = 5/196 (2%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGP--APIDVFDISGIF 75
           K  +++ ++     +G WI+L SD ++FA  F TY  L  +  AG   A  D++++   F
Sbjct: 14  KHPEQATMEGKNKLVGLWIFLASDTVLFASVFATYIALKDSGPAGMEFAAKDLYELPLAF 73

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTV-SWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
           V T++LL SSL+  +AM     +   +  V +W+ +T   G+ F+ +EIYEF H + +  
Sbjct: 74  VMTMLLLTSSLTSVYAMYH--MRNFNYSGVRTWMGITVLLGLGFLALEIYEFQHYVHIGF 131

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
              +SAF S+FF LVG+HGLHV  GL+W+  L+I+   +GL   N  +    S++WHF+D
Sbjct: 132 GYTQSAFSSAFFTLVGMHGLHVIIGLVWITGLIIRNSSRGLNLYNAPKFFAASLYWHFID 191

Query: 195 LIWICVFSFVYLMGVV 210
           ++W+ +F+ VYLMGVV
Sbjct: 192 VVWVFIFTVVYLMGVV 207


>gi|163938625|ref|YP_001643509.1| cytochrome aa3 quinol oxidase subunit III [Bacillus
           weihenstephanensis KBAB4]
 gi|229131648|ref|ZP_04260529.1| Quinol oxidase subunit 3 [Bacillus cereus BDRD-ST196]
 gi|163860822|gb|ABY41881.1| Cytochrome aa3 quinol oxidase subunit III [Bacillus
           weihenstephanensis KBAB4]
 gi|228651796|gb|EEL07752.1| Quinol oxidase subunit 3 [Bacillus cereus BDRD-ST196]
          Length = 200

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 110/179 (61%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C  A
Sbjct: 22  LGFWIFLGAEIMLFATLFASYLVLAGRTADGPTPAQLFEVKTLLIQTLLLLTSSFTCGIA 81

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
            +    K      ++W ++T   G  F+  EI EF   +   A  Q SAFLS+FF L+G 
Sbjct: 82  -IHEMRKHNQKGMLAWFILTLLLGAGFLFFEIEEFILYVGEGATIQTSAFLSAFFVLLGT 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+IW   ++IQILK+GL     R++  +S++WHFLDL+W+ +++ VYL G+V
Sbjct: 141 HGAHVTGGIIWATCVIIQILKRGLTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMV 199


>gi|154685910|ref|YP_001421071.1| CtaE [Bacillus amyloliquefaciens FZB42]
 gi|154351761|gb|ABS73840.1| CtaE [Bacillus amyloliquefaciens FZB42]
          Length = 207

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 118/194 (60%), Gaps = 4/194 (2%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
             +++ ++    +LGFW++L  + ++FA  F T+  L ++ A GP+  ++F++  +F++T
Sbjct: 15  SPEKATLEGKNKFLGFWLFLGGETVLFASLFATFLALRESKAGGPSTAEMFELPIVFIAT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVS-WLLVTAFFGMIFIIMEIYEFAHLISMEAVP- 136
           ++LL SSL+  +AM     K    K +  WLLVT   G  F+ +EIYEF H         
Sbjct: 75  MLLLTSSLTSVYAMYH--MKNFSFKKMQVWLLVTVLLGAGFLGVEIYEFMHYTHEFGFTI 132

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
             SA  S+F+ LVG HG HV FGL+W+  L+I+  K+GL   N  +    S++WHF+D++
Sbjct: 133 TSSALGSAFYTLVGTHGAHVAFGLLWISALMIRNAKRGLSLYNAPKYYVASLYWHFIDVV 192

Query: 197 WICVFSFVYLMGVV 210
           W+ +F+ VYLMG+V
Sbjct: 193 WVFIFTVVYLMGMV 206


>gi|52082324|ref|YP_081115.1| cytochrome aa3 quinol oxidase subunit III [Bacillus licheniformis
           ATCC 14580]
 gi|52787715|ref|YP_093544.1| QoxC [Bacillus licheniformis ATCC 14580]
 gi|319648198|ref|ZP_08002415.1| QoxC protein [Bacillus sp. BT1B_CT2]
 gi|52005535|gb|AAU25477.1| cytochrome aa3 quinol oxidase (subunit III) [Bacillus licheniformis
           ATCC 14580]
 gi|52350217|gb|AAU42851.1| QoxC [Bacillus licheniformis ATCC 14580]
 gi|317389833|gb|EFV70643.1| QoxC protein [Bacillus sp. BT1B_CT2]
          Length = 204

 Score =  134 bits (338), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 68/179 (37%), Positives = 107/179 (59%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++  +F+  F TYAVL    A G  P ++FD   + + T +LL SS +C  A
Sbjct: 25  LGFWIFLGAEIALFSTLFATYAVLHNRTAGGVLPAELFDAKLVLIMTFLLLTSSFTCGIA 84

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +     +  +   + W+++T   G  F+  E+YEF H +   A    SA+ S+FF L+G 
Sbjct: 85  V-HEMRRGSLKGVMIWMIITLLLGAGFVSYELYEFNHYVHEGATLSTSAYWSAFFVLLGT 143

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HGLHV  G+ W+  +++Q  K+GL      +L   S++WHFLD++WI +F+ VYL+G+V
Sbjct: 144 HGLHVSIGIFWIIGILLQTKKRGLTPQTSAKLFISSLYWHFLDVVWIFIFTGVYLIGLV 202


>gi|229056468|ref|ZP_04195880.1| Quinol oxidase subunit 3 [Bacillus cereus AH603]
 gi|229165641|ref|ZP_04293413.1| Quinol oxidase subunit 3 [Bacillus cereus AH621]
 gi|228617815|gb|EEK74868.1| Quinol oxidase subunit 3 [Bacillus cereus AH621]
 gi|228720865|gb|EEL72415.1| Quinol oxidase subunit 3 [Bacillus cereus AH603]
          Length = 200

 Score =  134 bits (338), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 73/179 (40%), Positives = 110/179 (61%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C  A
Sbjct: 22  LGFWIFLGAEIMLFATLFASYLVLAGRTADGPTPAQLFELKTLLIQTLLLLTSSFTCGIA 81

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
            +    K      ++W ++T   G  F+  EI EF   I   A  Q SAFLS+FF L+G 
Sbjct: 82  -IHEMRKHNQKGMLAWFILTLLLGAGFLFFEIEEFIMYIGEGATIQTSAFLSAFFVLLGT 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+IW   ++IQILK+GL     R++  +S++WHFLDL+W+ +++ VYL G+V
Sbjct: 141 HGAHVTGGIIWATCVIIQILKRGLTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMV 199


>gi|253574578|ref|ZP_04851919.1| cytochrome c oxidase subunit III [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251846283|gb|EES74290.1| cytochrome c oxidase subunit III [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 208

 Score =  134 bits (337), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 116/193 (60%), Gaps = 2/193 (1%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++     LGFW++L  + ++F   F T+  L    A GP+  ++F++     +T
Sbjct: 16  EPEKATLEGRNKILGFWLFLGGEAVLFGTLFATFLTLRNQIADGPSASELFNLGITAAAT 75

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP-Q 137
            +LL+SSL+  FA+ A   +    K   WL VT   G+ F+++EIYEFA  +  E     
Sbjct: 76  FILLVSSLTSVFAIQA-MHRGDKGKLAGWLAVTVLLGLAFLVLEIYEFAEYVLHEDYGMT 134

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
            SAF S+F+ LVG HG HV FG++W+ +L+ Q+ KKGL      ++   +++WHF+D++W
Sbjct: 135 TSAFSSAFYTLVGFHGAHVLFGILWISLLIGQLFKKGLTVVTAPKIYVSAIYWHFIDVVW 194

Query: 198 ICVFSFVYLMGVV 210
           + +F+ VYL+G V
Sbjct: 195 VFIFTVVYLLGKV 207


>gi|207721796|ref|YP_002252234.1| transmembrane cytochrome o ubiquinol oxidase (subunit III) protein
           [Ralstonia solanacearum MolK2]
 gi|206586960|emb|CAQ17544.1| transmembrane cytochrome o ubiquinol oxidase (subunit III) protein
           [Ralstonia solanacearum MolK2]
          Length = 284

 Score =  134 bits (337), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 72/151 (47%), Positives = 97/151 (64%), Gaps = 1/151 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSD ++FA  F T+ VL    A GP   ++FD+S + + T +LL+SS++    M
Sbjct: 35  GFWVYLMSDLILFASLFATFCVLRSATAGGPNGKELFDLSYVLIETGILLVSSITYGMVM 94

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +   + R   + + WL +T   G  F+ MEI EF HLI+  A P RSAFLSSFF LVG H
Sbjct: 95  IGLQSGR-KDQVMLWLGITFLLGAAFVGMEINEFHHLIAEGAGPSRSAFLSSFFTLVGTH 153

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRL 183
           GLHV  GL+W+ VL+ QI +KGL + N  RL
Sbjct: 154 GLHVASGLLWIAVLMWQISRKGLTATNSTRL 184


>gi|229162876|ref|ZP_04290833.1| Cytochrome c oxidase subunit 3 [Bacillus cereus R309803]
 gi|228620758|gb|EEK77627.1| Cytochrome c oxidase subunit 3 [Bacillus cereus R309803]
          Length = 207

 Score =  134 bits (336), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 114/193 (59%), Gaps = 2/193 (1%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++    ++GFW++L  + ++FA  F TY  L  +   G    ++F +  +F+ T
Sbjct: 15  EPEKATLEGKNKFVGFWLFLGGETVLFASLFGTYLALKNSTNGGATSQEMFQMPLVFIMT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI-SMEAVPQ 137
           ++LL SSL+  +AM          K   WLL+T   G+ F+  EIYEF H     +   +
Sbjct: 75  MLLLTSSLTSVYAMYHMKNFNF-KKMQLWLLITVLLGLGFLGFEIYEFYHYTHEFKHTMR 133

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
            SAF S+F+ALVG HGLHV FGL W+  L+ +  K+GL   N  +    S++WHF+D++W
Sbjct: 134 SSAFGSAFYALVGTHGLHVLFGLCWILTLIFRNAKRGLNLYNAPKFYVASIYWHFIDVVW 193

Query: 198 ICVFSFVYLMGVV 210
           + +F+ VYLMG+V
Sbjct: 194 VFIFTVVYLMGMV 206


>gi|312112705|ref|YP_003991021.1| cytochrome aa3 quinol oxidase subunit III [Geobacillus sp. Y4.1MC1]
 gi|311217806|gb|ADP76410.1| cytochrome aa3 quinol oxidase, subunit III [Geobacillus sp.
           Y4.1MC1]
          Length = 204

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 78/179 (43%), Positives = 114/179 (63%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++  +FA  F TY VL +   +GP   ++F++  + + T++LL SS +C  A
Sbjct: 26  LGFWIFLGAEVALFATLFATYLVLFQRTGSGPTAKELFEVKDVLIETLLLLTSSFTCGLA 85

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +      RL    ++WLLVT   G  FI  EI EF H +   A  Q SAFLSSFF LVG 
Sbjct: 86  VFEMRRNRL-SGLLTWLLVTLLLGAGFITFEIREFIHYVHEGATMQTSAFLSSFFVLVGT 144

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+ W+ +++IQIL++GL     R++  +S++WHFLD++WI +F+ VYL G+V
Sbjct: 145 HGAHVSLGIGWMILIIIQILQRGLTPRTARKVFIVSLYWHFLDVVWIFIFTLVYLTGMV 203


>gi|229159780|ref|ZP_04287788.1| Quinol oxidase subunit 3 [Bacillus cereus R309803]
 gi|228623717|gb|EEK80535.1| Quinol oxidase subunit 3 [Bacillus cereus R309803]
          Length = 200

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 110/179 (61%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C   
Sbjct: 22  LGFWIFLGAEIMLFATLFASYLVLAGRTADGPTPAQLFELKTLLIQTLLLLTSSFTCGI- 80

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           ++    K      + W ++T   G  F+  EI EF   +S  A  Q SAFLS+FF L+G 
Sbjct: 81  VIHEMRKHNQKAMLGWFILTLLLGAGFLFFEIEEFILYVSEGATLQTSAFLSAFFVLLGT 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+IW   ++IQILK+GL     R++  +S++WHFLDL+W+ +++ VYL G+V
Sbjct: 141 HGAHVTGGIIWAICVIIQILKRGLTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMV 199


>gi|261404604|ref|YP_003240845.1| cytochrome-c oxidase [Paenibacillus sp. Y412MC10]
 gi|329923617|ref|ZP_08279061.1| cytochrome C oxidase, subunit 3 [Paenibacillus sp. HGF5]
 gi|261281067|gb|ACX63038.1| Cytochrome-c oxidase [Paenibacillus sp. Y412MC10]
 gi|328941170|gb|EGG37469.1| cytochrome C oxidase, subunit 3 [Paenibacillus sp. HGF5]
          Length = 206

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 116/193 (60%), Gaps = 2/193 (1%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++     LGFW++L  + ++F   F T+  L      GP   ++F +     +T
Sbjct: 14  EPEKATLEGRNKVLGFWLFLGGEAVLFGTLFATFLALRGQNNEGPTAAELFSLPITAAAT 73

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           ++LL+SSL+  FA+ A   +  I K   WL+VT   G+ F+ +EIYEF   +  E+   +
Sbjct: 74  LILLVSSLTSVFAIQA-LHRHNIEKLKLWLIVTVVLGLGFLGLEIYEFYEYVVHESFNMK 132

Query: 139 -SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
            SAF S+F+ LVG HG HV FG++W+ +L+ Q+ +KGL      ++   +M+WHF+D++W
Sbjct: 133 TSAFSSAFYTLVGFHGAHVAFGVVWISLLIAQLYRKGLTVVTAPKVYVSAMYWHFIDVVW 192

Query: 198 ICVFSFVYLMGVV 210
           + +FS VYL+G V
Sbjct: 193 VFIFSVVYLLGKV 205


>gi|304405377|ref|ZP_07387036.1| Cytochrome-c oxidase [Paenibacillus curdlanolyticus YK9]
 gi|304345416|gb|EFM11251.1| Cytochrome-c oxidase [Paenibacillus curdlanolyticus YK9]
          Length = 206

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 115/193 (59%), Gaps = 2/193 (1%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVFDISGIFVS 77
           + +++ ++     LGFW++L  + ++F   F  +  L      G P   ++F++S + ++
Sbjct: 14  EPEKATLEGRNKVLGFWLFLGGETVLFGTLFSAFLALRDKVGEGNPTANELFNLSTVAIA 73

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T +LL SSL+  FA+ A  + +  +  + WL +T  FG+ F+ +EIYEF   +       
Sbjct: 74  TFILLTSSLTSVFAIQAMHSGKK-NAMLGWLAITVLFGLGFLGLEIYEFYEYVHEGHGFT 132

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
            SAF SSF+ LVG HG HV FG+IW+ +L+ Q++KKGL      +L    M+WHF+D++W
Sbjct: 133 TSAFSSSFYTLVGFHGAHVAFGVIWISLLIGQVMKKGLNVVTAPKLYVAGMYWHFIDVVW 192

Query: 198 ICVFSFVYLMGVV 210
           + +F+ VYLMG V
Sbjct: 193 VFIFTVVYLMGKV 205


>gi|315645044|ref|ZP_07898170.1| cytochrome c oxidase, subunit III [Paenibacillus vortex V453]
 gi|315279465|gb|EFU42770.1| cytochrome c oxidase, subunit III [Paenibacillus vortex V453]
          Length = 206

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 116/193 (60%), Gaps = 2/193 (1%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++     LGFW++L  + ++F   F T+  L      GP   ++F +     +T
Sbjct: 14  EPEKATLEGRNKVLGFWLFLGGEAVLFGTLFATFLALRGQNNEGPTASELFSLPITAAAT 73

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           ++LL+SSL+  FA+ A   +  I K   WL+VT   G+ F+ +EIYEF   I  E+   +
Sbjct: 74  LILLVSSLTSVFAIQA-LHRHNIEKLKLWLIVTVALGLGFLGLEIYEFYEYIVHESFNMK 132

Query: 139 -SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
            SAF S+F+ LVG HG HV FG++W+ +L+ Q+ +KGL      ++   +M+WHF+D++W
Sbjct: 133 TSAFSSAFYTLVGFHGAHVAFGVVWISLLIAQLYRKGLTVVTAPKVYVSAMYWHFIDVVW 192

Query: 198 ICVFSFVYLMGVV 210
           + +FS VYL+G V
Sbjct: 193 VFIFSVVYLLGKV 205


>gi|295399679|ref|ZP_06809660.1| Cytochrome-c oxidase [Geobacillus thermoglucosidasius C56-YS93]
 gi|312111802|ref|YP_003990118.1| cytochrome-c oxidase [Geobacillus sp. Y4.1MC1]
 gi|294978082|gb|EFG53679.1| Cytochrome-c oxidase [Geobacillus thermoglucosidasius C56-YS93]
 gi|311216903|gb|ADP75507.1| Cytochrome-c oxidase [Geobacillus sp. Y4.1MC1]
          Length = 206

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 113/193 (58%), Gaps = 3/193 (1%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + + + ++    +LGFW +L  + ++FA  F T+  L    A GP   ++F +  +FVST
Sbjct: 15  EPERATLEGKNKFLGFWFFLGGETVLFASLFATFIALRDKTAGGPTSEELFQMPIVFVST 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVS-WLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           ++LL SSL+  +A+     K    K +  W  +T   G+ F+ +EI+EF   +       
Sbjct: 75  MILLTSSLTSVYAI--HHMKNFDFKKMQLWFGITVLLGLAFLGLEIFEFYEYVHEGFKYS 132

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
            SAF S+F+ LVGLHG HV FGL W+  L+I+  K+GL   N  +    S++WHF+D++W
Sbjct: 133 TSAFSSAFYTLVGLHGSHVAFGLSWILTLMIRNAKRGLNLYNAPKFYVASLYWHFIDVVW 192

Query: 198 ICVFSFVYLMGVV 210
           + +F+ VYLMG+V
Sbjct: 193 VFIFTVVYLMGMV 205


>gi|288553207|ref|YP_003425142.1| cytochrome caa3 subunit III [Bacillus pseudofirmus OF4]
 gi|461797|sp|Q04442|COX3_BACPE RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome aa3 subunit 3; AltName: Full=Cytochrome
           c oxidase polypeptide III
 gi|322150|pir||E45335 cytochrome-c oxidase (EC 1.9.3.1) chain III - Bacillus firmus
 gi|142788|gb|AAA22366.1| cytochrome oxidase subunit III [Bacillus firmus]
 gi|288544367|gb|ADC48250.1| cytochrome caa3 subunit III [Bacillus pseudofirmus OF4]
          Length = 206

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 112/191 (58%), Gaps = 2/191 (1%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTI 79
            + + ++    +LGFW +L  + ++FA FF T+  L    A GP   D+  +  +F+ T+
Sbjct: 15  PERATLEGKNKFLGFWFFLGGETILFATFFGTFLGLRGGTADGPTSADLVALDLVFIMTM 74

Query: 80  VLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAH-LISMEAVPQR 138
           +LL SSL+   AM A   K      + W+ +T   G+ F+  EIYEF H ++  +     
Sbjct: 75  LLLTSSLTSVLAMFA-MKKNNFKAMMIWMWITVVLGLAFLGFEIYEFHHYVVDYQFGFST 133

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF S+F++LVGLHG HV FGL W+ VL+I+  K G+   N  +     ++WHF+D++W+
Sbjct: 134 SAFASAFYSLVGLHGAHVAFGLSWIIVLLIRYRKSGITLTNAPKFYVAGLYWHFIDVVWV 193

Query: 199 CVFSFVYLMGV 209
            +F+ VYLMGV
Sbjct: 194 FIFTVVYLMGV 204


>gi|218895754|ref|YP_002444165.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus G9842]
 gi|228963801|ref|ZP_04124941.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|218540782|gb|ACK93176.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus G9842]
 gi|228795872|gb|EEM43340.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar sotto str.
           T04001]
          Length = 200

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 109/179 (60%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C   
Sbjct: 22  LGFWIFLGAEIMLFATLFASYLVLAGRTADGPTPAQLFELKTLLIQTLLLLTSSFTCGI- 80

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           ++    K      + W ++T   G  F+  EI EF   I   A  Q SAFLS+FF L+G 
Sbjct: 81  VIHEMRKHNQKAMLGWFVLTLLLGAGFLFFEIEEFIMYIGEGATIQTSAFLSAFFVLLGT 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+IW   ++IQILK+GL     R++  +S++WHFLDL+W+ +++ VYL G+V
Sbjct: 141 HGAHVTGGIIWAICVIIQILKRGLTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMV 199


>gi|228913389|ref|ZP_04077022.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|228846298|gb|EEM91317.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
          Length = 200

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 108/179 (60%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C   
Sbjct: 22  LGFWIFLGAEIMLFATLFASYLVLAGRTADGPTPAQLFELKTLLIQTLLLLTSSFTCGI- 80

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           ++    K      + W ++T   G  F+  EI EF   I   A  Q SAFLS FF L+G 
Sbjct: 81  VIHEMRKHNQKAMLGWFILTLLLGAGFLFFEIEEFIMYIGEGATIQTSAFLSGFFVLLGT 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+IW   ++IQILK+GL     R++  +S++WHFLDL+W+ +++ VYL G+V
Sbjct: 141 HGAHVTGGIIWAICVIIQILKRGLTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMV 199


>gi|461800|sp|Q03439|COX3_BACP3 RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome aa3 subunit 3; AltName: Full=Cytochrome
           c oxidase polypeptide III; AltName: Full=Oxidase aa(3)
           subunit 3
 gi|77450|pir||JX0142 cytochrome-c oxidase (EC 1.9.3.1) chain III - thermophilic
           bacterium PS-3
 gi|217151|dbj|BAA03047.1| cytochtome c oxidase subunit 3 [Bacillus sp. PS3]
          Length = 207

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 114/197 (57%), Gaps = 3/197 (1%)

Query: 15  FYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
           F    ++ + ++    +LGFW++L  + ++FA  F TY  L      GP+  ++F +  +
Sbjct: 12  FPAAPERNATLEGKNKFLGFWLFLGGETVLFASLFATYLALKDKTNGGPSAEELFQMPVV 71

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVS-WLLVTAFFGMIFIIMEIYEFAHLISME 133
           F++T++LL SSL+  +A+     K    K +  W  +T   G  F+ +EIYEF   +   
Sbjct: 72  FMATMLLLTSSLTSVYAIYH--MKNFDFKKMQLWFGITVLLGAGFLGLEIYEFNEYVHEG 129

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
                SAF S+F+ LVG HG HV FGL+W+  L+I+  K+GL   N  +    S++WHF+
Sbjct: 130 HKFTTSAFASAFYTLVGTHGSHVAFGLLWILTLMIRNAKRGLNLYNAPKFYVASLYWHFI 189

Query: 194 DLIWICVFSFVYLMGVV 210
           D++W+ +F+ VYLMG+V
Sbjct: 190 DVVWVFIFTVVYLMGMV 206


>gi|167461105|ref|ZP_02326194.1| cytochrome caa3 oxidase subunit III CoxC [Paenibacillus larvae
           subsp. larvae BRL-230010]
          Length = 318

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 67/192 (34%), Positives = 114/192 (59%), Gaps = 1/192 (0%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++     LGFW++L  + ++F   F TY  L  +   G    ++F +  I ++T
Sbjct: 127 EPEKATLEGKNKVLGFWLFLGGETVLFGCLFATYLALRNSVGDGKTSDELFQLPMIALAT 186

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
            +LL SSL+  FA++A    RL    + WL ++   G+ F+ +EIYEF   +        
Sbjct: 187 FLLLTSSLTSVFAVMALHRHRL-QSMLRWLAISVVLGLAFLGLEIYEFVEYVHEGHGFTT 245

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF +SF++LVG HG HV FG++W+ +L+IQ  KKGL +    +    +++WHF+D++W+
Sbjct: 246 SAFSTSFYSLVGFHGAHVLFGILWISLLIIQGSKKGLTTVTAPKFYIAALYWHFIDVVWV 305

Query: 199 CVFSFVYLMGVV 210
            +F+ VYLMG V
Sbjct: 306 FIFTVVYLMGKV 317


>gi|228906454|ref|ZP_04070335.1| Quinol oxidase subunit 3 [Bacillus thuringiensis IBL 200]
 gi|228975947|ref|ZP_04136468.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228977448|ref|ZP_04137842.1| Quinol oxidase subunit 3 [Bacillus thuringiensis Bt407]
 gi|229028500|ref|ZP_04184620.1| Quinol oxidase subunit 3 [Bacillus cereus AH1271]
 gi|229095350|ref|ZP_04226342.1| Quinol oxidase subunit 3 [Bacillus cereus Rock3-29]
 gi|229114300|ref|ZP_04243720.1| Quinol oxidase subunit 3 [Bacillus cereus Rock1-3]
 gi|229171484|ref|ZP_04299068.1| Quinol oxidase subunit 3 [Bacillus cereus MM3]
 gi|228612022|gb|EEK69260.1| Quinol oxidase subunit 3 [Bacillus cereus MM3]
 gi|228669138|gb|EEL24560.1| Quinol oxidase subunit 3 [Bacillus cereus Rock1-3]
 gi|228688209|gb|EEL42095.1| Quinol oxidase subunit 3 [Bacillus cereus Rock3-29]
 gi|228732813|gb|EEL83675.1| Quinol oxidase subunit 3 [Bacillus cereus AH1271]
 gi|228782272|gb|EEM30456.1| Quinol oxidase subunit 3 [Bacillus thuringiensis Bt407]
 gi|228783783|gb|EEM31841.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228853181|gb|EEM97957.1| Quinol oxidase subunit 3 [Bacillus thuringiensis IBL 200]
 gi|326938473|gb|AEA14369.1| cytochrome aa3 quinol oxidase polypeptide III [Bacillus
           thuringiensis serovar chinensis CT-43]
          Length = 200

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 109/179 (60%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C   
Sbjct: 22  LGFWIFLGAEIMLFATLFASYLVLAGRTADGPTPAQLFELKTLLIQTLLLLTSSFTCGI- 80

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           ++    K      + W ++T   G  F+  EI EF   I   A  Q SAFLS+FF L+G 
Sbjct: 81  VIHEMRKHNQKAMLGWFILTLLLGAGFLFFEIEEFIMYIGEGATIQTSAFLSAFFVLLGT 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+IW   ++IQILK+GL     R++  +S++WHFLDL+W+ +++ VYL G+V
Sbjct: 141 HGAHVTGGIIWATCVIIQILKRGLTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMV 199


>gi|30018878|ref|NP_830509.1| cytochrome aa3 quinol oxidase polypeptide III [Bacillus cereus ATCC
           14579]
 gi|30260851|ref|NP_843228.1| quinol oxidase, subunit III [Bacillus anthracis str. Ames]
 gi|42779848|ref|NP_977095.1| quinol oxidase, subunit III [Bacillus cereus ATCC 10987]
 gi|47525982|ref|YP_017331.1| quinol oxidase subunit III [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49183692|ref|YP_026944.1| quinol oxidase subunit III [Bacillus anthracis str. Sterne]
 gi|49480265|ref|YP_034957.1| quinol oxidase subunit III (cytochrome c oxidase subunit III)
           [Bacillus thuringiensis serovar konkukian str. 97-27]
 gi|52144610|ref|YP_082218.1| quinol oxidase, subunit III (cytochrome c oxidase, subunit III)
           [Bacillus cereus E33L]
 gi|65318129|ref|ZP_00391088.1| COG1845: Heme/copper-type cytochrome/quinol oxidase, subunit 3
           [Bacillus anthracis str. A2012]
 gi|118476379|ref|YP_893530.1| quinol oxidase, subunit III (cytochrome c oxidase, subunit III)
           [Bacillus thuringiensis str. Al Hakam]
 gi|165872914|ref|ZP_02217538.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0488]
 gi|167635136|ref|ZP_02393452.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0442]
 gi|167641848|ref|ZP_02400088.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0193]
 gi|170689426|ref|ZP_02880617.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0465]
 gi|170709008|ref|ZP_02899439.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0389]
 gi|177652799|ref|ZP_02935172.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0174]
 gi|190568584|ref|ZP_03021490.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis
           Tsiankovskii-I]
 gi|196035750|ref|ZP_03103153.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus W]
 gi|196047115|ref|ZP_03114333.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus
           03BB108]
 gi|206968469|ref|ZP_03229425.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus AH1134]
 gi|206977812|ref|ZP_03238702.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus
           H3081.97]
 gi|217958285|ref|YP_002336831.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus AH187]
 gi|218232838|ref|YP_002365495.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus B4264]
 gi|222094456|ref|YP_002528515.1| quinol oxidase, subunit iii (cytochrome c oxidase, subunit iii)
           [Bacillus cereus Q1]
 gi|225862679|ref|YP_002748057.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus
           03BB102]
 gi|227816428|ref|YP_002816437.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           CDC 684]
 gi|228932130|ref|ZP_04095021.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228957119|ref|ZP_04118889.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228983900|ref|ZP_04144093.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229042562|ref|ZP_04190305.1| Quinol oxidase subunit 3 [Bacillus cereus AH676]
 gi|229108308|ref|ZP_04237927.1| Quinol oxidase subunit 3 [Bacillus cereus Rock1-15]
 gi|229126127|ref|ZP_04255148.1| Quinol oxidase subunit 3 [Bacillus cereus BDRD-Cer4]
 gi|229143425|ref|ZP_04271854.1| Quinol oxidase subunit 3 [Bacillus cereus BDRD-ST24]
 gi|229188907|ref|ZP_04315940.1| Quinol oxidase subunit 3 [Bacillus cereus ATCC 10876]
 gi|229601533|ref|YP_002865296.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0248]
 gi|254684222|ref|ZP_05148082.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           CNEVA-9066]
 gi|254725884|ref|ZP_05187666.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A1055]
 gi|254734416|ref|ZP_05192129.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           Western North America USA6153]
 gi|254742102|ref|ZP_05199789.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           Kruger B]
 gi|254755776|ref|ZP_05207809.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           Vollum]
 gi|254762358|ref|ZP_05214202.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           Australia 94]
 gi|296501451|ref|YP_003663151.1| cytochrome aa3 quinol oxidase polypeptide III [Bacillus
           thuringiensis BMB171]
 gi|301052350|ref|YP_003790561.1| quinol oxidase subunit III [Bacillus anthracis CI]
 gi|29894420|gb|AAP07710.1| Cytochrome aa3 quinol oxidase polypeptide III [Bacillus cereus ATCC
           14579]
 gi|30254300|gb|AAP24714.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           Ames]
 gi|42735765|gb|AAS39703.1| quinol oxidase, subunit III [Bacillus cereus ATCC 10987]
 gi|47501130|gb|AAT29806.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49177619|gb|AAT52995.1| quinol oxidase, subunit III [Bacillus anthracis str. Sterne]
 gi|49331821|gb|AAT62467.1| quinol oxidase, subunit III (cytochrome c oxidase, subunit III)
           [Bacillus thuringiensis serovar konkukian str. 97-27]
 gi|51978079|gb|AAU19629.1| quinol oxidase, subunit III (cytochrome c oxidase, subunit III)
           [Bacillus cereus E33L]
 gi|118415604|gb|ABK84023.1| cytochrome aa3 quinol oxidase subunit 3 [Bacillus thuringiensis
           str. Al Hakam]
 gi|164711327|gb|EDR16880.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0488]
 gi|167510196|gb|EDR85602.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0193]
 gi|167529395|gb|EDR92146.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0442]
 gi|170126110|gb|EDS95006.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0389]
 gi|170666588|gb|EDT17360.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0465]
 gi|172081833|gb|EDT66902.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0174]
 gi|190560378|gb|EDV14357.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis
           Tsiankovskii-I]
 gi|195991717|gb|EDX55682.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus W]
 gi|196022096|gb|EDX60785.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus
           03BB108]
 gi|206737389|gb|EDZ54536.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus AH1134]
 gi|206744009|gb|EDZ55426.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus
           H3081.97]
 gi|217062978|gb|ACJ77228.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus AH187]
 gi|218160795|gb|ACK60787.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus B4264]
 gi|221238513|gb|ACM11223.1| quinol oxidase, subunit III (cytochrome c oxidase, subunit III)
           [Bacillus cereus Q1]
 gi|225788852|gb|ACO29069.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus
           03BB102]
 gi|227007623|gb|ACP17366.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           CDC 684]
 gi|228594612|gb|EEK52398.1| Quinol oxidase subunit 3 [Bacillus cereus ATCC 10876]
 gi|228640053|gb|EEK96454.1| Quinol oxidase subunit 3 [Bacillus cereus BDRD-ST24]
 gi|228657334|gb|EEL13151.1| Quinol oxidase subunit 3 [Bacillus cereus BDRD-Cer4]
 gi|228675145|gb|EEL30370.1| Quinol oxidase subunit 3 [Bacillus cereus Rock1-15]
 gi|228726781|gb|EEL77995.1| Quinol oxidase subunit 3 [Bacillus cereus AH676]
 gi|228775813|gb|EEM24186.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228802566|gb|EEM49413.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228827558|gb|EEM73301.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|229265941|gb|ACQ47578.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0248]
 gi|296322503|gb|ADH05431.1| cytochrome aa3 quinol oxidase polypeptide III [Bacillus
           thuringiensis BMB171]
 gi|300374519|gb|ADK03423.1| quinol oxidase, subunit III [Bacillus cereus biovar anthracis str.
           CI]
 gi|324324742|gb|ADY20002.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 200

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 108/179 (60%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C   
Sbjct: 22  LGFWIFLGAEIMLFATLFASYLVLAGRTADGPTPAQLFELKTLLIQTLLLLTSSFTCGI- 80

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           ++    K      + W ++T   G  F+  EI EF   I   A  Q SAFLS FF L+G 
Sbjct: 81  VIHEMRKHNQKAMLGWFVLTLLLGAGFLFFEIEEFIMYIGEGATIQTSAFLSGFFVLLGT 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+IW   ++IQILK+GL     R++  +S++WHFLDL+W+ +++ VYL G+V
Sbjct: 141 HGAHVTGGIIWAICVIIQILKRGLTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMV 199


>gi|322383504|ref|ZP_08057279.1| cytochrome caa3 oxidase-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321152216|gb|EFX45047.1| cytochrome caa3 oxidase-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 193

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 67/192 (34%), Positives = 114/192 (59%), Gaps = 1/192 (0%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++     LGFW++L  + ++F   F TY  L  +   G    ++F +  I ++T
Sbjct: 2   EPEKATLEGKNKVLGFWLFLGGETVLFGCLFATYLALRNSVGDGKTSDELFQLPMIALAT 61

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
            +LL SSL+  FA++A    RL    + WL ++   G+ F+ +EIYEF   +        
Sbjct: 62  FLLLTSSLTSVFAVMALHRHRL-QSMLRWLAISVVLGLAFLGLEIYEFVEYVHEGHGFTT 120

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF +SF++LVG HG HV FG++W+ +L+IQ  KKGL +    +    +++WHF+D++W+
Sbjct: 121 SAFSTSFYSLVGFHGAHVLFGILWISLLIIQGSKKGLTTVTAPKFYIAALYWHFIDVVWV 180

Query: 199 CVFSFVYLMGVV 210
            +F+ VYLMG V
Sbjct: 181 FIFTVVYLMGKV 192


>gi|327439285|dbj|BAK15650.1| heme/copper-type cytochrome/quinol oxidase, subunit 3 [Solibacillus
           silvestris StLB046]
          Length = 199

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 72/190 (37%), Positives = 109/190 (57%), Gaps = 5/190 (2%)

Query: 23  SCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLL 82
           S  +++    GFW +L ++ ++F   F +Y VL      GP   ++F+I  +   T +LL
Sbjct: 13  STEENNLKIFGFWTFLGAEIMLFGTLFASYFVLSGRTGDGPTAAEIFEIGPVLAETFILL 72

Query: 83  LSSLSCSFAMLASATKRLIHK--TVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA 140
            SS +   A+ A    RL  K  T+S++ +T   G  FI +EIYEF H + + A    SA
Sbjct: 73  TSSFTIGLAIHA---MRLGSKKATLSFMGITLLLGAAFISVEIYEFVHYVHVGAGITTSA 129

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICV 200
           F S+    +G HGLHV FGL W   ++IQI K+GL S    +    S++WHFLD++WI +
Sbjct: 130 FTSALLTTLGTHGLHVTFGLFWGIFIMIQIAKRGLNSVTAGKTFVFSLYWHFLDVVWIFI 189

Query: 201 FSFVYLMGVV 210
           FSF+YL G++
Sbjct: 190 FSFIYLKGMM 199


>gi|295402442|ref|ZP_06812395.1| cytochrome aa3 quinol oxidase, subunit III [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|294975533|gb|EFG51158.1| cytochrome aa3 quinol oxidase, subunit III [Geobacillus
           thermoglucosidasius C56-YS93]
          Length = 204

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 113/179 (63%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++  +FA  F TY VL +   +GP   ++F++  + + T++LL SS +C  A
Sbjct: 26  LGFWIFLGAEVALFATLFATYLVLFQRTGSGPTAKELFEVKDVLIETLLLLTSSFTCGLA 85

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +      R     ++WLLVT   G  FI  EI EF H +   A  Q SAFLSSFF LVG 
Sbjct: 86  VFEMRRNRF-SGLLTWLLVTLLLGAGFITFEIREFIHYVHEGATMQTSAFLSSFFVLVGT 144

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+ W+ +++IQIL++GL     R++  +S++WHFLD++WI +F+ VYL G+V
Sbjct: 145 HGAHVSLGIGWMILIIIQILQRGLTPRTARKVFIVSLYWHFLDVVWIFIFTLVYLTGMV 203


>gi|289551129|ref|YP_003472033.1| quinol oxidase polypeptide III QoxC [Staphylococcus lugdunensis
           HKU09-01]
 gi|315658630|ref|ZP_07911500.1| quinol oxidase subunit III [Staphylococcus lugdunensis M23590]
 gi|289180661|gb|ADC87906.1| quinol oxidase polypeptide III QoxC [Staphylococcus lugdunensis
           HKU09-01]
 gi|315496261|gb|EFU84586.1| quinol oxidase subunit III [Staphylococcus lugdunensis M23590]
          Length = 201

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 115/195 (58%), Gaps = 6/195 (3%)

Query: 20  KKESCVDHDG--TYLGFWIYLMSDCLMFAVFFVTYAVL--GKNYAAGPAPIDVFDISGIF 75
           K      H+G    LGFWI+L ++  +F   F T   L  G +YA G    D+F++  + 
Sbjct: 6   KTIDARTHEGELNKLGFWIFLTAEFALFGTLFATLLTLQHGGDYA-GKLTTDLFELKLVL 64

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           + T  LLLSS +C  A+     ++  +  + W+++T   G++F+  EIYEFAH  S    
Sbjct: 65  IMTFALLLSSYTCGIAIYYMRKEKQ-NLMMLWMIITLALGLVFVGFEIYEFAHYASEGVN 123

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           P   +F SSFF L+G HG HV  G++W+  L+IQ+  +GL   N  +L  +S++WHFLD+
Sbjct: 124 PTIGSFWSSFFILLGTHGAHVSLGIVWIICLLIQVATRGLNKYNAPKLFIVSLYWHFLDV 183

Query: 196 IWICVFSFVYLMGVV 210
           +WI +F+ VY++G+V
Sbjct: 184 VWIFIFTAVYMIGMV 198


>gi|75762630|ref|ZP_00742475.1| Cytochrome aa3 quinol oxidase polypeptide III [Bacillus
           thuringiensis serovar israelensis ATCC 35646]
 gi|74489877|gb|EAO53248.1| Cytochrome aa3 quinol oxidase polypeptide III [Bacillus
           thuringiensis serovar israelensis ATCC 35646]
          Length = 182

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 109/179 (60%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C   
Sbjct: 4   LGFWIFLGAEIMLFATLFASYLVLAGRTADGPTPAQLFELKTLLIQTLLLLTSSFTCGI- 62

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           ++    K      + W ++T   G  F+  EI EF   I   A  Q SAFLS+FF L+G 
Sbjct: 63  VIHEMRKHNQKAMLGWFVLTLLLGAGFLFFEIEEFIMYIGEGATIQTSAFLSAFFVLLGT 122

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+IW   ++IQILK+GL     R++  +S++WHFLDL+W+ +++ VYL G+V
Sbjct: 123 HGAHVTGGIIWAICVIIQILKRGLTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMV 181


>gi|229101461|ref|ZP_04232202.1| Quinol oxidase subunit 3 [Bacillus cereus Rock3-28]
 gi|228681949|gb|EEL36085.1| Quinol oxidase subunit 3 [Bacillus cereus Rock3-28]
          Length = 200

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 71/179 (39%), Positives = 109/179 (60%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C   
Sbjct: 22  LGFWIFLGAEIMLFATLFASYLVLAGRTADGPTPAQLFELKTLLIQTLLLLTSSFTCGI- 80

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           ++    K      + W ++T   G  F+  EI EF   +   A  Q SAFLS+FF L+G 
Sbjct: 81  VIHEMRKHNQKAMLGWFILTLLLGAGFLFFEIEEFILYVGEGATIQTSAFLSAFFVLLGT 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+IW   ++IQILK+GL     R++  +S++WHFLDL+W+ +++ VYL G+V
Sbjct: 141 HGAHVTGGIIWAICVIIQILKRGLTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMV 199


>gi|47568831|ref|ZP_00239525.1| cytochrome c oxidase subunit III [Bacillus cereus G9241]
 gi|228951199|ref|ZP_04113314.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|229068385|ref|ZP_04201688.1| Quinol oxidase subunit 3 [Bacillus cereus F65185]
 gi|229078012|ref|ZP_04210621.1| Quinol oxidase subunit 3 [Bacillus cereus Rock4-2]
 gi|229149039|ref|ZP_04277283.1| Quinol oxidase subunit 3 [Bacillus cereus m1550]
 gi|229177229|ref|ZP_04304616.1| Quinol oxidase subunit 3 [Bacillus cereus 172560W]
 gi|47554507|gb|EAL12864.1| cytochrome c oxidase subunit III [Bacillus cereus G9241]
 gi|228606235|gb|EEK63669.1| Quinol oxidase subunit 3 [Bacillus cereus 172560W]
 gi|228634421|gb|EEK91006.1| Quinol oxidase subunit 3 [Bacillus cereus m1550]
 gi|228705350|gb|EEL57727.1| Quinol oxidase subunit 3 [Bacillus cereus Rock4-2]
 gi|228714846|gb|EEL66718.1| Quinol oxidase subunit 3 [Bacillus cereus F65185]
 gi|228808496|gb|EEM55000.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
          Length = 200

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 108/179 (60%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C   
Sbjct: 22  LGFWIFLGAEIMLFATLFASYLVLAGRTADGPTPAQLFELKTLLIQTLLLLTSSFTCGI- 80

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           ++    K      + W ++T   G  F+  EI EF   I   A  Q SAFLS FF L+G 
Sbjct: 81  VIHEMRKHNQKAMLGWFVLTLLLGAGFLFFEIEEFIMYIGEGATIQTSAFLSGFFVLLGT 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+IW   ++IQILK+GL     R++  +S++WHFLDL+W+ +++ VYL G+V
Sbjct: 141 HGAHVTGGIIWATCVIIQILKRGLTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMV 199


>gi|226329081|ref|ZP_03804599.1| hypothetical protein PROPEN_02984 [Proteus penneri ATCC 35198]
 gi|225202267|gb|EEG84621.1| hypothetical protein PROPEN_02984 [Proteus penneri ATCC 35198]
          Length = 115

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 62/102 (60%), Positives = 79/102 (77%)

Query: 107 WLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVL 166
           WL VT  FG+ F+IME+YEF  LI+    P RSAFLS+FFALV  HGLHV  GLIW+ ++
Sbjct: 12  WLFVTFLFGLGFVIMEVYEFHELIAEGYGPDRSAFLSAFFALVSTHGLHVTAGLIWIVIM 71

Query: 167 VIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           +IQ+ ++GL   N+ RL CLS+FWHFLD++WICVF+ VYLMG
Sbjct: 72  MIQVSRRGLTEVNRTRLSCLSLFWHFLDVVWICVFTVVYLMG 113


>gi|172057995|ref|YP_001814455.1| cytochrome c oxidase subunit III [Exiguobacterium sibiricum 255-15]
 gi|171990516|gb|ACB61438.1| cytochrome c oxidase subunit III [Exiguobacterium sibiricum 255-15]
          Length = 209

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 117/203 (57%), Gaps = 3/203 (1%)

Query: 10  PNFSLFYVKDKKE-SCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA-AGPAPID 67
           PN  +  + D  E + ++    Y+ FW +L  +  +FA  F TY  L  + A  G    D
Sbjct: 7   PNNPITGIPDHVEKATLEGKNKYVAFWFFLGGETTLFASLFGTYIGLHNSGAKEGLRSYD 66

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
           +F++  +F+ T++LL SSL+   AM+A   +  + K   WL++T   G+ F+  EIYEF 
Sbjct: 67  IFEMGLVFIMTMLLLTSSLTSVLAMMA-MKRNDVKKMKMWLIITLALGLGFLSGEIYEFN 125

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
           H   +      SAF S+F+ LVG HG HV FGL+W+  L+I+   +G+   N  +    S
Sbjct: 126 HYYHIGHTFTSSAFGSAFYTLVGFHGAHVLFGLLWISTLLIRNWNRGITVVNAPKYYVSS 185

Query: 188 MFWHFLDLIWICVFSFVYLMGVV 210
           ++WHF+D++W+ +FS VYLMG+V
Sbjct: 186 LYWHFIDVVWVFIFSVVYLMGMV 208


>gi|196249841|ref|ZP_03148537.1| cytochrome aa3 quinol oxidase, subunit III [Geobacillus sp.
           G11MC16]
 gi|196210717|gb|EDY05480.1| cytochrome aa3 quinol oxidase, subunit III [Geobacillus sp.
           G11MC16]
          Length = 176

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 71/174 (40%), Positives = 110/174 (63%), Gaps = 1/174 (0%)

Query: 37  YLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASA 96
           +L ++ ++FA  F TY VL +   +GP   ++F +  + + T++LL SS +C  A+    
Sbjct: 3   FLGAEVVLFATLFATYLVLFQRTGSGPTAQELFQVKDVLIETLLLLTSSFTCGLAIFEMR 62

Query: 97  TKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHV 156
             RL    ++WLLVT   G+ FI  E+ EF H +   A  Q SAFLSSFF LVG HG HV
Sbjct: 63  RGRLA-GLLAWLLVTLLLGIGFITFEVREFIHYVHEGATMQTSAFLSSFFVLVGTHGAHV 121

Query: 157 FFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
             G+ W+  ++IQ+L++GL     R++  +S++WHFLD++WI +F+ VYL+G+V
Sbjct: 122 SLGIGWMIFIIIQLLQRGLTVKTARKVFIVSLYWHFLDVVWIFIFTLVYLLGMV 175


>gi|205373048|ref|ZP_03225854.1| CtaE [Bacillus coahuilensis m4-4]
          Length = 216

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 72/192 (37%), Positives = 111/192 (57%), Gaps = 3/192 (1%)

Query: 21  KESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPA-PIDVFDISGIFVSTI 79
           + + V     + GFW +L  + ++FA  F TY  L      G     ++FD+  +FV+T+
Sbjct: 25  RVTNVRRKNKFYGFWFFLGGETVLFASLFATYLALKDKVLPGQKVAAEIFDLPLVFVATM 84

Query: 80  VLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP-QR 138
           +LL SSL+  +AM            V+WL +T   G  F+ +E+YEF H +         
Sbjct: 85  LLLTSSLTSVYAMHHMKNYNF-RGMVAWLFITVALGAAFLGLEVYEFYHYVHAYGHTFTS 143

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF S+F+ALVG HGLHV FGL+W+  L+I+  K+GL   N  +    S++WHF+D++W+
Sbjct: 144 SAFGSAFYALVGTHGLHVAFGLLWITTLLIRNRKRGLSLYNAPKFYVASLYWHFIDVVWV 203

Query: 199 CVFSFVYLMGVV 210
            +F+ VYLMG+V
Sbjct: 204 FIFTVVYLMGLV 215


>gi|239636438|ref|ZP_04677440.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus warneri
           L37603]
 gi|239597793|gb|EEQ80288.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus warneri
           L37603]
          Length = 201

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 115/188 (61%), Gaps = 6/188 (3%)

Query: 27  HDG--TYLGFWIYLMSDCLMFAVFFVTYAVL--GKNYAAGPAPIDVFDISGIFVSTIVLL 82
           H+G    LGFWI+L ++  +F   F T   L  G +YA G    ++F++  + + T  LL
Sbjct: 13  HEGELNKLGFWIFLTAEFALFGTLFATLLTLQHGGDYA-GKMTTELFELPLVLIMTFALL 71

Query: 83  LSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFL 142
           LSS +C  A+     ++  +  + W+++T   G++F+  EIYEFAH  +    P   +F 
Sbjct: 72  LSSYTCGIAIYYMRKEKQ-NLMMFWMILTVLLGLVFVGFEIYEFAHYATEGVNPTIGSFW 130

Query: 143 SSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFS 202
           SSFF L+G HG HV  G++W+  L+IQI  +GL S N  +L  +S++WHFLD++WI +F+
Sbjct: 131 SSFFILLGTHGCHVSVGIVWIICLLIQIATRGLDSYNAPKLFIVSLYWHFLDVVWIFIFT 190

Query: 203 FVYLMGVV 210
            VY++G+V
Sbjct: 191 AVYMIGMV 198


>gi|56419619|ref|YP_146937.1| cytochrome c oxidase subunit III [Geobacillus kaustophilus HTA426]
 gi|261419281|ref|YP_003252963.1| cytochrome-c oxidase [Geobacillus sp. Y412MC61]
 gi|297530749|ref|YP_003672024.1| cytochrome-c oxidase [Geobacillus sp. C56-T3]
 gi|319766097|ref|YP_004131598.1| cytochrome-c oxidase [Geobacillus sp. Y412MC52]
 gi|56379461|dbj|BAD75369.1| cytochrome c oxidase subunit III [Geobacillus kaustophilus HTA426]
 gi|261375738|gb|ACX78481.1| Cytochrome-c oxidase [Geobacillus sp. Y412MC61]
 gi|297254001|gb|ADI27447.1| Cytochrome-c oxidase [Geobacillus sp. C56-T3]
 gi|317110963|gb|ADU93455.1| Cytochrome-c oxidase [Geobacillus sp. Y412MC52]
          Length = 206

 Score =  130 bits (328), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 68/191 (35%), Positives = 112/191 (58%), Gaps = 3/191 (1%)

Query: 21  KESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIV 80
           + + ++    +LGFW++L  + ++FA  F TY  L      GP+  ++F +  +F++T++
Sbjct: 17  ERATLEGKNKFLGFWLFLGGETVLFASLFATYLALKDKTNGGPSAEELFQMPVVFMATML 76

Query: 81  LLLSSLSCSFAMLASATKRLIHKTVS-WLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS 139
           LL SSL+  +A+     K    K +  W  +T   G  F+ +EIYEF   +        S
Sbjct: 77  LLTSSLTSVYAIYH--MKNFDFKKMQLWFGITVLLGAGFLGLEIYEFNEYVHEGHKFTTS 134

Query: 140 AFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWIC 199
           AF S+F+ LVG HG HV FGL+W+  L+I+  K+GL   N  +    S++WHF+D++W+ 
Sbjct: 135 AFASAFYTLVGTHGSHVAFGLLWILTLMIRNAKRGLNLYNAPKFYVASLYWHFIDVVWVF 194

Query: 200 VFSFVYLMGVV 210
           +F+ VYLMG+V
Sbjct: 195 IFTVVYLMGMV 205


>gi|251799268|ref|YP_003013999.1| cytochrome-c oxidase [Paenibacillus sp. JDR-2]
 gi|247546894|gb|ACT03913.1| Cytochrome-c oxidase [Paenibacillus sp. JDR-2]
          Length = 205

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 67/192 (34%), Positives = 115/192 (59%), Gaps = 1/192 (0%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++     LGFW++L ++ ++F   F  +  L      GP   ++F++  + ++T
Sbjct: 14  EPEKATLEGRNKILGFWLFLGAETVLFGTLFSAFLALRDQVLDGPKSQELFELPLVALAT 73

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
            +LL SSL+  FA  A   ++ +   V WL+VT   G+ F+ +EIYEF++ +        
Sbjct: 74  GLLLTSSLTSVFATQALHQQK-VKAMVWWLVVTVILGLGFLGLEIYEFSNYVHEGHGFTT 132

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF SSF+ LVG HG HV FG++W+ +L+ Q+LKKGL      +     ++WHF+D++W+
Sbjct: 133 SAFSSSFYTLVGFHGAHVAFGIVWISLLIGQLLKKGLTVTTAPKAYVAGIYWHFIDVVWV 192

Query: 199 CVFSFVYLMGVV 210
            +F+ VYLMG V
Sbjct: 193 FIFTVVYLMGKV 204


>gi|228989832|ref|ZP_04149812.1| Quinol oxidase subunit 3 [Bacillus pseudomycoides DSM 12442]
 gi|228996023|ref|ZP_04155678.1| Quinol oxidase subunit 3 [Bacillus mycoides Rock3-17]
 gi|229003639|ref|ZP_04161454.1| Quinol oxidase subunit 3 [Bacillus mycoides Rock1-4]
 gi|228757605|gb|EEM06835.1| Quinol oxidase subunit 3 [Bacillus mycoides Rock1-4]
 gi|228763719|gb|EEM12611.1| Quinol oxidase subunit 3 [Bacillus mycoides Rock3-17]
 gi|228769979|gb|EEM18562.1| Quinol oxidase subunit 3 [Bacillus pseudomycoides DSM 12442]
          Length = 200

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 71/179 (39%), Positives = 107/179 (59%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C  A
Sbjct: 22  LGFWIFLGAEIVLFATLFASYLVLAGRTADGPTPAQLFELKTLLIQTLLLLTSSFTCGIA 81

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
            +    K      + W + T   G  F+  E+ EF   ++  A  Q S FLS FF L+G 
Sbjct: 82  -IHEMRKHNQKAMLGWFIFTLILGAGFLFFEVEEFMAYVAEGATIQTSGFLSGFFVLLGT 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+IW   +VIQILK+GL     R++  +S++WHFLD++WI +++ VYL G+V
Sbjct: 141 HGAHVTAGIIWATCVVIQILKRGLTPVTARKVFIISLYWHFLDVVWIFIYTLVYLNGMV 199


>gi|228474321|ref|ZP_04059056.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus hominis
           SK119]
 gi|314936750|ref|ZP_07844097.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus hominis
           subsp. hominis C80]
 gi|228271680|gb|EEK13027.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus hominis
           SK119]
 gi|313655369|gb|EFS19114.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus hominis
           subsp. hominis C80]
          Length = 201

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 71/189 (37%), Positives = 113/189 (59%), Gaps = 6/189 (3%)

Query: 26  DHDG--TYLGFWIYLMSDCLMFAVFFVTYAVL--GKNYAAGPAPIDVFDISGIFVSTIVL 81
            H+G    LGFWI+L ++  +F   F T   L  G +Y  G    ++F++  + + T  L
Sbjct: 12  THEGQLNKLGFWIFLTAEFALFGTLFATLLTLQHGGSYG-GKMTTELFELPLVLIMTFAL 70

Query: 82  LLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAF 141
           L+SS +C  A +    K    K + W+++T   G+IF+  EIYEFAH  S    P+  ++
Sbjct: 71  LISSYTCGIA-IYYLRKEEKGKMMFWMILTVILGLIFVGFEIYEFAHYASEGVTPKVGSY 129

Query: 142 LSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVF 201
            SSFF L+G HG HV  G++W+  L+IQ+  +GL   N  +L  +S++WHFLD++WI +F
Sbjct: 130 WSSFFILLGTHGAHVSLGIVWIICLLIQVATRGLNKFNAPKLFIVSLYWHFLDVVWIFIF 189

Query: 202 SFVYLMGVV 210
           + VY++G+V
Sbjct: 190 TAVYMIGMV 198


>gi|149181710|ref|ZP_01860202.1| CtaE [Bacillus sp. SG-1]
 gi|148850558|gb|EDL64716.1| CtaE [Bacillus sp. SG-1]
          Length = 209

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 70/197 (35%), Positives = 113/197 (57%), Gaps = 10/197 (5%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAP-----IDVFDISGI 74
            +++ ++    +LGFW +L  + ++F   F TY  L  +    P+P      D+FD+   
Sbjct: 16  PEKATLEAKNKFLGFWFFLGGETVLFGSLFATYLALKDSV---PSPDHALAKDIFDLPLA 72

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI-SME 133
           F++T++LL SSL+  +AM             +WLL+T   G  F+ +EIYEF H +    
Sbjct: 73  FIATMLLLTSSLTSVYAMYHMKNYNF-KNMQAWLLITVLLGAAFLALEIYEFNHYVHEYH 131

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
                SAF S+F+ LVG HG HV FGL+W+  L+++  K+GL   N  +    S++WHF+
Sbjct: 132 HTFTSSAFGSAFYTLVGFHGAHVAFGLLWIISLMVRNAKRGLSLYNAPKFYVASLYWHFI 191

Query: 194 DLIWICVFSFVYLMGVV 210
           D++W+ +F+ VYLMG+V
Sbjct: 192 DVVWVFIFTVVYLMGMV 208


>gi|138894619|ref|YP_001125072.1| cytochrome caa3-type oxidase III [Geobacillus thermodenitrificans
           NG80-2]
 gi|196247772|ref|ZP_03146474.1| cytochrome c oxidase subunit III [Geobacillus sp. G11MC16]
 gi|1841879|dbj|BAA11113.1| cytochrome c oxidase subunit III [Geobacillus stearothermophilus]
 gi|134266132|gb|ABO66327.1| Cytochrome caa3-type oxidase III [Geobacillus thermodenitrificans
           NG80-2]
 gi|196212556|gb|EDY07313.1| cytochrome c oxidase subunit III [Geobacillus sp. G11MC16]
          Length = 206

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 110/190 (57%), Gaps = 1/190 (0%)

Query: 21  KESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIV 80
           + + ++    +LGFW++L  + ++FA  F TY  L      GP+  ++F +  +F++T++
Sbjct: 17  ERATLEGKNKFLGFWLFLGGETVLFASLFATYLALKDKTNGGPSGEELFQMPIVFMATML 76

Query: 81  LLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA 140
           LL SSL+  +A+          K   W  +T   G  F+ +EIYEF   +        SA
Sbjct: 77  LLTSSLTSVYAIYHMKNFDF-QKMQLWFGITVLLGAGFLALEIYEFYEYVHEGHKFTSSA 135

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICV 200
           F S+F+ LVG HG HV FGL+W+  L+I+  K+GL   N  +    S++WHF+D++W+ +
Sbjct: 136 FGSAFYTLVGTHGAHVAFGLLWILTLMIRNAKRGLNLYNAPKFYVASLYWHFIDVVWVFI 195

Query: 201 FSFVYLMGVV 210
           F+ VYLMG+V
Sbjct: 196 FTVVYLMGMV 205


>gi|330684196|gb|EGG95940.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus
           epidermidis VCU121]
          Length = 201

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 115/188 (61%), Gaps = 6/188 (3%)

Query: 27  HDG--TYLGFWIYLMSDCLMFAVFFVTYAVL--GKNYAAGPAPIDVFDISGIFVSTIVLL 82
           H+G    LGFWI+L ++  +F   F T   L  G +YA G    ++F++  + + T  LL
Sbjct: 13  HEGELNKLGFWIFLTAEFALFGTLFATLLTLQHGGDYA-GKMTTELFELPLVLIMTFALL 71

Query: 83  LSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFL 142
           LSS +C  A+     ++  +  + W+++T   G++F+  EIYEFAH  +    P   +F 
Sbjct: 72  LSSYTCGIAIYYMRKEKQ-NLMMFWMILTVLLGLVFVGFEIYEFAHYATEGVNPTIGSFW 130

Query: 143 SSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFS 202
           SSFF L+G HG HV  G++W+  L+IQI  +GL S N  +L  +S++WHFLD++WI +F+
Sbjct: 131 SSFFILLGTHGCHVSVGIVWIICLLIQIGTRGLDSYNAPKLFIVSLYWHFLDVVWIFIFT 190

Query: 203 FVYLMGVV 210
            VY++G+V
Sbjct: 191 AVYMIGMV 198


>gi|27467675|ref|NP_764312.1| quinol oxidase polypeptide III QoxC [Staphylococcus epidermidis
           ATCC 12228]
 gi|57866536|ref|YP_188229.1| quinol oxidase, subunit III [Staphylococcus epidermidis RP62A]
 gi|242242363|ref|ZP_04796808.1| cytochrome-c oxidase [Staphylococcus epidermidis W23144]
 gi|251810512|ref|ZP_04824985.1| cytochrome-c oxidase [Staphylococcus epidermidis BCM-HMP0060]
 gi|282876583|ref|ZP_06285448.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus
           epidermidis SK135]
 gi|293366953|ref|ZP_06613628.1| quinol oxidase subunit III [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|81675019|sp|Q5HQB1|QOX3_STAEQ RecName: Full=Probable quinol oxidase subunit 3; AltName:
           Full=Quinol oxidase polypeptide III
 gi|81842948|sp|Q8CPP8|QOX3_STAES RecName: Full=Probable quinol oxidase subunit 3; AltName:
           Full=Quinol oxidase polypeptide III
 gi|27315219|gb|AAO04354.1|AE016746_144 quinol oxidase polypeptide III QoxC [Staphylococcus epidermidis
           ATCC 12228]
 gi|57637194|gb|AAW53982.1| quinol oxidase, subunit III [Staphylococcus epidermidis RP62A]
 gi|242234170|gb|EES36482.1| cytochrome-c oxidase [Staphylococcus epidermidis W23144]
 gi|251805923|gb|EES58580.1| cytochrome-c oxidase [Staphylococcus epidermidis BCM-HMP0060]
 gi|281294671|gb|EFA87200.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus
           epidermidis SK135]
 gi|291318928|gb|EFE59299.1| quinol oxidase subunit III [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|319401614|gb|EFV89824.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus
           epidermidis FRI909]
 gi|329732867|gb|EGG69213.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus
           epidermidis VCU144]
 gi|329734253|gb|EGG70569.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus
           epidermidis VCU028]
 gi|329735503|gb|EGG71791.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus
           epidermidis VCU045]
          Length = 201

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 113/188 (60%), Gaps = 6/188 (3%)

Query: 27  HDG--TYLGFWIYLMSDCLMFAVFFVTYAVL--GKNYAAGPAPIDVFDISGIFVSTIVLL 82
           H+G    LGFWI+L ++  +F   F T   L  G  Y  G    D+F++  I + T  LL
Sbjct: 13  HEGELNKLGFWIFLTAEFALFGTLFATLLTLQHGGGYG-GKLTTDLFELHLILIMTFALL 71

Query: 83  LSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFL 142
           +SS +C  A+     ++  +  + W+++T   G++F+  EIYEFAH  S    P   +F 
Sbjct: 72  ISSYTCGIAIYYMRQEKQ-NLMMFWMIITVILGLVFVGFEIYEFAHYASEGVNPTIGSFW 130

Query: 143 SSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFS 202
           SSFF L+G HG HV  G++W+  L+IQI  +GL S N  +L  +S++WHFLD++W+ +F+
Sbjct: 131 SSFFILLGTHGAHVSLGIVWVICLLIQIGTRGLDSYNAPKLFIVSLYWHFLDVVWVFIFT 190

Query: 203 FVYLMGVV 210
            VY++G+V
Sbjct: 191 AVYMIGMV 198


>gi|239826488|ref|YP_002949112.1| cytochrome C oxidase subunit III [Geobacillus sp. WCH70]
 gi|239806781|gb|ACS23846.1| cytochrome c oxidase subunit III [Geobacillus sp. WCH70]
          Length = 206

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 111/192 (57%), Gaps = 1/192 (0%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
             + + ++    +LG W++L  + ++FA  F T+  L    A GP   ++F +  +FV+T
Sbjct: 15  SPERATIEGKNKFLGLWVFLGGETVLFASLFGTFIALRDKTAGGPTSQELFHLPLVFVAT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           ++LL SSL+  +A+          K + W  +T   G+ F+ +EIYEF   +        
Sbjct: 75  MLLLTSSLTSVYAIYHMKNFDF-KKMMLWFGITVLLGLCFLGLEIYEFYEYVHKGLKFST 133

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF S+F+ LVGLHG HV FGL W+  L+I+  K+GL   N  +    S++WHF+D++W+
Sbjct: 134 SAFSSAFYTLVGLHGSHVAFGLSWILTLMIRNAKRGLNLYNAPKFYVASLYWHFIDVVWV 193

Query: 199 CVFSFVYLMGVV 210
            +F+ VYLMG+V
Sbjct: 194 FIFTVVYLMGMV 205


>gi|70726904|ref|YP_253818.1| quinol oxidase polypeptide III [Staphylococcus haemolyticus
           JCSC1435]
 gi|123659873|sp|Q4L563|QOX3_STAHJ RecName: Full=Probable quinol oxidase subunit 3; AltName:
           Full=Quinol oxidase polypeptide III
 gi|68447628|dbj|BAE05212.1| quinol oxidase polypeptide III [Staphylococcus haemolyticus
           JCSC1435]
          Length = 201

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 69/188 (36%), Positives = 115/188 (61%), Gaps = 6/188 (3%)

Query: 27  HDG--TYLGFWIYLMSDCLMFAVFFVTYAVL--GKNYAAGPAPIDVFDISGIFVSTIVLL 82
           H+G    LGFWI+L ++  +F   F T   L  G +YA G    ++F++  + + T  LL
Sbjct: 13  HEGQLNKLGFWIFLTAEFSLFGTLFATLLTLQHGGDYA-GKMTTELFELPLVLIMTFALL 71

Query: 83  LSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFL 142
           +SS +C  ++     ++  +  + W+++T   G++F+  EIYEFAH +S    PQ  ++ 
Sbjct: 72  ISSYTCGISIYYMRKEKQ-NLMMFWMILTVLLGLVFVGFEIYEFAHYVSEGVTPQIGSYW 130

Query: 143 SSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFS 202
           SSFF L+G HG HV  G+ W+  L+IQ+  +GL   N  +L  +S++WHFLD++WI +F+
Sbjct: 131 SSFFILLGTHGAHVSLGIGWIICLLIQVATRGLNKYNAPKLFIVSLYWHFLDVVWIFIFT 190

Query: 203 FVYLMGVV 210
            VY++G+V
Sbjct: 191 AVYMIGMV 198


>gi|152974415|ref|YP_001373932.1| cytochrome aa3 quinol oxidase subunit III [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152023167|gb|ABS20937.1| Cytochrome aa3 quinol oxidase subunit III [Bacillus cytotoxicus NVH
           391-98]
          Length = 200

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 107/179 (59%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C  A
Sbjct: 22  LGFWIFLGAEIVLFATLFASYLVLAGRTADGPTPAQLFELKTLLIQTLLLLTSSFTCGIA 81

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
            +    +   +  + W + T   G  F+  EI EF    +  A  Q S FLS FF L+G 
Sbjct: 82  -IHEMRRHNKNAMLGWFIFTLLLGAGFLFFEIEEFMTYAAEGATIQTSGFLSGFFVLLGT 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+IW   ++IQILK+GL     R++  +S++WHFLD++WI +++ VYL G+V
Sbjct: 141 HGAHVTAGIIWAICVIIQILKRGLTPITARKVFIISLYWHFLDVVWIFIYTLVYLNGMV 199


>gi|89099673|ref|ZP_01172547.1| cytochrome aa3 quinol oxidase subunit III [Bacillus sp. NRRL
           B-14911]
 gi|89085616|gb|EAR64743.1| cytochrome aa3 quinol oxidase subunit III [Bacillus sp. NRRL
           B-14911]
          Length = 198

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 112/190 (58%), Gaps = 5/190 (2%)

Query: 23  SCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLL 82
           S  ++    LGFWI+L ++ ++FA  F  Y  L     +GP+  ++F+IS + + T VLL
Sbjct: 12  STEENKTKILGFWIFLGAEIMLFATLFAGYFTLVDRTGSGPSAGEIFEISPVLIETFVLL 71

Query: 83  LSSLSCSFAMLASATKRLIHKT--VSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA 140
            SS +   A+ A    RL +K   +++  +T   G+ F+ +EIYEF H + + A  Q SA
Sbjct: 72  TSSFTIGLAIHA---MRLGNKKAMLAFFGITILLGLGFLSVEIYEFIHYVHIGAGLQTSA 128

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICV 200
           F +     +G HGLHV FG+ W   +++Q+ K+GL      +    S++WHFLD++WI +
Sbjct: 129 FTAILLTTLGTHGLHVTFGIFWGLAIMLQVKKRGLNPHTANKSFIFSLYWHFLDVVWIFI 188

Query: 201 FSFVYLMGVV 210
           FSF+YL G++
Sbjct: 189 FSFIYLKGLM 198


>gi|319892053|ref|YP_004148928.1| quinol oxidase polypeptide III QoxC [Staphylococcus
           pseudintermedius HKU10-03]
 gi|317161749|gb|ADV05292.1| quinol oxidase polypeptide III QoxC [Staphylococcus
           pseudintermedius HKU10-03]
 gi|323464838|gb|ADX76991.1| quinol oxidase subunit III [Staphylococcus pseudintermedius ED99]
          Length = 202

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 121/203 (59%), Gaps = 13/203 (6%)

Query: 17  VKDKKESCVD---HDG--TYLGFWIYLMSDCLMFAVFFVTYAVL--GKNYAAGPAPIDVF 69
           +  K  + +D   H+G    LGFWI+L ++  +F   F T   L  G +Y  G    D+F
Sbjct: 1   MSHKNVNTIDARTHEGDLNKLGFWIFLTAEFALFGTLFATLLTLQHGGSYG-GMLTTDLF 59

Query: 70  DISGIFVSTIVLLLSSLSCSFAM--LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
           ++  + + T +LL SS +C  A+  +    K+L+   + W+++T   G+ F+  EI+EF+
Sbjct: 60  ELPLVLIMTFLLLASSYTCGIAIYYMRKENKQLL---LIWMIITIILGIGFVGFEIFEFS 116

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
           H +   A PQ +++ SSFF L+G HG HV  G+ W+  L+IQ+  +GL   N  +L  +S
Sbjct: 117 HYVHEGATPQLASYWSSFFILLGTHGAHVTVGIFWIICLLIQVATRGLTKYNAPKLFIVS 176

Query: 188 MFWHFLDLIWICVFSFVYLMGVV 210
           ++WHFLD++WI +F+ VY++G+V
Sbjct: 177 LYWHFLDVVWIFIFTAVYMIGMV 199


>gi|289829173|ref|ZP_06546815.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-3139]
          Length = 156

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 85/130 (65%), Gaps = 1/130 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSDC++F++ F TYAVL    A GP   D+F++  + V T +LL SS++   A 
Sbjct: 28  GFWVYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAA 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A   K    + +SWL +T  FG  FI MEIYEF HLI     P RS FLS+FFALVG H
Sbjct: 88  IA-MHKNNKSQVISWLALTFLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTH 146

Query: 153 GLHVFFGLIW 162
           GLHV  GLIW
Sbjct: 147 GLHVTSGLIW 156


>gi|29654348|ref|NP_820040.1| cytochrome c oxidase polypeptide III [Coxiella burnetii RSA 493]
 gi|153206716|ref|ZP_01945557.1| cytochrome o ubiquinol oxidase, subunit III [Coxiella burnetii 'MSU
           Goat Q177']
 gi|154706160|ref|YP_001424382.1| cytochrome c oxidase polypeptide III [Coxiella burnetii Dugway
           5J108-111]
 gi|161830988|ref|YP_001596690.1| cytochrome o ubiquinol oxidase, subunit III [Coxiella burnetii RSA
           331]
 gi|165924174|ref|ZP_02220006.1| cytochrome o ubiquinol oxidase, subunit III [Coxiella burnetii RSA
           334]
 gi|212212543|ref|YP_002303479.1| cytochrome O ubiquinol oxidase subunit III [Coxiella burnetii
           CbuG_Q212]
 gi|212218406|ref|YP_002305193.1| cytochrome O ubiquinol oxidase subunit III [Coxiella burnetii
           CbuK_Q154]
 gi|29541615|gb|AAO90554.1| cytochrome c oxidase polypeptide III [Coxiella burnetii RSA 493]
 gi|120577079|gb|EAX33703.1| cytochrome o ubiquinol oxidase, subunit III [Coxiella burnetii 'MSU
           Goat Q177']
 gi|154355446|gb|ABS76908.1| cytochrome c oxidase polypeptide III [Coxiella burnetii Dugway
           5J108-111]
 gi|161762855|gb|ABX78497.1| cytochrome o ubiquinol oxidase, subunit III [Coxiella burnetii RSA
           331]
 gi|165916378|gb|EDR34982.1| cytochrome o ubiquinol oxidase, subunit III [Coxiella burnetii RSA
           334]
 gi|212010953|gb|ACJ18334.1| cytochrome O ubiquinol oxidase subunit III [Coxiella burnetii
           CbuG_Q212]
 gi|212012668|gb|ACJ20048.1| cytochrome O ubiquinol oxidase subunit III [Coxiella burnetii
           CbuK_Q154]
          Length = 198

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 71/192 (36%), Positives = 108/192 (56%), Gaps = 2/192 (1%)

Query: 20  KKESCVDHDGT-YLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
             E   + D T   GFW+Y+M+DC++FA  F T+ VL    A GP    + D+  + V T
Sbjct: 7   AAEHHHNADATDVFGFWLYIMTDCILFASLFATFLVLHHPGAVGPPLKPLIDLPYVLVET 66

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
             LL S+ +   A+      +L    + WL++T   G  F++ME+ EF HL +       
Sbjct: 67  FFLLASNFTFCLAIFGINKNKL-PAVIFWLILTFILGAGFVVMEVMEFIHLNAEGYSWHV 125

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           S   S+FF LVG HG HV  GL+W+ +++IQ+    +     RR++ L +FW+FLD++WI
Sbjct: 126 SGAASAFFTLVGTHGFHVTMGLLWILIMIIQLPILKINKNTARRMVYLGLFWNFLDIVWI 185

Query: 199 CVFSFVYLMGVV 210
            +F+ VYLMG V
Sbjct: 186 FLFTIVYLMGAV 197


>gi|323488486|ref|ZP_08093731.1| cytochrome c oxidase, subunit III [Planococcus donghaensis MPA1U2]
 gi|323397854|gb|EGA90655.1| cytochrome c oxidase, subunit III [Planococcus donghaensis MPA1U2]
          Length = 208

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 116/207 (56%), Gaps = 19/207 (9%)

Query: 18  KDKKESCVDHDGT--------YLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPID-- 67
           K   +S  DH  T        ++GFW+ L ++ + FA  F TY  L      GP+ ++  
Sbjct: 6   KYTPQSWPDHPETATLEGKNKFVGFWLLLAAETVTFASLFATYLALKDK---GPSGMEFS 62

Query: 68  ---VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTV-SWLLVTAFFGMIFIIMEI 123
              +F++  +F  T++LL SSL+  +AM     K    K + +WL +T   G+ F+ +EI
Sbjct: 63  AAGLFELPLVFAMTMILLTSSLTSVYAM--HHMKNYNFKAMQAWLAITVLLGLTFLGLEI 120

Query: 124 YEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRL 183
           YEF H + +      SAF S+FF LVG HG HV FGL W   L+++  K+GL   N  + 
Sbjct: 121 YEFNHYVHIGFGYTNSAFSSAFFTLVGTHGAHVLFGLSWFIALMLRNAKRGLNMYNAPKF 180

Query: 184 ICLSMFWHFLDLIWICVFSFVYLMGVV 210
              S++WHF+D++W+ +F+ VYLMGV+
Sbjct: 181 YLASLYWHFIDVVWVFIFTVVYLMGVI 207


>gi|16080866|ref|NP_391694.1| cytochrome aa3-600 quinol oxidase subunit III [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|221311780|ref|ZP_03593627.1| cytochrome aa3 quinol oxidase (subunit III) [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|221316105|ref|ZP_03597910.1| cytochrome aa3 quinol oxidase (subunit III) [Bacillus subtilis
           subsp. subtilis str. NCIB 3610]
 gi|221321018|ref|ZP_03602312.1| cytochrome aa3 quinol oxidase (subunit III) [Bacillus subtilis
           subsp. subtilis str. JH642]
 gi|221325302|ref|ZP_03606596.1| cytochrome aa3 quinol oxidase (subunit III) [Bacillus subtilis
           subsp. subtilis str. SMY]
 gi|321313372|ref|YP_004205659.1| cytochrome aa3-600 quinol oxidase subunit III [Bacillus subtilis
           BSn5]
 gi|464514|sp|P34958|QOX3_BACSU RecName: Full=Quinol oxidase subunit 3; AltName: Full=Oxidase
           aa(3)-600 subunit 3; AltName: Full=Quinol oxidase
           aa3-600, subunit QoxC; AltName: Full=Quinol oxidase
           polypeptide III
 gi|143398|gb|AAA22688.1| quinol oxidase [Bacillus subtilis]
 gi|413963|emb|CAA51595.1| ipa-39d qoxC [Bacillus subtilis subsp. subtilis str. 168]
 gi|2636350|emb|CAB15841.1| cytochrome aa3-600 quinol oxidase (subunit III) [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|291486406|dbj|BAI87481.1| cytochrome aa3 quinol oxidase subunit III [Bacillus subtilis subsp.
           natto BEST195]
 gi|320019646|gb|ADV94632.1| cytochrome aa3-600 quinol oxidase (subunit III) [Bacillus subtilis
           BSn5]
          Length = 204

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 106/178 (59%), Gaps = 1/178 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++F+  F T+ VL    A G  P ++F+++ + + T +LL+SS +C  A
Sbjct: 25  LGFWIFLGAEIVLFSTLFATFFVLKNRTAGGVLPDELFEVNLVMIMTFLLLISSFTCGIA 84

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
            +    +  +   V W ++T   G  F+  EI EF H +   A    SAF S FF L+G 
Sbjct: 85  -VHEMRRGSLKGVVIWTIITLLLGAGFVGCEINEFVHYVHEGAALSTSAFWSGFFVLLGT 143

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           HG HV  G+ W+  ++IQ+ K+GL      ++   S++WHFLD++WI +F+ VYLMG+
Sbjct: 144 HGTHVTIGIFWITGILIQLKKRGLTPQTSSKIFISSLYWHFLDVVWIFIFTGVYLMGL 201


>gi|56963900|ref|YP_175631.1| cytochrome aa3 quinol oxidase subunit III QoxC [Bacillus clausii
           KSM-K16]
 gi|56910143|dbj|BAD64670.1| cytochrome aa3 quinol oxidase subunit III QoxC [Bacillus clausii
           KSM-K16]
          Length = 204

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 72/201 (35%), Positives = 115/201 (57%), Gaps = 7/201 (3%)

Query: 9   SPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDV 68
           +PN  L Y   +  + +      LGFWI+L ++  +FA  F +Y VL    A      ++
Sbjct: 8   NPNEPLEYQSAEGRNNI------LGFWIFLGAEFALFATLFASYFVLVDRNAGAVPSAEL 61

Query: 69  FDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAH 128
           FD++ + + T +LL SS +C  A+      R+ ++T+ W+ +T   G+ F+  EIYEF H
Sbjct: 62  FDLNLVLIMTFLLLTSSFTCGIAIHEMRAGRM-NQTLVWIGLTLLLGLGFVGFEIYEFIH 120

Query: 129 LISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSM 188
            +   A    SA  S+FF L+G HGLHV  G+ W+ +L IQ+LK+G       +    S+
Sbjct: 121 YVHEGATLSASAHWSTFFVLLGTHGLHVSIGIGWIVLLAIQMLKRGFTPRTTSKFFIASL 180

Query: 189 FWHFLDLIWICVFSFVYLMGV 209
           +WHFLD++WI +F+ VYL+G+
Sbjct: 181 YWHFLDVVWIMIFTGVYLLGM 201


>gi|299820827|ref|ZP_07052716.1| quinol oxidase subunit III [Listeria grayi DSM 20601]
 gi|299817848|gb|EFI85083.1| quinol oxidase subunit III [Listeria grayi DSM 20601]
          Length = 202

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 74/208 (35%), Positives = 118/208 (56%), Gaps = 9/208 (4%)

Query: 4   QKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK-NYAAG 62
           + + K+ +  L Y  ++    +      +GFW +L ++  +FA  F TY V+ K    AG
Sbjct: 2   ESVKKNDDRPLEYQSEQGSLNI------IGFWTFLTAEIALFATLFATYFVMEKAGSNAG 55

Query: 63  PAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIME 122
             P ++F++  + V T +LL SS +C  A +    K  +   V ++++T   G  F+  E
Sbjct: 56  HPPSEMFELWLVLVMTFLLLTSSFTCGLA-IGEMRKGNVKMLVVYMIITLLLGAGFVGFE 114

Query: 123 IYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRR 182
           IYEF+H +      Q  ++ SSFF L+G HGLHV  GL W+  ++IQ LK+GL   N  +
Sbjct: 115 IYEFSHYVMEGVTMQVGSYWSSFFVLLGTHGLHVTIGLFWITFILIQ-LKRGLTPKNASK 173

Query: 183 LICLSMFWHFLDLIWICVFSFVYLMGVV 210
           L   S++WHFLD++WI +F+ VYL G+V
Sbjct: 174 LFITSLYWHFLDVVWIFIFTGVYLYGMV 201


>gi|194016425|ref|ZP_03055039.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus pumilus ATCC
           7061]
 gi|194011898|gb|EDW21466.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus pumilus ATCC
           7061]
          Length = 205

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 109/181 (60%), Gaps = 7/181 (3%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++F+  F TY VL    A G  P ++FD+  + + T +LL+SS +C  A
Sbjct: 25  LGFWIFLGAEIVLFSTLFATYFVLHGRTAGGVLPAELFDMKLVLIMTFLLLVSSFTCGIA 84

Query: 92  ---MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
              M   +TK +    V W ++T   G  F+  EI+EF H +   A    SA+ S+FF L
Sbjct: 85  VHEMRRGSTKGV----VIWTILTLLLGAGFVGFEIFEFFHYVHEGASIHTSAYWSAFFVL 140

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           +G HGLHV  G+ W+  ++ QI K+GL      ++   S++WHFLD++WI +F+ VYL+G
Sbjct: 141 LGTHGLHVSIGIFWITGVLFQIKKRGLTPQTASKIFISSLYWHFLDVVWIFIFTAVYLIG 200

Query: 209 V 209
           +
Sbjct: 201 L 201


>gi|258423560|ref|ZP_05686450.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           A9635]
 gi|282916310|ref|ZP_06324072.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus D139]
 gi|283770122|ref|ZP_06343014.1| quinol oxidase polypeptide III QoxC [Staphylococcus aureus subsp.
           aureus H19]
 gi|257846261|gb|EEV70285.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           A9635]
 gi|282319750|gb|EFB50098.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus D139]
 gi|283460269|gb|EFC07359.1| quinol oxidase polypeptide III QoxC [Staphylococcus aureus subsp.
           aureus H19]
          Length = 201

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 115/190 (60%), Gaps = 10/190 (5%)

Query: 27  HDG--TYLGFWIYLMSDCLMFAVFFVTYAVL--GKNYAAGPAPIDVFDISGIFVSTIVLL 82
           H+G    LGFWI++ ++  +F   F T   L  G +YA G    ++F++  + + T  LL
Sbjct: 13  HEGELNKLGFWIFITAEFALFGTLFATLLTLQHGGDYA-GKMTTELFELPLVLIMTFALL 71

Query: 83  LSSLSCSFAM--LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA 140
            SS +C  A+  +    ++L+   + W+++T   G++F+  EIYEFAH  S    P   +
Sbjct: 72  FSSYTCGIAIYYMRQEKQKLM---MFWMIITLLLGLVFVGFEIYEFAHYASEGVNPTIGS 128

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICV 200
           + SSFF L+G HG HV  G++W   L+IQI ++GL   N  +L  +S++WHFLD++W+ +
Sbjct: 129 YWSSFFILLGTHGCHVTLGIVWAICLLIQIQRRGLDKYNAPKLFIVSLYWHFLDVVWVFI 188

Query: 201 FSFVYLMGVV 210
           F+ VY++G+V
Sbjct: 189 FTAVYMIGMV 198


>gi|15924049|ref|NP_371583.1| quinol oxidase polypeptide III [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|15926645|ref|NP_374178.1| quinol oxidase polypeptide III QoxC [Staphylococcus aureus subsp.
           aureus N315]
 gi|21282671|ref|NP_645759.1| quinol oxidase polypeptide III QoxC [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49483223|ref|YP_040447.1| quinol oxidase polypeptide III [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49485898|ref|YP_043119.1| putative quinol oxidase polypeptide III [Staphylococcus aureus
           subsp. aureus MSSA476]
 gi|57650252|ref|YP_185932.1| quinol oxidase, subunit III [Staphylococcus aureus subsp. aureus
           COL]
 gi|82750669|ref|YP_416410.1| quinol oxidase polypeptide III [Staphylococcus aureus RF122]
 gi|87161041|ref|YP_493659.1| quinol oxidase, subunit III [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|88194756|ref|YP_499552.1| cytochrome c oxidase subunit III [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|148267551|ref|YP_001246494.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus JH9]
 gi|150393607|ref|YP_001316282.1| cytochrome aa3 quinol oxidase subunit III [Staphylococcus aureus
           subsp. aureus JH1]
 gi|151221140|ref|YP_001331962.1| quinol oxidase polypeptide III [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|156979382|ref|YP_001441641.1| quinol oxidase polypeptide III [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|161509243|ref|YP_001574902.1| quinol oxidase subunit III [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|221141968|ref|ZP_03566461.1| quinol oxidase subunit III [Staphylococcus aureus subsp. aureus
           str. JKD6009]
 gi|253316216|ref|ZP_04839429.1| quinol oxidase, subunit III [Staphylococcus aureus subsp. aureus
           str. CF-Marseille]
 gi|253731667|ref|ZP_04865832.1| quinol oxidase polypeptide III [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253732578|ref|ZP_04866743.1| quinol oxidase polypeptide III [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|255005846|ref|ZP_05144447.2| quinol oxidase, subunit III [Staphylococcus aureus subsp. aureus
           Mu50-omega]
 gi|257425113|ref|ZP_05601539.1| quinol oxidase polypeptide III QoxC [Staphylococcus aureus subsp.
           aureus 55/2053]
 gi|257427776|ref|ZP_05604174.1| CyoC protein [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257430410|ref|ZP_05606792.1| quinol oxidase polypeptide III QoxC [Staphylococcus aureus subsp.
           aureus 68-397]
 gi|257433113|ref|ZP_05609471.1| quinol oxidase polypeptide III QoxC [Staphylococcus aureus subsp.
           aureus E1410]
 gi|257436011|ref|ZP_05612058.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus M876]
 gi|257795209|ref|ZP_05644188.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           A9781]
 gi|258407082|ref|ZP_05680231.1| quinol oxidase polypeptide III QoxC [Staphylococcus aureus A9763]
 gi|258421826|ref|ZP_05684747.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           A9719]
 gi|258435224|ref|ZP_05688963.1| conserved hypothetical protein [Staphylococcus aureus A9299]
 gi|258443321|ref|ZP_05691664.1| quinol oxidase [Staphylococcus aureus A8115]
 gi|258446916|ref|ZP_05695069.1| quinol oxidase [Staphylococcus aureus A6300]
 gi|258449894|ref|ZP_05697992.1| cytochrome aa3 quinol oxidase subunit III [Staphylococcus aureus
           A6224]
 gi|258451992|ref|ZP_05700008.1| quinol oxidase polypeptide III QoxC [Staphylococcus aureus A5948]
 gi|258454992|ref|ZP_05702955.1| quinol oxidase polypeptide III [Staphylococcus aureus A5937]
 gi|262049397|ref|ZP_06022270.1| Quinol oxidase polypeptide III QoxC [Staphylococcus aureus D30]
 gi|262052835|ref|ZP_06025021.1| Quinol oxidase polypeptide III QoxC [Staphylococcus aureus
           930918-3]
 gi|269202670|ref|YP_003281939.1| quinol oxidase, subunit III [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282894084|ref|ZP_06302315.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           A8117]
 gi|282903608|ref|ZP_06311496.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus C160]
 gi|282905378|ref|ZP_06313233.1| cytochrome aa3 quinol oxidase subunit III [Staphylococcus aureus
           subsp. aureus Btn1260]
 gi|282908350|ref|ZP_06316181.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus WW2703/97]
 gi|282910637|ref|ZP_06318440.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus WBG10049]
 gi|282913834|ref|ZP_06321621.1| quinol oxidase, subunit 3 [Staphylococcus aureus subsp. aureus
           M899]
 gi|282918759|ref|ZP_06326494.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus C427]
 gi|282923881|ref|ZP_06331557.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus C101]
 gi|282925071|ref|ZP_06332732.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           A9765]
 gi|282927280|ref|ZP_06334902.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           A10102]
 gi|283957805|ref|ZP_06375256.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus A017934/97]
 gi|284023985|ref|ZP_06378383.1| quinol oxidase, subunit III [Staphylococcus aureus subsp. aureus
           132]
 gi|293500872|ref|ZP_06666723.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus 58-424]
 gi|293509828|ref|ZP_06668537.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus M809]
 gi|293526414|ref|ZP_06671099.1| quinol oxidase, subunit 3 [Staphylococcus aureus subsp. aureus
           M1015]
 gi|294848046|ref|ZP_06788793.1| cytochrome aa3 quinol oxidase [Staphylococcus aureus A9754]
 gi|295405863|ref|ZP_06815672.1| cytochrome aa3 quinol oxidase [Staphylococcus aureus A8819]
 gi|295427548|ref|ZP_06820180.1| cytochrome aa3 quinol oxidase [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296277097|ref|ZP_06859604.1| quinol oxidase, subunit III [Staphylococcus aureus subsp. aureus
           MR1]
 gi|297208307|ref|ZP_06924737.1| quinol oxidase subunit III [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|297245454|ref|ZP_06929325.1| cytochrome aa3 quinol oxidase [Staphylococcus aureus A8796]
 gi|297591501|ref|ZP_06950139.1| quinol oxidase subunit III [Staphylococcus aureus subsp. aureus
           MN8]
 gi|300912383|ref|ZP_07129826.1| quinol oxidase subunit III [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|304381386|ref|ZP_07364038.1| quinol oxidase subunit III [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|81694781|sp|Q5HH25|QOX3_STAAC RecName: Full=Probable quinol oxidase subunit 3; AltName:
           Full=Quinol oxidase polypeptide III
 gi|81696347|sp|Q6GAF4|QOX3_STAAS RecName: Full=Probable quinol oxidase subunit 3; AltName:
           Full=Quinol oxidase polypeptide III
 gi|81696509|sp|Q6GI25|QOX3_STAAR RecName: Full=Probable quinol oxidase subunit 3; AltName:
           Full=Quinol oxidase polypeptide III
 gi|81704531|sp|Q7A183|QOX3_STAAW RecName: Full=Probable quinol oxidase subunit 3; AltName:
           Full=Quinol oxidase polypeptide III
 gi|81705892|sp|Q7A6A0|QOX3_STAAN RecName: Full=Probable quinol oxidase subunit 3; AltName:
           Full=Quinol oxidase polypeptide III
 gi|81781805|sp|Q99V38|QOX3_STAAM RecName: Full=Probable quinol oxidase subunit 3; AltName:
           Full=Quinol oxidase polypeptide III
 gi|122539830|sp|Q2FZK1|QOX3_STAA8 RecName: Full=Probable quinol oxidase subunit 3; AltName:
           Full=Quinol oxidase polypeptide III
 gi|123486460|sp|Q2FI19|QOX3_STAA3 RecName: Full=Probable quinol oxidase subunit 3; AltName:
           Full=Quinol oxidase polypeptide III
 gi|123548915|sp|Q2YX16|QOX3_STAAB RecName: Full=Probable quinol oxidase subunit 3; AltName:
           Full=Quinol oxidase polypeptide III
 gi|13700860|dbj|BAB42156.1| Quinol oxidase polypeptide III QoxC [Staphylococcus aureus subsp.
           aureus N315]
 gi|14246829|dbj|BAB57221.1| Quinol oxidase polypeptide III [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|21204109|dbj|BAB94807.1| Quinol oxidase polypeptide III QoxC [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49241352|emb|CAG40036.1| putative quinol oxidase polypeptide III [Staphylococcus aureus
           subsp. aureus MRSA252]
 gi|49244341|emb|CAG42769.1| putative quinol oxidase polypeptide III [Staphylococcus aureus
           subsp. aureus MSSA476]
 gi|57284438|gb|AAW36532.1| quinol oxidase, subunit III [Staphylococcus aureus subsp. aureus
           COL]
 gi|82656200|emb|CAI80613.1| quinol oxidase polypeptide III [Staphylococcus aureus RF122]
 gi|87127015|gb|ABD21529.1| quinol oxidase, subunit III [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87202314|gb|ABD30124.1| cytochrome c oxidase subunit III, putative [Staphylococcus aureus
           subsp. aureus NCTC 8325]
 gi|147740620|gb|ABQ48918.1| Cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus JH9]
 gi|149946059|gb|ABR51995.1| Cytochrome aa3 quinol oxidase subunit III [Staphylococcus aureus
           subsp. aureus JH1]
 gi|150373940|dbj|BAF67200.1| quinol oxidase polypeptide III [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|156721517|dbj|BAF77934.1| Quinol oxidase polypeptide III [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|160368052|gb|ABX29023.1| quinol oxidase subunit III [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|253724666|gb|EES93395.1| quinol oxidase polypeptide III [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253729356|gb|EES98085.1| quinol oxidase polypeptide III [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257272089|gb|EEV04221.1| quinol oxidase polypeptide III QoxC [Staphylococcus aureus subsp.
           aureus 55/2053]
 gi|257274617|gb|EEV06104.1| CyoC protein [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257278538|gb|EEV09157.1| quinol oxidase polypeptide III QoxC [Staphylococcus aureus subsp.
           aureus 68-397]
 gi|257281206|gb|EEV11343.1| quinol oxidase polypeptide III QoxC [Staphylococcus aureus subsp.
           aureus E1410]
 gi|257284293|gb|EEV14413.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus M876]
 gi|257789181|gb|EEV27521.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           A9781]
 gi|257841237|gb|EEV65682.1| quinol oxidase polypeptide III QoxC [Staphylococcus aureus A9763]
 gi|257842159|gb|EEV66587.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           A9719]
 gi|257848885|gb|EEV72868.1| conserved hypothetical protein [Staphylococcus aureus A9299]
 gi|257851411|gb|EEV75350.1| quinol oxidase [Staphylococcus aureus A8115]
 gi|257854248|gb|EEV77198.1| quinol oxidase [Staphylococcus aureus A6300]
 gi|257856814|gb|EEV79717.1| cytochrome aa3 quinol oxidase subunit III [Staphylococcus aureus
           A6224]
 gi|257860207|gb|EEV83039.1| quinol oxidase polypeptide III QoxC [Staphylococcus aureus A5948]
 gi|257862872|gb|EEV85637.1| quinol oxidase polypeptide III [Staphylococcus aureus A5937]
 gi|259159283|gb|EEW44341.1| Quinol oxidase polypeptide III QoxC [Staphylococcus aureus
           930918-3]
 gi|259162506|gb|EEW47075.1| Quinol oxidase polypeptide III QoxC [Staphylococcus aureus D30]
 gi|262074960|gb|ACY10933.1| quinol oxidase, subunit III [Staphylococcus aureus subsp. aureus
           ED98]
 gi|269940555|emb|CBI48934.1| putative quinol oxidase polypeptide III [Staphylococcus aureus
           subsp. aureus TW20]
 gi|282313853|gb|EFB44245.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus C101]
 gi|282316569|gb|EFB46943.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus C427]
 gi|282321902|gb|EFB52226.1| quinol oxidase, subunit 3 [Staphylococcus aureus subsp. aureus
           M899]
 gi|282325242|gb|EFB55551.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus WBG10049]
 gi|282328015|gb|EFB58297.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus WW2703/97]
 gi|282330670|gb|EFB60184.1| cytochrome aa3 quinol oxidase subunit III [Staphylococcus aureus
           subsp. aureus Btn1260]
 gi|282590969|gb|EFB96044.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           A10102]
 gi|282592669|gb|EFB97677.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           A9765]
 gi|282595226|gb|EFC00190.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus C160]
 gi|282763570|gb|EFC03699.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           A8117]
 gi|283470270|emb|CAQ49481.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus ST398]
 gi|283789954|gb|EFC28771.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus A017934/97]
 gi|285816737|gb|ADC37224.1| quinol oxidase polypeptide III QoxC [Staphylococcus aureus
           04-02981]
 gi|290920486|gb|EFD97549.1| quinol oxidase, subunit 3 [Staphylococcus aureus subsp. aureus
           M1015]
 gi|291095877|gb|EFE26138.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus 58-424]
 gi|291467278|gb|EFF09795.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus M809]
 gi|294824846|gb|EFG41268.1| cytochrome aa3 quinol oxidase [Staphylococcus aureus A9754]
 gi|294969298|gb|EFG45318.1| cytochrome aa3 quinol oxidase [Staphylococcus aureus A8819]
 gi|295127906|gb|EFG57540.1| cytochrome aa3 quinol oxidase [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296887046|gb|EFH25949.1| quinol oxidase subunit III [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|297177757|gb|EFH37007.1| cytochrome aa3 quinol oxidase [Staphylococcus aureus A8796]
 gi|297576387|gb|EFH95103.1| quinol oxidase subunit III [Staphylococcus aureus subsp. aureus
           MN8]
 gi|298694296|gb|ADI97518.1| quinol oxidase polypeptide III [Staphylococcus aureus subsp. aureus
           ED133]
 gi|300886629|gb|EFK81831.1| quinol oxidase subunit III [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|302332669|gb|ADL22862.1| Cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus JKD6159]
 gi|302750884|gb|ADL65061.1| Cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus str. JKD6008]
 gi|304340061|gb|EFM06003.1| quinol oxidase subunit III [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|312829453|emb|CBX34295.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus ECT-R 2]
 gi|315130357|gb|EFT86344.1| quinol oxidase subunit III [Staphylococcus aureus subsp. aureus
           CGS03]
 gi|315193727|gb|EFU24122.1| quinol oxidase subunit III [Staphylococcus aureus subsp. aureus
           CGS00]
 gi|315197480|gb|EFU27816.1| quinol oxidase subunit III [Staphylococcus aureus subsp. aureus
           CGS01]
 gi|320141125|gb|EFW32972.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus MRSA131]
 gi|320143182|gb|EFW34972.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus MRSA177]
 gi|323438882|gb|EGA96618.1| quinol oxidase polypeptide III [Staphylococcus aureus O11]
 gi|323441727|gb|EGA99371.1| quinol oxidase polypeptide III [Staphylococcus aureus O46]
 gi|329313728|gb|AEB88141.1| Probable quinol oxidase subunit 3 [Staphylococcus aureus subsp.
           aureus T0131]
 gi|329727944|gb|EGG64392.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus 21189]
 gi|329728220|gb|EGG64659.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus 21172]
 gi|329729071|gb|EGG65483.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus aureus
           subsp. aureus 21193]
          Length = 201

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 115/190 (60%), Gaps = 10/190 (5%)

Query: 27  HDG--TYLGFWIYLMSDCLMFAVFFVTYAVL--GKNYAAGPAPIDVFDISGIFVSTIVLL 82
           H+G    LGFWI++ ++  +F   F T   L  G +YA G    ++F++  + + T  LL
Sbjct: 13  HEGELNKLGFWIFITAEFALFGTLFATLLTLQHGGDYA-GKMTTELFELPLVLIMTFALL 71

Query: 83  LSSLSCSFAM--LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA 140
            SS +C  A+  +    ++L+   + W+++T   G++F+  EIYEFAH  S    P   +
Sbjct: 72  FSSYTCGIAIYYMRQEKQKLM---MFWMIITLLLGLVFVGFEIYEFAHYASEGVNPTIGS 128

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICV 200
           + SSFF L+G HG HV  G++W   L+IQI ++GL   N  +L  +S++WHFLD++W+ +
Sbjct: 129 YWSSFFILLGTHGCHVSLGIVWAICLLIQIQRRGLDKYNAPKLFIVSLYWHFLDVVWVFI 188

Query: 201 FSFVYLMGVV 210
           F+ VY++G+V
Sbjct: 189 FTAVYMIGMV 198


>gi|296331457|ref|ZP_06873929.1| cytochrome aa3-600 quinol oxidase (subunit III) [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305676444|ref|YP_003868116.1| cytochrome aa3-600 quinol oxidase subunit III [Bacillus subtilis
           subsp. spizizenii str. W23]
 gi|317411864|sp|E0TW65|QOX3_BACPZ RecName: Full=Quinol oxidase subunit 3; AltName: Full=Oxidase
           aa(3)-600 subunit 3; AltName: Full=Quinol oxidase
           aa3-600, subunit qoxC; AltName: Full=Quinol oxidase
           polypeptide III
 gi|296151572|gb|EFG92449.1| cytochrome aa3-600 quinol oxidase (subunit III) [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305414688|gb|ADM39807.1| cytochrome aa3-600 quinol oxidase (subunit III) [Bacillus subtilis
           subsp. spizizenii str. W23]
          Length = 204

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 106/178 (59%), Gaps = 1/178 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++F+  F T+ VL    A G  P ++F+++ + + T +LL+SS +C  A
Sbjct: 25  LGFWIFLGAEIVLFSTLFATFFVLQNRTAGGVLPDELFEVNLVMIMTFLLLISSFTCGIA 84

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
            +    +  +   V W ++T   G  F+  EI EF H +   A    SAF S FF L+G 
Sbjct: 85  -VHEMRRGSLKGVVIWTIITLLLGAGFVGCEINEFVHYVHEGASLGTSAFWSGFFVLLGT 143

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           HG HV  G+ W+  ++IQ+ K+GL      ++   S++WHFLD++WI +F+ VYLMG+
Sbjct: 144 HGTHVTIGIFWIIGILIQLKKRGLTPQTSSKIFISSLYWHFLDVVWIFIFTGVYLMGL 201


>gi|332974366|gb|EGK11294.1| cytochrome c oxidase, subunit III [Desmospora sp. 8437]
          Length = 207

 Score =  127 bits (319), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 63/192 (32%), Positives = 111/192 (57%), Gaps = 1/192 (0%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++     +GFW++L ++  +FA     Y  L  ++  GP   ++F +  + +ST
Sbjct: 17  EPEKATLEGKNKIVGFWLFLAAESTLFATEMGAYVALKGSHLNGPPSQELFQLPMVALST 76

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           ++LL+SSL+    +++  T     K ++W  +T   G  F+ +E YEF   +        
Sbjct: 77  LILLVSSLTSVLGVMSMHTGD-ARKMLTWFGLTVLLGAAFLGLETYEFMEYVHEGHTLTG 135

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF SSF+ L+G HG HV FG++W+  LVIQ  KKG+      +    S++WHF+D++WI
Sbjct: 136 SAFASSFYLLLGTHGAHVLFGVLWILGLVIQGAKKGITVHTAPKFYLASLYWHFIDVVWI 195

Query: 199 CVFSFVYLMGVV 210
            +F+ VYLMG++
Sbjct: 196 FIFTVVYLMGMI 207


>gi|242373279|ref|ZP_04818853.1| quinol oxidase polypeptide III [Staphylococcus epidermidis
           M23864:W1]
 gi|242348989|gb|EES40591.1| quinol oxidase polypeptide III [Staphylococcus epidermidis
           M23864:W1]
          Length = 201

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 114/197 (57%), Gaps = 6/197 (3%)

Query: 18  KDKKESCVDHDG--TYLGFWIYLMSDCLMFAVFFVTYAVL--GKNYAAGPAPIDVFDISG 73
             K      H+G    LGFWI+L ++  +F   F T   L  G +YA      ++F++  
Sbjct: 4   DTKTIDSRSHEGELNKLGFWIFLTAEFALFGTLFATLLTLQHGGDYAH-KMTTELFELPL 62

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           + + T  LLLSS +C  A+     ++  +  + W+++T   G++F+  EIYEFAH     
Sbjct: 63  VLIMTFSLLLSSYTCGIAIYYMRKEKQ-NLMMIWMIITVLLGLVFVGFEIYEFAHYAQEG 121

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
             P   +F SSFF L+G HG HV  G++W+  L+IQI  +GL S N  +L  +S++WHFL
Sbjct: 122 VNPTIGSFWSSFFILLGTHGCHVSVGIVWIICLLIQIGTRGLDSYNAPKLFIVSLYWHFL 181

Query: 194 DLIWICVFSFVYLMGVV 210
           D++WI +F+ VY++G+V
Sbjct: 182 DVVWIFIFTAVYMIGMV 198


>gi|213649242|ref|ZP_03379295.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhi str. J185]
          Length = 94

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 60/91 (65%), Positives = 73/91 (80%)

Query: 118 FIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLIS 177
           FI MEIYEF HLI     P RS FLS+FFALVG HGLHV  GLIW+ VL++Q+ ++GL S
Sbjct: 2   FIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQVARRGLTS 61

Query: 178 GNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
            N+ R++CLS+FWHFLD+IWICVF+ VYLMG
Sbjct: 62  TNRTRIMCLSLFWHFLDVIWICVFTVVYLMG 92


>gi|223043901|ref|ZP_03613943.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus capitis
           SK14]
 gi|314933255|ref|ZP_07840620.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus caprae
           C87]
 gi|222442805|gb|EEE48908.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus capitis
           SK14]
 gi|313653405|gb|EFS17162.1| cytochrome aa3 quinol oxidase, subunit III [Staphylococcus caprae
           C87]
          Length = 201

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 71/189 (37%), Positives = 113/189 (59%), Gaps = 6/189 (3%)

Query: 26  DHDG--TYLGFWIYLMSDCLMFAVFFVTYAVL--GKNYAAGPAPIDVFDISGIFVSTIVL 81
            H+G    LGFWI+L ++  +F   F T   L  G +YA      ++F++  + + T  L
Sbjct: 12  SHEGELNKLGFWIFLTAEFALFGTLFATLLTLQHGGDYAH-KMTTELFELPLVLIMTFSL 70

Query: 82  LLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAF 141
           LLSS +C  A+     ++  +  + W+++T   G++F+  EIYEFAH       P   +F
Sbjct: 71  LLSSYTCGIAIYYMRKEKQ-NLMMIWMIITVLLGLVFVGFEIYEFAHYAQEGVNPTIGSF 129

Query: 142 LSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVF 201
            SSFF L+G HG HV  G++W+  L+IQI  +GL S N  +L  +S++WHFLD++WI +F
Sbjct: 130 WSSFFILLGTHGCHVSVGIVWIICLLIQIGTRGLDSYNAPKLFIVSLYWHFLDVVWIFIF 189

Query: 202 SFVYLMGVV 210
           + VY++G+V
Sbjct: 190 TAVYMIGMV 198


>gi|157694210|ref|YP_001488672.1| cytochrome aa3 quinol oxidase subunit III [Bacillus pumilus
           SAFR-032]
 gi|157682968|gb|ABV64112.1| cytochrome aa3 quinol oxidase subunit III [Bacillus pumilus
           SAFR-032]
          Length = 205

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 109/181 (60%), Gaps = 7/181 (3%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++F+  F TY VL    A G  P ++FD+  + + T +LL+SS +C  A
Sbjct: 25  LGFWIFLGAEIVLFSTLFATYFVLHGRTAGGVLPAELFDMKLVLIMTFLLLVSSFTCGIA 84

Query: 92  ---MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
              M   +TK +    V W ++T   G  F+  E++EF H +   A    SA+ S+FF L
Sbjct: 85  VHEMRRGSTKGV----VIWTILTLLLGAGFVGFELFEFFHYVHEGASIHTSAYWSAFFVL 140

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           +G HGLHV  G+ W+  ++ QI K+GL      ++   S++WHFLD++WI +F+ VYL+G
Sbjct: 141 LGTHGLHVSIGIFWITGVLFQIKKRGLTPQTASKIFISSLYWHFLDVVWIFIFTAVYLIG 200

Query: 209 V 209
           +
Sbjct: 201 L 201


>gi|321315253|ref|YP_004207540.1| cytochrome c oxidase subunit III [Bacillus subtilis BSn5]
 gi|320021527|gb|ADV96513.1| cytochrome c oxidase, subunit III [Bacillus subtilis BSn5]
          Length = 207

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 112/193 (58%), Gaps = 2/193 (1%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
             ++  ++    +LGFW++L  + ++FA  F T+  L  + A+ P   ++FD++ +F++T
Sbjct: 15  SPEKVTLEGKNKFLGFWLFLGGETVLFASLFATFLALRNSNASDPPTTEMFDVTLVFIAT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP-Q 137
           ++LL SSL+  +AM          K   WL +T   G  F+ +EIYEF H          
Sbjct: 75  MLLLTSSLTSVYAMYHMKNFSF-GKMQLWLGITILLGAGFLGLEIYEFKHYTHEFGFTIT 133

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
            SA  S+F+ LVG HG HV FGL+W+  L+I+  K+GL      +    S++WHF+D++W
Sbjct: 134 SSALGSAFYTLVGTHGAHVAFGLMWISTLMIRNAKRGLNLYTAPKFYVASLYWHFIDVVW 193

Query: 198 ICVFSFVYLMGVV 210
           + +F+ VYLMG+V
Sbjct: 194 VFIFTVVYLMGMV 206


>gi|23099710|ref|NP_693176.1| cytochrome aa3 quinol oxidase subunit III [Oceanobacillus iheyensis
           HTE831]
 gi|22777940|dbj|BAC14211.1| cytochrome aa3 quinol oxidase subunit III [Oceanobacillus iheyensis
           HTE831]
          Length = 199

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 68/189 (35%), Positives = 113/189 (59%), Gaps = 2/189 (1%)

Query: 23  SCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVL-GKNYAAGPAPIDVFDISGIFVSTIVL 81
           S   +    LGFWI+L ++ ++FA  F +Y +  G+   +GP+  ++F+I  + ++T++L
Sbjct: 12  STEQNKMNILGFWIFLGAEIMLFATLFTSYFIYEGRGVGSGPSSAEIFEIGPVIINTMIL 71

Query: 82  LLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAF 141
           L SS +   A+ A   +R     + +L+VT   G  F+ +EIYEF H   + A  Q S F
Sbjct: 72  LTSSFTIGLAIHAMRIQR-TKAMIGFLIVTLVLGAAFVSVEIYEFIHFYHIGATLQTSGF 130

Query: 142 LSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVF 201
            ++ F  +  HG HV FGL W  +++IQ++K GL +    +    S++WHFLD++WI +F
Sbjct: 131 TATLFTTLATHGAHVTFGLFWGTMIIIQLVKHGLTAQTANKSFIFSLYWHFLDVMWIFIF 190

Query: 202 SFVYLMGVV 210
           SFVYL G++
Sbjct: 191 SFVYLKGMM 199


>gi|16078555|ref|NP_389374.1| cytochrome caa3 oxidase subunit III [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221309361|ref|ZP_03591208.1| cytochrome caa3 oxidase (subunit III) [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221313688|ref|ZP_03595493.1| cytochrome caa3 oxidase (subunit III) [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221318610|ref|ZP_03599904.1| cytochrome caa3 oxidase (subunit III) [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221322884|ref|ZP_03604178.1| cytochrome caa3 oxidase (subunit III) [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|7404348|sp|P24012|COX3_BACSU RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Caa-3605 subunit 3; AltName: Full=Cytochrome aa3
           subunit 3; AltName: Full=Cytochrome c oxidase
           polypeptide III; AltName: Full=Oxidase aa(3) subunit 3
 gi|2339994|emb|CAB11344.1| cytochrome c oxidase subunit III, aa3 type [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|2633862|emb|CAB13364.1| cytochrome caa3 oxidase (subunit III) [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|291484040|dbj|BAI85115.1| cytochrome caa3 oxidase subunit III [Bacillus subtilis subsp. natto
           BEST195]
          Length = 207

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 111/193 (57%), Gaps = 2/193 (1%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
             ++  ++    +LGFW++L  + ++FA  F T+  L  + A  P   ++FD++ +F++T
Sbjct: 15  SPEKVTLEGKNKFLGFWLFLGGETVLFASLFATFLALRNSNAGDPPTTEMFDVTLVFIAT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP-Q 137
           ++LL SSL+  +AM          K   WL +T   G  F+ +EIYEF H          
Sbjct: 75  MLLLTSSLTSVYAMYHMKNFSF-GKMQLWLGITILLGAGFLGLEIYEFKHYTHEFGFTIT 133

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
            SA  S+F+ LVG HG HV FGL+W+  L+I+  K+GL      +    S++WHF+D++W
Sbjct: 134 SSALGSAFYTLVGTHGAHVAFGLMWISTLMIRNAKRGLNLYTAPKFYVASLYWHFIDVVW 193

Query: 198 ICVFSFVYLMGVV 210
           + +F+ VYLMG+V
Sbjct: 194 VFIFTVVYLMGMV 206


>gi|296331066|ref|ZP_06873540.1| cytochrome c oxidase, subunit III [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305674221|ref|YP_003865893.1| cytochrome c oxidase, subunit III [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296151710|gb|EFG92585.1| cytochrome c oxidase, subunit III [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305412465|gb|ADM37584.1| cytochrome c oxidase, subunit III [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 207

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 111/193 (57%), Gaps = 2/193 (1%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
             ++  ++    +LGFW++L  + ++FA  F T+  L  + A  P   ++FD++ +F++T
Sbjct: 15  SPEKVTLEGKNKFLGFWLFLGGETVLFASLFATFLALRNSNAGDPPTTEMFDVTLVFIAT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP-Q 137
           ++LL SSL+  +AM          K   WL +T   G  F+ +EIYEF H          
Sbjct: 75  MLLLTSSLTSVYAMYHMKNFSF-GKMQLWLGITILLGAGFLGLEIYEFKHYTHEFGFTIT 133

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
            SA  S+F+ LVG HG HV FGL+W+  L+I+  K+GL      +    S++WHF+D++W
Sbjct: 134 SSALGSAFYTLVGTHGAHVAFGLMWISTLMIRNAKRGLNLYTAPKFYVASLYWHFIDVVW 193

Query: 198 ICVFSFVYLMGVV 210
           + +F+ VYLMG+V
Sbjct: 194 VFIFTVVYLMGMV 206


>gi|312438566|gb|ADQ77637.1| quinol oxidase subunit III [Staphylococcus aureus subsp. aureus
           TCH60]
          Length = 201

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 114/190 (60%), Gaps = 10/190 (5%)

Query: 27  HDG--TYLGFWIYLMSDCLMFAVFFVTYAVL--GKNYAAGPAPIDVFDISGIFVSTIVLL 82
           H+G    LGFWI++ ++  +F   F T   L  G +YA G    ++F++  + + T  LL
Sbjct: 13  HEGELNKLGFWIFITAEFALFGTLFATLLTLQHGGDYA-GKMTTELFELPLVLIMTFALL 71

Query: 83  LSSLSCSFAM--LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA 140
            SS +C  A+  +    ++L+   + W+++T   G++F+  EIYEFAH  S    P   +
Sbjct: 72  FSSYTCGIAIYYMRQEKQKLM---MFWMIITLLLGLVFVGFEIYEFAHYASEGVNPTIGS 128

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICV 200
           + SSFF L+G HG HV  G++W   L+IQI + GL   N  +L  +S++WHFLD++W+ +
Sbjct: 129 YWSSFFILLGTHGCHVSLGIVWAICLLIQIQRHGLDKYNAPKLFIVSLYWHFLDVVWVFI 188

Query: 201 FSFVYLMGVV 210
           F+ VY++G+V
Sbjct: 189 FTAVYMIGMV 198


>gi|311070326|ref|YP_003975249.1| cytochrome aa3-600 quinol oxidase subunit III [Bacillus atrophaeus
           1942]
 gi|310870843|gb|ADP34318.1| cytochrome aa3-600 quinol oxidase subunit III [Bacillus atrophaeus
           1942]
          Length = 204

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/178 (36%), Positives = 106/178 (59%), Gaps = 1/178 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++F+  F T+ VL    A G  P ++F+++ + + T +LL+SS +C  A
Sbjct: 25  LGFWIFLGAEIVLFSTLFATFFVLQNRTAGGVLPEELFEVNLVMIMTFLLLISSFTCGIA 84

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +     +  +   V W ++T   G  F+  EI EF H +   A    SAF S FF L+G 
Sbjct: 85  V-HEMRRGSLKGVVIWTIITLLLGAGFVGCEINEFVHYVHEGASLGTSAFWSGFFVLLGT 143

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           HG HV  G+ W+  +++Q+ K+GL      ++   S++WHFLD++WI +F+ VYLMG+
Sbjct: 144 HGTHVTIGIFWIAGILLQLKKRGLTPQTSSKIFISSLYWHFLDVVWIFIFTGVYLMGL 201


>gi|229541233|ref|ZP_04430293.1| Cytochrome-c oxidase [Bacillus coagulans 36D1]
 gi|229325653|gb|EEN91328.1| Cytochrome-c oxidase [Bacillus coagulans 36D1]
          Length = 208

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 68/198 (34%), Positives = 115/198 (58%), Gaps = 9/198 (4%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI----DVFDISG 73
           +  + + ++    +LGFW++L  + ++FA  F TY  L      GPA +    D+F++  
Sbjct: 14  ESPERATLEGRNKFLGFWLFLGGETVLFASLFATYLALKDK---GPASMVHAKDLFELPL 70

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS-M 132
            F++T+ LL SS++  +A+          K  +W L+T   G  F+ +E+YEF H ++  
Sbjct: 71  TFLATVFLLTSSITSVYAIY-HMKNFAFKKMQAWFLITVLLGACFLGLEVYEFHHYVTEY 129

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                 SAF S+F+ LVG HG HV FGL+W+  L+++  K+GL   N  +    S++WHF
Sbjct: 130 HHTFTSSAFGSAFYTLVGFHGGHVAFGLLWITTLMVRNAKRGLNLYNAPKFYVASLYWHF 189

Query: 193 LDLIWICVFSFVYLMGVV 210
           +D++W+ +F+ VYLMG+V
Sbjct: 190 IDVVWVFIFTVVYLMGMV 207


>gi|224476169|ref|YP_002633775.1| putative quinol oxidase polypeptide III [Staphylococcus carnosus
           subsp. carnosus TM300]
 gi|222420776|emb|CAL27590.1| putative quinol oxidase polypeptide III [Staphylococcus carnosus
           subsp. carnosus TM300]
          Length = 200

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 66/191 (34%), Positives = 116/191 (60%), Gaps = 10/191 (5%)

Query: 26  DHDGTY--LGFWIYLMSDCLMFAVFFVTYAVL--GKNYAAGPAPIDVFDISGIFVSTIVL 81
            H+G     GFWI+L ++  +F   F T  ++    +YA      D+F++  + + T  L
Sbjct: 11  SHEGNLNKFGFWIFLTAEFSLFGTLFATLLIMQHAGDYAH-KLTTDLFELPLVLLMTFAL 69

Query: 82  LLSSLSCSFAM--LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS 139
           L+SS +C  A+  +    ++L+   + W+++T   G +F+ +EI+EFAH +S    PQ  
Sbjct: 70  LISSYTCGIAIYYMRQEKQKLM---MIWMIITVALGAVFVGLEIFEFAHYVSEGVTPQIG 126

Query: 140 AFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWIC 199
           ++ SSFF L+G HG HV  G++W+  L+IQ+  +GL   N  +L  +S++WHFLD++W+ 
Sbjct: 127 SYWSSFFILLGTHGAHVSLGIVWIICLLIQVATRGLNEHNAPKLFIVSLYWHFLDVVWVF 186

Query: 200 VFSFVYLMGVV 210
           +F+ VY++G+V
Sbjct: 187 IFTAVYMIGMV 197


>gi|319654011|ref|ZP_08008104.1| cytochrome c oxidase subunit III [Bacillus sp. 2_A_57_CT2]
 gi|317394333|gb|EFV75078.1| cytochrome c oxidase subunit III [Bacillus sp. 2_A_57_CT2]
          Length = 208

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 67/194 (34%), Positives = 110/194 (56%), Gaps = 3/194 (1%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI--DVFDISGIFV 76
             + + ++    +LGFW +L  + ++FA  F TY  L      G  P+  ++F +  +FV
Sbjct: 15  SPERATLEAKNKFLGFWFFLGGETVLFASLFATYLALKNKVPNGDHPLTNELFSMEIVFV 74

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
           +T++LL+SSL+   AM          K   WL +T   G+ F+ +EIYEF          
Sbjct: 75  ATMLLLVSSLTSVCAMYHMKNFNF-KKMQLWLGITVLLGVAFLGLEIYEFTEYFHKGHTF 133

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
             SAF S+F+ LVG HG HV FGL+W+  L+++  ++GL   N  +    S++WHF+D++
Sbjct: 134 TSSAFGSAFYVLVGFHGAHVAFGLLWIVTLMVRNARRGLNLYNAPKFYVASLYWHFIDVV 193

Query: 197 WICVFSFVYLMGVV 210
           W+ +F+ VYLMG++
Sbjct: 194 WVFIFTVVYLMGMI 207


>gi|73663041|ref|YP_301822.1| quinol oxidase polypeptide III [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|123642235|sp|Q49WI2|QOX3_STAS1 RecName: Full=Probable quinol oxidase subunit 3; AltName:
           Full=Quinol oxidase polypeptide III
 gi|72495556|dbj|BAE18877.1| quinol oxidase polypeptide III [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 201

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 68/191 (35%), Positives = 115/191 (60%), Gaps = 10/191 (5%)

Query: 26  DHDGTY--LGFWIYLMSDCLMFAVFFVTYAVL--GKNYAAGPAPIDVFDISGIFVSTIVL 81
            H+G    LGFW++L ++  +F   F T   L  G +YA G    ++F++  + + T  L
Sbjct: 12  SHEGNLNKLGFWVFLTAEFSLFGTLFATLLTLQHGGDYA-GKMTTELFELPLVLIMTFAL 70

Query: 82  LLSSLSCSFAM--LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS 139
           L+SS +C  A+  +    ++L+   + W+++T   GM+F+  EIYEFAH +         
Sbjct: 71  LISSYTCGIAIYYMRKEKEKLM---LIWMIITVLLGMVFVGFEIYEFAHYVHEGVNLTIG 127

Query: 140 AFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWIC 199
           ++ SSFF L+G HG HV  G++W+  L+IQ+  +GL   N  +L  +S++WHFLD++WI 
Sbjct: 128 SYWSSFFILLGTHGAHVSLGIVWIICLLIQVAMRGLNKDNAPKLFIVSLYWHFLDVVWIF 187

Query: 200 VFSFVYLMGVV 210
           +F+ VY++G+V
Sbjct: 188 IFTAVYMIGMV 198


>gi|39871|emb|CAA38078.1| cytochrome-c oxidase subunit III [Bacillus subtilis]
          Length = 207

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 67/193 (34%), Positives = 110/193 (56%), Gaps = 2/193 (1%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
             ++  ++    +LGFW++L  + ++FA  F T+     + A  P   ++FD++ +F++T
Sbjct: 15  SPEKVTLEGKNNFLGFWLFLGGETVLFASLFATFLAASNSNAGDPPTTEMFDVTLVFIAT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP-Q 137
           ++LL SSL+  +AM          K   WL +T   G  F+ +EIYEF H          
Sbjct: 75  MLLLTSSLTSVYAMYHMKNFSF-GKMQLWLGITILLGAGFLGLEIYEFKHYTHEFGFTIT 133

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
            SA  S+F+ LVG HG HV FGL+W+  L+I+  K+GL      +    S++WHF+D++W
Sbjct: 134 SSALGSAFYTLVGTHGAHVAFGLMWISTLMIRNAKRGLNLYTAPKFYVASLYWHFIDVVW 193

Query: 198 ICVFSFVYLMGVV 210
           + +F+ VYLMG+V
Sbjct: 194 VFIFTVVYLMGMV 206


>gi|15614629|ref|NP_242932.1| cytochrome aa3 quinol oxidase subunit III [Bacillus halodurans
           C-125]
 gi|10174685|dbj|BAB05785.1| cytochrome aa3 quinol oxidase subunit III [Bacillus halodurans
           C-125]
          Length = 204

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 73/201 (36%), Positives = 113/201 (56%), Gaps = 7/201 (3%)

Query: 9   SPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDV 68
           +PN  L Y   +  + +      LGFWI+L ++  +FA  F +Y VL    A      D+
Sbjct: 8   NPNQPLEYQSAEGRNNI------LGFWIFLGAEFALFATLFASYFVLVDRNADAVRAADL 61

Query: 69  FDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAH 128
           FD++ + + T +LL SS +C  A+      R+ ++   W+ +T   G+ F+  EIYEF H
Sbjct: 62  FDLNLVLIMTFLLLTSSFTCGLAIHEMRAGRM-NRMFVWIGLTLLLGLGFVGFEIYEFVH 120

Query: 129 LISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSM 188
                A    SA  S+FF L+G HGLHV  G+ W+ +LVIQ+ K+GL      +    S+
Sbjct: 121 YAHEGATLSASAHWSAFFLLLGTHGLHVSIGIGWIVLLVIQMKKRGLTPRTTSKFFIASL 180

Query: 189 FWHFLDLIWICVFSFVYLMGV 209
           +WHFLD++WI +F+ VYL+G+
Sbjct: 181 YWHFLDVVWIMIFTGVYLLGM 201


>gi|295695108|ref|YP_003588346.1| Cytochrome-c oxidase [Bacillus tusciae DSM 2912]
 gi|295410710|gb|ADG05202.1| Cytochrome-c oxidase [Bacillus tusciae DSM 2912]
          Length = 213

 Score =  125 bits (314), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 65/192 (33%), Positives = 110/192 (57%), Gaps = 1/192 (0%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
             + + ++     LGFW++L  +C +FA  F TY  L      GP   ++F +  I ++T
Sbjct: 20  GPETATLEGKNKVLGFWVFLGGECALFASLFATYLTLRGQTLNGPTAQELFHLPIIGLAT 79

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           I+LL SSL+    + A     L    + WL VT   G+ F+ +++ EF        V   
Sbjct: 80  ILLLTSSLTGVLGINAMHRGNL-RSLLRWLGVTVLLGLGFLAVQVVEFITYAGEGFVFGT 138

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF S+FF LVG HG HV FG++W+ +L++Q+ ++G+      ++   S++WHF+D++W+
Sbjct: 139 SAFSSAFFTLVGFHGGHVAFGVVWISILILQLKREGITPRKAPKVFIASLYWHFVDVVWV 198

Query: 199 CVFSFVYLMGVV 210
            +F+ VYLMG++
Sbjct: 199 FIFTVVYLMGIL 210


>gi|228992678|ref|ZP_04152604.1| Cytochrome c oxidase subunit 3 [Bacillus pseudomycoides DSM 12442]
 gi|228998722|ref|ZP_04158309.1| Cytochrome c oxidase subunit 3 [Bacillus mycoides Rock3-17]
 gi|229006224|ref|ZP_04163910.1| Cytochrome c oxidase subunit 3 [Bacillus mycoides Rock1-4]
 gi|228755065|gb|EEM04424.1| Cytochrome c oxidase subunit 3 [Bacillus mycoides Rock1-4]
 gi|228761190|gb|EEM10149.1| Cytochrome c oxidase subunit 3 [Bacillus mycoides Rock3-17]
 gi|228767010|gb|EEM15647.1| Cytochrome c oxidase subunit 3 [Bacillus pseudomycoides DSM 12442]
          Length = 207

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 69/194 (35%), Positives = 114/194 (58%), Gaps = 4/194 (2%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++    ++GFW++L  + ++FA  F TY  L  +   GP   ++F +  +F+ T
Sbjct: 15  EPEKATLEGKNKFVGFWLFLGGETVLFASLFGTYLALKNSTNGGPTSQEMFQMPLVFIMT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMI-FIIMEIYEFAHLI-SMEAVP 136
           ++LL SSL+  +AM     K    K +   L+      + F+  EIYEF H     +   
Sbjct: 75  MLLLTSSLTSVYAMYH--MKNFNFKQMQLWLLVTVLLGLGFLGFEIYEFYHYTHEFKHTM 132

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
           + SAF S+F+ALVG HGLHV FGL+W+  LV +  K+GL   N  +    S++WHF+D++
Sbjct: 133 RSSAFGSAFYALVGTHGLHVLFGLLWILTLVFRNAKRGLNLYNAPKFYVASIYWHFIDVV 192

Query: 197 WICVFSFVYLMGVV 210
           W+ +F+ VYLMG+V
Sbjct: 193 WVFIFTVVYLMGMV 206


>gi|229174609|ref|ZP_04302138.1| Cytochrome c oxidase subunit 3 [Bacillus cereus MM3]
 gi|228608861|gb|EEK66154.1| Cytochrome c oxidase subunit 3 [Bacillus cereus MM3]
          Length = 207

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 115/193 (59%), Gaps = 2/193 (1%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++    ++GFW++L  + ++FA  F TY  L  +   GP   ++F +  +F+ T
Sbjct: 15  EPEKATLEGKNKFVGFWLFLGGETVLFASLFGTYLALKNSTNGGPTSQEMFQMPLVFIMT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI-SMEAVPQ 137
           ++LL SSL+  +AM          K   WLLVT   G+ F+  EIYEF H     +   +
Sbjct: 75  MLLLTSSLTSVYAMYHMKNFNF-KKMQLWLLVTVLLGLGFLAFEIYEFYHYTHEFKHTMR 133

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
            SAF S+F+ALVG HGLHV FGL W+  L+ +  K+GL   N  +    S++WHF+D++W
Sbjct: 134 SSAFGSAFYALVGTHGLHVLFGLCWILTLIFRNAKRGLNLYNAPKFYVASIYWHFIDVVW 193

Query: 198 ICVFSFVYLMGVV 210
           + +F+ VYLMG+V
Sbjct: 194 VFIFTVVYLMGMV 206


>gi|254721544|ref|ZP_05183333.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A1055]
          Length = 207

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 116/193 (60%), Gaps = 2/193 (1%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++ +  ++GFW++L  + ++FA  F TY  L  +   GP   ++F +  +F+ T
Sbjct: 15  EPEKATLEGENKFVGFWLFLGGETVLFASLFGTYLALKNSTNGGPTSQEMFQMPLVFIMT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI-SMEAVPQ 137
           ++LL SSL+  +AM          K   WLLVT   G+ F+  EIYEF H     +   +
Sbjct: 75  MLLLTSSLTSVYAMYHMKNFNF-KKMQLWLLVTVLLGLGFLGFEIYEFYHYAHEFKHTMR 133

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
            SAF S+F+ALVG HGLHV FGL W+  L+ +  K+GL   N  +    S++WHF+D++W
Sbjct: 134 SSAFGSAFYALVGTHGLHVLFGLCWILTLIFRNAKRGLNLYNAPKFYVASIYWHFIDVVW 193

Query: 198 ICVFSFVYLMGVV 210
           + +F+ VYLMG+V
Sbjct: 194 VFIFTVVYLMGMV 206


>gi|294499884|ref|YP_003563584.1| cytochrome aa3 quinol oxidase subunit III [Bacillus megaterium QM
           B1551]
 gi|295705269|ref|YP_003598344.1| cytochrome aa3 quinol oxidase subunit III [Bacillus megaterium DSM
           319]
 gi|294349821|gb|ADE70150.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus megaterium QM
           B1551]
 gi|294802928|gb|ADF39994.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus megaterium DSM
           319]
          Length = 202

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 66/180 (36%), Positives = 103/180 (57%), Gaps = 2/180 (1%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++  +F+  FVTY       A GP   ++F +    + T++LL SS +   A
Sbjct: 23  LGFWIFLGAEIALFSTLFVTYLTYHTRTAGGPTAEELFVVKDFMIETLLLLFSSFTMGIA 82

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEF-AHLISMEAVPQRSAFLSSFFALVG 150
           +       L    + W ++T   G  F+  EI EF  + +   A  Q SAFLS FF L+G
Sbjct: 83  IFKMRNNDL-KGLLVWFVITLVLGGGFLFYEIREFYMYAVHEGATMQTSAFLSGFFTLLG 141

Query: 151 LHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
            HGLHV  G+ W   ++IQ++++GL     R++  + ++WHFLD++WI +F+ VYL G+V
Sbjct: 142 THGLHVTVGVFWAISIIIQLVRRGLTPVTARKVFIIGLYWHFLDVVWIFIFTLVYLNGLV 201


>gi|67641798|ref|ZP_00440565.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia mallei
           GB8 horse 4]
 gi|121599554|ref|YP_993719.1| cytochrome o ubiquinol oxidase subunit 3 [Burkholderia mallei
           SAVP1]
 gi|124386320|ref|YP_001028823.1| ubiquinol oxidase, subunit III [Burkholderia mallei NCTC 10229]
 gi|126449262|ref|YP_001081266.1| cytochrome o ubiquinol oxidase subunit 3 [Burkholderia mallei NCTC
           10247]
 gi|167001102|ref|ZP_02266903.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia mallei
           PRL-20]
 gi|121228364|gb|ABM50882.1| CytOchrome o ubiquinol oxidase subunit 3 [Burkholderia mallei
           SAVP1]
 gi|124294340|gb|ABN03609.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia mallei
           NCTC 10229]
 gi|126242132|gb|ABO05225.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia mallei
           NCTC 10247]
 gi|238522786|gb|EEP86228.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia mallei
           GB8 horse 4]
 gi|243063054|gb|EES45240.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia mallei
           PRL-20]
          Length = 102

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 60/97 (61%), Positives = 74/97 (76%), Gaps = 1/97 (1%)

Query: 115 GMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKK- 173
           G  F+ ME+ EF+HL++  A PQRSAFLSSFF LVG HGLHV  GL+W+ VLV Q L++ 
Sbjct: 6   GAAFLAMELREFSHLVAEGAGPQRSAFLSSFFTLVGTHGLHVTAGLVWMAVLVAQALRRP 65

Query: 174 GLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
            L   + RRL CLS+FWHFLD++WICVFSFVYL  V+
Sbjct: 66  DLTERDIRRLTCLSLFWHFLDIVWICVFSFVYLASVI 102


>gi|308175542|ref|YP_003922247.1| cytochrome aa3-600 quinol oxidase subunit III [Bacillus
           amyloliquefaciens DSM 7]
 gi|307608406|emb|CBI44777.1| cytochrome aa3-600 quinol oxidase (subunit III) [Bacillus
           amyloliquefaciens DSM 7]
 gi|328555520|gb|AEB26012.1| cytochrome aa3-600 quinol oxidase (subunit III) [Bacillus
           amyloliquefaciens TA208]
 gi|328913892|gb|AEB65488.1| cytochrome aa3-600 quinol oxidase (subunit III) [Bacillus
           amyloliquefaciens LL3]
          Length = 204

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 106/178 (59%), Gaps = 1/178 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++F+  F T+ VL +  A G  P ++F++  + + T +LL+SS +C  A
Sbjct: 25  LGFWIFLGAEIVLFSTLFATFFVLQRRTAGGVLPAELFEVKLVMIMTFLLLISSFTCGIA 84

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +     +  +   V W ++T   G  F+  E+ EF H +   A    SAF S FF L+G 
Sbjct: 85  V-HEMRRGSLKGVVIWTIITLLLGAGFVGCELNEFIHYVHEGASLGTSAFWSGFFVLLGT 143

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           HG HV  G+ W+  +++Q+ K+GL      ++   S++WHFLD++WI +F+ VYL+G+
Sbjct: 144 HGTHVTIGIFWITGILLQLKKRGLTPQTSSKIFISSLYWHFLDVVWIFIFTGVYLIGL 201


>gi|42783037|ref|NP_980284.1| cytochrome c oxidase, subunit III [Bacillus cereus ATCC 10987]
 gi|47565817|ref|ZP_00236856.1| cytochrome c oxidase subunit III [Bacillus cereus G9241]
 gi|52141547|ref|YP_085283.1| cytochrome c oxidase, subunit III [Bacillus cereus E33L]
 gi|75762088|ref|ZP_00741994.1| Cytochrome c oxidase polypeptide III [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|163941681|ref|YP_001646565.1| cytochrome c oxidase subunit III [Bacillus weihenstephanensis
           KBAB4]
 gi|206971235|ref|ZP_03232186.1| cytochrome c oxidase, subunit III [Bacillus cereus AH1134]
 gi|206978408|ref|ZP_03239278.1| cytochrome c oxidase, subunit III [Bacillus cereus H3081.97]
 gi|217961427|ref|YP_002339995.1| cytochrome c oxidase, subunit III [Bacillus cereus AH187]
 gi|218235434|ref|YP_002368742.1| cytochrome c oxidase, subunit III [Bacillus cereus B4264]
 gi|218899098|ref|YP_002447509.1| cytochrome c oxidase, subunit III [Bacillus cereus G9842]
 gi|222097390|ref|YP_002531447.1| cytochrome c oxidase, subunit iii [Bacillus cereus Q1]
 gi|228902448|ref|ZP_04066602.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis IBL 4222]
 gi|228909768|ref|ZP_04073591.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis IBL 200]
 gi|228922693|ref|ZP_04085992.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228954218|ref|ZP_04116246.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228960203|ref|ZP_04121860.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228966963|ref|ZP_04128001.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228974035|ref|ZP_04134608.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228980627|ref|ZP_04140935.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis Bt407]
 gi|228987085|ref|ZP_04147210.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229013147|ref|ZP_04170291.1| Cytochrome c oxidase subunit 3 [Bacillus mycoides DSM 2048]
 gi|229019144|ref|ZP_04175978.1| Cytochrome c oxidase subunit 3 [Bacillus cereus AH1273]
 gi|229031572|ref|ZP_04187572.1| Cytochrome c oxidase subunit 3 [Bacillus cereus AH1271]
 gi|229047627|ref|ZP_04193216.1| Cytochrome c oxidase subunit 3 [Bacillus cereus AH676]
 gi|229071441|ref|ZP_04204663.1| Cytochrome c oxidase subunit 3 [Bacillus cereus F65185]
 gi|229075698|ref|ZP_04208680.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock4-18]
 gi|229081194|ref|ZP_04213704.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock4-2]
 gi|229098412|ref|ZP_04229357.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock3-29]
 gi|229104504|ref|ZP_04235171.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock3-28]
 gi|229111412|ref|ZP_04240964.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock1-15]
 gi|229117438|ref|ZP_04246814.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock1-3]
 gi|229129219|ref|ZP_04258192.1| Cytochrome c oxidase subunit 3 [Bacillus cereus BDRD-Cer4]
 gi|229134750|ref|ZP_04263559.1| Cytochrome c oxidase subunit 3 [Bacillus cereus BDRD-ST196]
 gi|229140670|ref|ZP_04269218.1| Cytochrome c oxidase subunit 3 [Bacillus cereus BDRD-ST26]
 gi|229146513|ref|ZP_04274884.1| Cytochrome c oxidase subunit 3 [Bacillus cereus BDRD-ST24]
 gi|229152140|ref|ZP_04280334.1| Cytochrome c oxidase subunit 3 [Bacillus cereus m1550]
 gi|229157519|ref|ZP_04285596.1| Cytochrome c oxidase subunit 3 [Bacillus cereus ATCC 4342]
 gi|229168681|ref|ZP_04296403.1| Cytochrome c oxidase subunit 3 [Bacillus cereus AH621]
 gi|229180217|ref|ZP_04307561.1| Cytochrome c oxidase subunit 3 [Bacillus cereus 172560W]
 gi|229192150|ref|ZP_04319118.1| Cytochrome c oxidase subunit 3 [Bacillus cereus ATCC 10876]
 gi|229198058|ref|ZP_04324770.1| Cytochrome c oxidase subunit 3 [Bacillus cereus m1293]
 gi|296504436|ref|YP_003666136.1| cytochrome c oxidase polypeptide III [Bacillus thuringiensis
           BMB171]
 gi|42738964|gb|AAS42892.1| cytochrome c oxidase, subunit III [Bacillus cereus ATCC 10987]
 gi|47557097|gb|EAL15426.1| cytochrome c oxidase subunit III [Bacillus cereus G9241]
 gi|51975016|gb|AAU16566.1| cytochrome c oxidase, subunit III [Bacillus cereus E33L]
 gi|74490422|gb|EAO53732.1| Cytochrome c oxidase polypeptide III [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|163863878|gb|ABY44937.1| cytochrome c oxidase subunit III [Bacillus weihenstephanensis
           KBAB4]
 gi|206734007|gb|EDZ51178.1| cytochrome c oxidase, subunit III [Bacillus cereus AH1134]
 gi|206743388|gb|EDZ54825.1| cytochrome c oxidase, subunit III [Bacillus cereus H3081.97]
 gi|217067304|gb|ACJ81554.1| cytochrome c oxidase, subunit III [Bacillus cereus AH187]
 gi|218163391|gb|ACK63383.1| cytochrome c oxidase, subunit III [Bacillus cereus B4264]
 gi|218541319|gb|ACK93713.1| cytochrome c oxidase, subunit III [Bacillus cereus G9842]
 gi|221241448|gb|ACM14158.1| cytochrome c oxidase, subunit III [Bacillus cereus Q1]
 gi|228585416|gb|EEK43522.1| Cytochrome c oxidase subunit 3 [Bacillus cereus m1293]
 gi|228591357|gb|EEK49208.1| Cytochrome c oxidase subunit 3 [Bacillus cereus ATCC 10876]
 gi|228603426|gb|EEK60903.1| Cytochrome c oxidase subunit 3 [Bacillus cereus 172560W]
 gi|228614837|gb|EEK71940.1| Cytochrome c oxidase subunit 3 [Bacillus cereus AH621]
 gi|228625969|gb|EEK82719.1| Cytochrome c oxidase subunit 3 [Bacillus cereus ATCC 4342]
 gi|228631332|gb|EEK87967.1| Cytochrome c oxidase subunit 3 [Bacillus cereus m1550]
 gi|228637146|gb|EEK93605.1| Cytochrome c oxidase subunit 3 [Bacillus cereus BDRD-ST24]
 gi|228642742|gb|EEK99025.1| Cytochrome c oxidase subunit 3 [Bacillus cereus BDRD-ST26]
 gi|228648796|gb|EEL04822.1| Cytochrome c oxidase subunit 3 [Bacillus cereus BDRD-ST196]
 gi|228654456|gb|EEL10321.1| Cytochrome c oxidase subunit 3 [Bacillus cereus BDRD-Cer4]
 gi|228666048|gb|EEL21514.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock1-3]
 gi|228672028|gb|EEL27320.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock1-15]
 gi|228678946|gb|EEL33156.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock3-28]
 gi|228685029|gb|EEL38962.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock3-29]
 gi|228702238|gb|EEL54714.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock4-2]
 gi|228707474|gb|EEL59665.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock4-18]
 gi|228711732|gb|EEL63685.1| Cytochrome c oxidase subunit 3 [Bacillus cereus F65185]
 gi|228723721|gb|EEL75077.1| Cytochrome c oxidase subunit 3 [Bacillus cereus AH676]
 gi|228729861|gb|EEL80841.1| Cytochrome c oxidase subunit 3 [Bacillus cereus AH1271]
 gi|228742160|gb|EEL92326.1| Cytochrome c oxidase subunit 3 [Bacillus cereus AH1273]
 gi|228748097|gb|EEL97958.1| Cytochrome c oxidase subunit 3 [Bacillus mycoides DSM 2048]
 gi|228772679|gb|EEM21120.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228779095|gb|EEM27354.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis Bt407]
 gi|228785671|gb|EEM33677.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228792697|gb|EEM40261.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228799471|gb|EEM46431.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228805538|gb|EEM52129.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228836967|gb|EEM82309.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228850057|gb|EEM94888.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis IBL 200]
 gi|228857192|gb|EEN01698.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis IBL 4222]
 gi|296325488|gb|ADH08416.1| cytochrome c oxidase polypeptide III [Bacillus thuringiensis
           BMB171]
 gi|324327842|gb|ADY23102.1| cytochrome c oxidase, subunit III [Bacillus thuringiensis serovar
           finitimus YBT-020]
 gi|326941714|gb|AEA17610.1| cytochrome c oxidase polypeptide III [Bacillus thuringiensis
           serovar chinensis CT-43]
          Length = 207

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 115/193 (59%), Gaps = 2/193 (1%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++    ++GFW++L  + ++FA  F TY  L  +   GP   ++F +  +F+ T
Sbjct: 15  EPEKATLEGKNKFVGFWLFLGGETVLFASLFGTYLALKNSTNGGPTSQEMFQMPLVFIMT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI-SMEAVPQ 137
           ++LL SSL+  +AM          K   WLLVT   G+ F+  EIYEF H     +   +
Sbjct: 75  MLLLTSSLTSVYAMYHMKNFNF-KKMQLWLLVTVLLGLGFLGFEIYEFYHYTHEFKHTMR 133

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
            SAF S+F+ALVG HGLHV FGL W+  L+ +  K+GL   N  +    S++WHF+D++W
Sbjct: 134 SSAFGSAFYALVGTHGLHVLFGLCWILTLIFRNAKRGLNLYNAPKFYVASIYWHFIDVVW 193

Query: 198 ICVFSFVYLMGVV 210
           + +F+ VYLMG+V
Sbjct: 194 VFIFTVVYLMGMV 206


>gi|126653833|ref|ZP_01725696.1| cytochrome aa3 quinol oxidase subunit III [Bacillus sp. B14905]
 gi|126589670|gb|EAZ83807.1| cytochrome aa3 quinol oxidase subunit III [Bacillus sp. B14905]
          Length = 203

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 64/178 (35%), Positives = 101/178 (56%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWI+L ++ ++FA  F  Y  L     +GP   ++F+++ +   T +LL SS +    +
Sbjct: 26  GFWIFLGAEIVLFATLFTVYFTLHTRTGSGPNGAEIFELTPVLWETFLLLTSSFTIGLGV 85

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
            A    R     +++ ++T   G+ F+ +EI EF   +   A  Q SAFLSS   L+G H
Sbjct: 86  HAMRIGRK-KAMMTFFIITLLLGLGFLAIEIDEFITYVHEGATIQTSAFLSSLMTLLGTH 144

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           G HV FG  W   ++IQ+ K+GL      +    S++WHFLD++WI +FSFVYL G++
Sbjct: 145 GAHVTFGFFWGLAIIIQVAKRGLNPQTANKAFIFSLYWHFLDVVWIFIFSFVYLKGLI 202


>gi|154687940|ref|YP_001423101.1| QoxC [Bacillus amyloliquefaciens FZB42]
 gi|154353791|gb|ABS75870.1| QoxC [Bacillus amyloliquefaciens FZB42]
          Length = 204

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 106/178 (59%), Gaps = 1/178 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++F+  F T+ VL +  A G  P ++F++  + + T +LL+SS +C  A
Sbjct: 25  LGFWIFLGAEIVLFSTLFATFFVLQRRTAGGVLPAELFEVKLVMIMTFLLLISSFTCGIA 84

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +     +  +   V W ++T   G  F+  E+ EF H +   A    SAF S FF L+G 
Sbjct: 85  V-HEMRRGSLKGVVIWTIITLLLGAGFVGCELNEFIHYVHEGASLGTSAFWSGFFVLLGT 143

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           HG HV  G+ W+  +++Q+ K+GL      ++   S++WHFLD++WI +F+ VYL+G+
Sbjct: 144 HGTHVTIGIFWIAGILLQLKKRGLTPQTSSKIFISSLYWHFLDVVWIFIFTGVYLIGL 201


>gi|295698391|ref|YP_003603046.1| Cytochrome o ubiquinol oxidase subunit 3 [Candidatus Riesia
           pediculicola USDA]
 gi|291157388|gb|ADD79833.1| Cytochrome o ubiquinol oxidase subunit 3 [Candidatus Riesia
           pediculicola USDA]
          Length = 196

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 106/189 (56%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           D +++   ++ T LGFWIYLMSD L F    + Y+V  K         D  ++  +F+ T
Sbjct: 4   DNEDTLRKNNKTLLGFWIYLMSDMLFFVSLILVYSVFLKEDVRFSILRDQINLKIVFLET 63

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           I+L  +SL   F+  +    R     +  L  +   G+ F  +E YE + L   +  P+ 
Sbjct: 64  ILLSTNSLMFYFSETSFQLNRKKEFFIKILFFSLIIGVTFFFVETYEISKLFQCQFFPKN 123

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           S+  S+FF+++G H LHVFFGLIW+ V+  +IL KGL   +   L CLS FWHFLD++WI
Sbjct: 124 SSIFSAFFSVIGAHSLHVFFGLIWIIVMEGKILFKGLDKNSLVSLKCLSDFWHFLDIMWI 183

Query: 199 CVFSFVYLM 207
            + S V+L+
Sbjct: 184 LIVSVVHLL 192


>gi|30264013|ref|NP_846390.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. Ames]
 gi|47529450|ref|YP_020799.1| cytochrome c oxidase subunit III [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49186852|ref|YP_030104.1| cytochrome c oxidase subunit III [Bacillus anthracis str. Sterne]
 gi|49478458|ref|YP_038004.1| cytochrome c oxidase subunit III [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|65321337|ref|ZP_00394296.1| COG1845: Heme/copper-type cytochrome/quinol oxidase, subunit 3
           [Bacillus anthracis str. A2012]
 gi|118479159|ref|YP_896310.1| cytochrome c oxidase, subunit III [Bacillus thuringiensis str. Al
           Hakam]
 gi|165872133|ref|ZP_02216772.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0488]
 gi|167633499|ref|ZP_02391823.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0442]
 gi|167640968|ref|ZP_02399225.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0193]
 gi|170688794|ref|ZP_02879998.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0465]
 gi|170705795|ref|ZP_02896258.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0389]
 gi|177654276|ref|ZP_02936205.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0174]
 gi|190565931|ref|ZP_03018850.1| cytochrome c oxidase, subunit III [Bacillus anthracis
           Tsiankovskii-I]
 gi|196035910|ref|ZP_03103312.1| cytochrome c oxidase, subunit III [Bacillus cereus W]
 gi|196038642|ref|ZP_03105950.1| cytochrome c oxidase, subunit III [Bacillus cereus NVH0597-99]
 gi|196045939|ref|ZP_03113168.1| cytochrome c oxidase, subunit III [Bacillus cereus 03BB108]
 gi|218905073|ref|YP_002452907.1| cytochrome c oxidase, subunit III [Bacillus cereus AH820]
 gi|225865924|ref|YP_002751302.1| cytochrome c oxidase, subunit III [Bacillus cereus 03BB102]
 gi|227816716|ref|YP_002816725.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. CDC 684]
 gi|228916579|ref|ZP_04080145.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228928989|ref|ZP_04092021.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228935257|ref|ZP_04098083.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228947661|ref|ZP_04109951.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|229092991|ref|ZP_04224122.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock3-42]
 gi|229123463|ref|ZP_04252662.1| Cytochrome c oxidase subunit 3 [Bacillus cereus 95/8201]
 gi|229604758|ref|YP_002868242.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0248]
 gi|254683709|ref|ZP_05147569.1| cytochrome c oxidase, subunit III [Bacillus anthracis str.
           CNEVA-9066]
 gi|254736054|ref|ZP_05193760.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. Western
           North America USA6153]
 gi|254743945|ref|ZP_05201628.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. Kruger
           B]
 gi|254754276|ref|ZP_05206311.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. Vollum]
 gi|254758033|ref|ZP_05210060.1| cytochrome c oxidase, subunit III [Bacillus anthracis str.
           Australia 94]
 gi|301055433|ref|YP_003793644.1| cytochrome c oxidase subunit III [Bacillus anthracis CI]
 gi|30258658|gb|AAP27876.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. Ames]
 gi|47504598|gb|AAT33274.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49180779|gb|AAT56155.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. Sterne]
 gi|49330014|gb|AAT60660.1| cytochrome c oxidase, subunit III [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|118418384|gb|ABK86803.1| cytochrome c oxidase, subunit III [Bacillus thuringiensis str. Al
           Hakam]
 gi|164712080|gb|EDR17618.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0488]
 gi|167511018|gb|EDR86407.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0193]
 gi|167530905|gb|EDR93592.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0442]
 gi|170129335|gb|EDS98199.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0389]
 gi|170667310|gb|EDT18069.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0465]
 gi|172080766|gb|EDT65847.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0174]
 gi|190562850|gb|EDV16816.1| cytochrome c oxidase, subunit III [Bacillus anthracis
           Tsiankovskii-I]
 gi|195991559|gb|EDX55525.1| cytochrome c oxidase, subunit III [Bacillus cereus W]
 gi|196023379|gb|EDX62057.1| cytochrome c oxidase, subunit III [Bacillus cereus 03BB108]
 gi|196030365|gb|EDX68964.1| cytochrome c oxidase, subunit III [Bacillus cereus NVH0597-99]
 gi|218537730|gb|ACK90128.1| cytochrome c oxidase, subunit III [Bacillus cereus AH820]
 gi|225788326|gb|ACO28543.1| cytochrome c oxidase, subunit III [Bacillus cereus 03BB102]
 gi|227005165|gb|ACP14908.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. CDC 684]
 gi|228659950|gb|EEL15591.1| Cytochrome c oxidase subunit 3 [Bacillus cereus 95/8201]
 gi|228690362|gb|EEL44148.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock3-42]
 gi|228812181|gb|EEM58512.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228824422|gb|EEM70228.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228830796|gb|EEM76401.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228843158|gb|EEM88240.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|229269166|gb|ACQ50803.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0248]
 gi|300377602|gb|ADK06506.1| cytochrome c oxidase, subunit III [Bacillus cereus biovar anthracis
           str. CI]
          Length = 207

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 115/193 (59%), Gaps = 2/193 (1%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++    ++GFW++L  + ++FA  F TY  L  +   GP   ++F +  +F+ T
Sbjct: 15  EPEKATLEGKNKFVGFWLFLGGETVLFASLFGTYLALKNSTNGGPTSQEMFQMPLVFIMT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI-SMEAVPQ 137
           ++LL SSL+  +AM          K   WLLVT   G+ F+  EIYEF H     +   +
Sbjct: 75  MLLLTSSLTSVYAMYHMKNFNF-KKMQLWLLVTVLLGLGFLGFEIYEFYHYAHEFKHTMR 133

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
            SAF S+F+ALVG HGLHV FGL W+  L+ +  K+GL   N  +    S++WHF+D++W
Sbjct: 134 SSAFGSAFYALVGTHGLHVLFGLCWILTLIFRNAKRGLNLYNAPKFYVASIYWHFIDVVW 193

Query: 198 ICVFSFVYLMGVV 210
           + +F+ VYLMG+V
Sbjct: 194 VFIFTVVYLMGMV 206


>gi|255021770|ref|ZP_05293802.1| Cytochrome O ubiquinol oxidase subunit III [Acidithiobacillus
           caldus ATCC 51756]
 gi|254968791|gb|EET26321.1| Cytochrome O ubiquinol oxidase subunit III [Acidithiobacillus
           caldus ATCC 51756]
          Length = 212

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/180 (35%), Positives = 104/180 (57%), Gaps = 3/180 (1%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGK--NYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSF 90
           GFW+Y+++D +++A  F +  VL    N A GP P  + D    +  TI L LS L+  +
Sbjct: 33  GFWLYMLTDAMVYAALFASLGVLSHVVNLAGGPPPAAIIDPVYAYGETITLFLSVLAYGY 92

Query: 91  AMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVG 150
           +M+A  +       +  +LV+   G++F+ +   +  HL S   +P+ S FLS FF ++ 
Sbjct: 93  SMVALKSGSR-GGVIGAMLVSMLLGVVFLGIAATDIGHLFSRGIIPETSGFLSIFFTILI 151

Query: 151 LHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
            H LH+  G++W+ V++ QI + G  +    RLI L +FWHF  +IW+ VF+FVYL G+V
Sbjct: 152 YHALHILVGIVWMLVMIAQIARDGFTANVVYRLINLRLFWHFQAVIWVFVFTFVYLQGMV 211


>gi|299535602|ref|ZP_07048923.1| quinol oxidase subunit 3 [Lysinibacillus fusiformis ZC1]
 gi|298728802|gb|EFI69356.1| quinol oxidase subunit 3 [Lysinibacillus fusiformis ZC1]
          Length = 199

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/178 (35%), Positives = 101/178 (56%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWI+L ++ ++FA  F  Y  L     +GP   ++F+++ +   T +LL SS +    +
Sbjct: 22  GFWIFLGAEIVLFATLFTVYFTLHTRTGSGPNGAEIFELTPVLWETFLLLTSSFTIGLGV 81

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
            A    R     +++ ++T   G+ F+ +EI EF   +   A  Q SAFLSS   L+G H
Sbjct: 82  HAMRIGRK-KAMMTFFIITLLLGLGFLAIEIDEFVTYVHEGATIQTSAFLSSLMTLLGTH 140

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           G HV FG  W   ++IQ+ K+GL      +    S++WHFLD++WI +FSFVYL G++
Sbjct: 141 GAHVTFGFFWGVAILIQVAKRGLNPQTANKAFIFSLYWHFLDVVWIFIFSFVYLKGLI 198


>gi|169829427|ref|YP_001699585.1| quinol oxidase subunit 3 [Lysinibacillus sphaericus C3-41]
 gi|168993915|gb|ACA41455.1| Quinol oxidase subunit 3 [Lysinibacillus sphaericus C3-41]
          Length = 199

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/178 (35%), Positives = 100/178 (56%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFWI+L ++ ++FA  F  Y  L      GP   ++F+++ +   T +LL SS +    +
Sbjct: 22  GFWIFLGAEIVLFATLFTVYFTLHTRTGNGPNGAEIFELTPVLWETFLLLTSSFTIGLGV 81

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
            A    R     +++ ++T   G+ F+ +EI EF   +   A  Q SAFLSS   L+G H
Sbjct: 82  HAMRIGRK-KAMMTFFIITLLLGLGFLAIEIDEFITYVHEGATIQTSAFLSSLMTLLGTH 140

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           G HV FG  W   ++IQ+ K+GL      +    S++WHFLD++WI +FSFVYL G++
Sbjct: 141 GAHVTFGFFWGLAIIIQVAKRGLNPQTANKAFIFSLYWHFLDVVWIFIFSFVYLKGLI 198


>gi|226314594|ref|YP_002774490.1| cytochrome c oxidase polypeptide III [Brevibacillus brevis NBRC
           100599]
 gi|226097544|dbj|BAH45986.1| cytochrome c oxidase polypeptide III [Brevibacillus brevis NBRC
           100599]
          Length = 208

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 67/193 (34%), Positives = 111/193 (57%), Gaps = 1/193 (0%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            + +++ ++     LGFW++L  + ++F   F T+  L      GP    +FD++ + V+
Sbjct: 12  DEPEKATLEGKNKVLGFWLFLGGETVLFGSLFATFIALRDQANGGPTSQALFDMNLVAVA 71

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T++LL SS++   A LA   K L  K   WL +T   G+ F+ +EIYEF H ++      
Sbjct: 72  TLLLLTSSMTSVMATLALHRKDL-KKIQLWLTITVILGLGFLALEIYEFVHYVNEGLKMS 130

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
            SAF S+F+ LVG HG HV FG+ W+ +L +   KKGL      +     ++WHF+D++W
Sbjct: 131 TSAFSSAFYTLVGFHGAHVAFGICWITLLQLSATKKGLTVVTAPKFYLACLYWHFIDVVW 190

Query: 198 ICVFSFVYLMGVV 210
           + +F+ VYLMG++
Sbjct: 191 VFIFTVVYLMGMI 203


>gi|152976356|ref|YP_001375873.1| cytochrome c oxidase subunit III [Bacillus cereus subsp. cytotoxis
           NVH 391-98]
 gi|152025108|gb|ABS22878.1| cytochrome c oxidase subunit III [Bacillus cytotoxicus NVH 391-98]
          Length = 207

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 114/194 (58%), Gaps = 4/194 (2%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++    ++GFW++L  + ++FA  F TY  L  +   GP+  ++F +  +F+ T
Sbjct: 15  EPEKATLEGKNKFVGFWLFLGGETVLFASLFGTYLALKNSTNGGPSSQEMFQMPLVFIMT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMI-FIIMEIYEFAHLI-SMEAVP 136
           ++LL SSL+  +AM     K    K +   L+      + F+  EIYEF H     +   
Sbjct: 75  MLLLTSSLTSVYAMYH--MKNFHFKQMQLWLLVTVLLGLGFLGFEIYEFYHYAHEFKHTM 132

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
           + SAF S+F+ALVG HGLHV FGL W+  L+ +  K+GL   N  +    S++WHF+D++
Sbjct: 133 RSSAFGSAFYALVGTHGLHVLFGLCWILTLIFRNAKRGLNLYNAPKFYVASIYWHFIDVV 192

Query: 197 WICVFSFVYLMGVV 210
           W+ +F+ VYLMG+V
Sbjct: 193 WVFIFTVVYLMGMV 206


>gi|212639692|ref|YP_002316212.1| cytochrome caa3 oxidase subunit III [Anoxybacillus flavithermus
           WK1]
 gi|212561172|gb|ACJ34227.1| Cytochrome caa3 oxidase (subunit III) [Anoxybacillus flavithermus
           WK1]
          Length = 206

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 115/193 (59%), Gaps = 3/193 (1%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++    +LGFW +L  + ++FA  F T+  L  + A GP   ++F +  +F++T
Sbjct: 15  EPEKATLEGKNKFLGFWFFLGGETVLFASLFATFLALRDSVANGPTAEELFKMPIVFLAT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVS-WLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           ++LL SSL+  +AM     +    K +  WL +T   G  F+ +EIYEF   +       
Sbjct: 75  MLLLTSSLTSVYAM--HHMRNFDFKKMQLWLGITVLLGAGFLALEIYEFTEYVHEGFKFS 132

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
            SAF SSF+ LVG HG HV FGL+W+  L+++  K+GL   N  +    S++WHF+D++W
Sbjct: 133 TSAFSSSFYTLVGTHGGHVAFGLLWIITLMVRNAKRGLNLYNAPKFYVASLYWHFIDVVW 192

Query: 198 ICVFSFVYLMGVV 210
           + +F+ VYLMG+V
Sbjct: 193 VFIFTVVYLMGMV 205


>gi|332974252|gb|EGK11184.1| cytochrome c oxidase, subunit III [Desmospora sp. 8437]
          Length = 209

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 106/192 (55%), Gaps = 1/192 (0%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
             + + ++     LGFW++L ++ +MFA FF  Y  L  +   GP   +++ I  +  ST
Sbjct: 18  HPERATMEGRNKILGFWLFLGAETVMFACFFGVYLALRNSSMDGPTTQELYHIPMVAAST 77

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           ++LL SSL+    ++    +    KT+ W  VT   G  F+ +EIYEF   +        
Sbjct: 78  LILLFSSLTSVLGVVG-MQQHHYKKTMFWFGVTVLLGASFLALEIYEFFVYVGEGHTFTS 136

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF S+F+ L+G HG HV FG+ W+  L+ Q  K+GL      +    S++WHF+D++W+
Sbjct: 137 SAFGSAFYTLLGTHGAHVLFGVCWITGLLFQARKQGLSQQMAPKFYVASLYWHFIDVVWV 196

Query: 199 CVFSFVYLMGVV 210
            +F+ VYLMG V
Sbjct: 197 FIFTVVYLMGKV 208


>gi|89099556|ref|ZP_01172431.1| cytochrome c oxidase subunit III [Bacillus sp. NRRL B-14911]
 gi|89085709|gb|EAR64835.1| cytochrome c oxidase subunit III [Bacillus sp. NRRL B-14911]
          Length = 209

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 109/195 (55%), Gaps = 4/195 (2%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI--DVFDISGIFV 76
             ++  ++    +LGFW +L  + ++FA  F TY  L          +  D+F++  +F 
Sbjct: 15  SPEKQTLEAKNKFLGFWFFLGGETVLFASLFATYLALKDKVPGTEHALAKDLFELPLVFA 74

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI-SMEAV 135
           +T++LL SSL+  +AM          K   W+ +T   G  F+ +EIYEF H +      
Sbjct: 75  ATMLLLTSSLTSVYAMYHMKNFNF-KKMQLWMWITVALGAAFLGLEIYEFNHYVHEYHHT 133

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
              SAF S+F+ LVG HG HV FGL+W+  L+I+  ++GL   N  +    S++WHF+D+
Sbjct: 134 FTSSAFGSAFYTLVGFHGGHVAFGLLWITTLLIRNSRRGLSLYNAPKFYVASLYWHFIDV 193

Query: 196 IWICVFSFVYLMGVV 210
           +W+ +F+ VYLMG+V
Sbjct: 194 VWVFIFTVVYLMGMV 208


>gi|315646713|ref|ZP_07899829.1| cytochrome aa3 quinol oxidase, subunit III [Paenibacillus vortex
           V453]
 gi|315277919|gb|EFU41242.1| cytochrome aa3 quinol oxidase, subunit III [Paenibacillus vortex
           V453]
          Length = 198

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 66/185 (35%), Positives = 108/185 (58%), Gaps = 1/185 (0%)

Query: 26  DHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS 85
           ++     GFW++L ++  +FA  F  Y VL   +A+GP+  ++F+I+ + + T +LL SS
Sbjct: 15  ENRNRIFGFWLFLGAEIALFATLFTVYFVLVNRFASGPSGAEIFEITPVLLETFLLLTSS 74

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSF 145
            +   A+ A     L  + + ++++T   G  F+ +EI+EF   +        SAF SS 
Sbjct: 75  FTIGLAVHAMRLG-LKKQMMIFMVITLLLGAGFLGIEIFEFFTYVHEGVTLSTSAFASSL 133

Query: 146 FALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
           F L+G HG HV FGL+W   ++IQ+ K GL      +    S++WHFLD++WI +FSFVY
Sbjct: 134 FTLLGTHGAHVTFGLLWGTAILIQLKKHGLDHSTANKSFIFSLYWHFLDVVWIFIFSFVY 193

Query: 206 LMGVV 210
           L G++
Sbjct: 194 LKGLM 198


>gi|30022030|ref|NP_833661.1| cytochrome c oxidase polypeptide III [Bacillus cereus ATCC 14579]
 gi|29897586|gb|AAP10862.1| Cytochrome c oxidase polypeptide III [Bacillus cereus ATCC 14579]
          Length = 207

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 71/193 (36%), Positives = 114/193 (59%), Gaps = 2/193 (1%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++    ++GFW++L  + ++FA  F TY  L  +   GP   ++F +  +F+ T
Sbjct: 15  EPEKATLEGKNKFVGFWLFLGGETVLFASLFGTYLALKNSTNGGPTSQEMFQMPLVFIMT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI-SMEAVPQ 137
           ++LL SSL+  +AM          K   WLLVT   G+ F+  EIYEF H     +   +
Sbjct: 75  MLLLTSSLTSVYAMYHMKNFNF-KKMQLWLLVTVLLGLGFLGFEIYEFYHYTHEFKHTMR 133

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
            SAF  +F+ALVG HGLHV FGL W+  L+ +  K+GL   N  +    S++WHF+D++W
Sbjct: 134 SSAFGYAFYALVGTHGLHVLFGLCWILTLIFRNAKRGLNLYNAPKFYVASIYWHFIDVVW 193

Query: 198 ICVFSFVYLMGVV 210
           + +F+ VYLMG+V
Sbjct: 194 VFIFTVVYLMGMV 206


>gi|261406337|ref|YP_003242578.1| cytochrome aa3 quinol oxidase subunit III [Paenibacillus sp.
           Y412MC10]
 gi|329922393|ref|ZP_08278070.1| cytochrome aa3 quinol oxidase, subunit III [Paenibacillus sp. HGF5]
 gi|261282800|gb|ACX64771.1| cytochrome aa3 quinol oxidase, subunit III [Paenibacillus sp.
           Y412MC10]
 gi|328942256|gb|EGG38527.1| cytochrome aa3 quinol oxidase, subunit III [Paenibacillus sp. HGF5]
          Length = 198

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 66/185 (35%), Positives = 108/185 (58%), Gaps = 1/185 (0%)

Query: 26  DHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS 85
           ++     GFW++L ++  +FA  F  Y VL   +A+GP+  ++F+I+ + + T +LL SS
Sbjct: 15  ENRNRIFGFWLFLGAEIALFATLFTVYFVLVNRFASGPSGAEIFEITPVLLETFLLLTSS 74

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSF 145
            +   A+ A     L  + + ++++T   G  F+ +EI+EF   +        SAF SS 
Sbjct: 75  FTIGLAVHAMRLG-LKKQMMIFMVITLLLGAGFLGIEIFEFFTYVHEGVTLSTSAFSSSL 133

Query: 146 FALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
           F L+G HG HV FGL+W   ++IQ+ K GL      +    S++WHFLD++WI +FSFVY
Sbjct: 134 FTLLGTHGAHVTFGLLWGTAILIQLKKHGLDHSTANKSFIFSLYWHFLDVVWIFIFSFVY 193

Query: 206 LMGVV 210
           L G++
Sbjct: 194 LKGLM 198


>gi|254824762|ref|ZP_05229763.1| heme-copper oxidase subunit I+III [Listeria monocytogenes FSL
           J1-194]
 gi|293594001|gb|EFG01762.1| heme-copper oxidase subunit I+III [Listeria monocytogenes FSL
           J1-194]
          Length = 203

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 68/208 (32%), Positives = 116/208 (55%), Gaps = 8/208 (3%)

Query: 4   QKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK-NYAAG 62
           + +  + N  + Y  ++    +      LGFWI+L ++  +FA  F TY V+ K    AG
Sbjct: 2   ESVETNKNLPIEYRSEQGRLNI------LGFWIFLGAEIALFATLFATYFVMRKAGSNAG 55

Query: 63  PAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIME 122
             P ++F++  + + T +LL SS +C  A +    K  +     + ++T   G  F+  E
Sbjct: 56  HPPAEMFELWLVLIMTFLLLTSSFTCGLA-IGEMRKGNVKMLTIYSIITLILGAGFVGFE 114

Query: 123 IYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRR 182
           +YEFAH +++    Q  ++ S+FF L+G HGLHV  G+ W+  ++IQI   GL      +
Sbjct: 115 LYEFAHYVTVGVTMQIGSYWSAFFVLLGTHGLHVTVGIFWISFILIQIKMHGLTPKTASK 174

Query: 183 LICLSMFWHFLDLIWICVFSFVYLMGVV 210
           +   S++WHFLD++WI +F+ VYL+G+V
Sbjct: 175 VFISSLYWHFLDVVWIFIFTGVYLLGMV 202


>gi|4432891|dbj|BAA20886.1| cytochrome c oxidase subunit III [Bacillus sp.]
          Length = 190

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 105/181 (58%), Gaps = 3/181 (1%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAP-IDVFDISGI 74
           +    +++ ++    +LGFW++L  + ++FA  F TY  L K+  AG  P  ++FD+  +
Sbjct: 12  FPDSPEKATLEGKNKFLGFWLFLGGETVLFASLFATYLAL-KDSTAGTKPGAEIFDLGLV 70

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
           F +T++LL SSL+  +AM          K   W+ +T   G+ F+I+EIYEF H I +  
Sbjct: 71  FAATMILLTSSLTSVYAMYHMKNFNF-RKMQLWMFITWLLGLSFLILEIYEFMHYIHLGH 129

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
               SAF S+F+ LVG HG HV FGL+W+  L+I+  K GL   N  +    S++WHFLD
Sbjct: 130 TFTSSAFGSAFYTLVGTHGAHVCFGLLWIGTLLIRYSKGGLNLYNAPKFYVASLYWHFLD 189

Query: 195 L 195
           +
Sbjct: 190 V 190


>gi|51893236|ref|YP_075927.1| cytochrome C oxidase subunit III [Symbiobacterium thermophilum IAM
           14863]
 gi|51856925|dbj|BAD41083.1| cytochrome C oxidase subunit III [Symbiobacterium thermophilum IAM
           14863]
          Length = 210

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 96/180 (53%), Gaps = 1/180 (0%)

Query: 28  DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
           D   LGFW+++ S+ + FA   V Y V    Y  G  P D+F+I    VST VLL+SSL+
Sbjct: 28  DNRKLGFWLFIASESIFFACLLVGYLVFRGGYQPGVGPRDLFNIELTTVSTFVLLMSSLA 87

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
              A+ A A +        W+LVTA  G+ F+  + YEF H          S F ++F+ 
Sbjct: 88  MVLAVNA-AQRNEGRAARRWVLVTALMGLTFLGFQAYEFTHFYHAGLSLSSSVFGTAFYT 146

Query: 148 LVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           L G HG HV  G+IWL  L+     KGL       +    ++WHF+D++WI +F+ VYL+
Sbjct: 147 LTGFHGAHVAVGVIWLLTLLYHGRGKGLTVDKADDVEVAGLYWHFVDIVWIVLFTVVYLL 206


>gi|16802063|ref|NP_463548.1| AA3-600 quinol oxidase subunit III [Listeria monocytogenes EGD-e]
 gi|47095076|ref|ZP_00232688.1| quinol oxidase AA3, subunit III [Listeria monocytogenes str. 1/2a
           F6854]
 gi|224498293|ref|ZP_03666642.1| AA3-600 quinol oxidase subunit III [Listeria monocytogenes Finland
           1988]
 gi|224503061|ref|ZP_03671368.1| AA3-600 quinol oxidase subunit III [Listeria monocytogenes FSL
           R2-561]
 gi|254827440|ref|ZP_05232127.1| heme-copper oxidase subunit I+III [Listeria monocytogenes FSL
           N3-165]
 gi|254830692|ref|ZP_05235347.1| AA3-600 quinol oxidase subunit III [Listeria monocytogenes 10403S]
 gi|254899670|ref|ZP_05259594.1| AA3-600 quinol oxidase subunit III [Listeria monocytogenes J0161]
 gi|254913127|ref|ZP_05263139.1| cytochrome c oxidase polypeptide I/III subunit 1 [Listeria
           monocytogenes J2818]
 gi|254937508|ref|ZP_05269205.1| heme-copper oxidase subunit I+III [Listeria monocytogenes F6900]
 gi|255025411|ref|ZP_05297397.1| AA3-600 quinol oxidase subunit III [Listeria monocytogenes FSL
           J2-003]
 gi|284803250|ref|YP_003415115.1| AA3-600 quinol oxidase subunit III [Listeria monocytogenes 08-5578]
 gi|284996391|ref|YP_003418159.1| AA3-600 quinol oxidase subunit III [Listeria monocytogenes 08-5923]
 gi|315273205|ref|ZP_07869232.1| cytochrome aa3 quinol oxidase, subunit III [Listeria marthii FSL
           S4-120]
 gi|16409374|emb|CAC98230.1| AA3-600 quinol oxidase subunit III [Listeria monocytogenes EGD-e]
 gi|47016421|gb|EAL07342.1| quinol oxidase AA3, subunit III [Listeria monocytogenes str. 1/2a
           F6854]
 gi|258599817|gb|EEW13142.1| heme-copper oxidase subunit I+III [Listeria monocytogenes FSL
           N3-165]
 gi|258610109|gb|EEW22717.1| heme-copper oxidase subunit I+III [Listeria monocytogenes F6900]
 gi|284058812|gb|ADB69753.1| AA3-600 quinol oxidase subunit III [Listeria monocytogenes 08-5578]
 gi|284061858|gb|ADB72797.1| AA3-600 quinol oxidase subunit III [Listeria monocytogenes 08-5923]
 gi|293591129|gb|EFF99463.1| cytochrome c oxidase polypeptide I/III subunit 1 [Listeria
           monocytogenes J2818]
 gi|313616167|gb|EFR89265.1| cytochrome aa3 quinol oxidase, subunit III [Listeria marthii FSL
           S4-120]
          Length = 203

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 68/208 (32%), Positives = 115/208 (55%), Gaps = 8/208 (3%)

Query: 4   QKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK-NYAAG 62
           + +  + N  + Y  ++    +      LGFWI+L ++  +FA  F TY V+ K    AG
Sbjct: 2   ESVETNKNLPIEYRSEQGRLNI------LGFWIFLGAEIALFATLFATYFVMRKAGSNAG 55

Query: 63  PAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIME 122
             P ++F++  + + T +LL SS +C  A +    K  +     + ++T   G  F+  E
Sbjct: 56  HPPAEMFELWLVLIMTFLLLTSSFTCGLA-IGEMRKGNVKMLTIYSIITLILGAGFVGFE 114

Query: 123 IYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRR 182
           +YEFAH ++     Q  ++ S+FF L+G HGLHV  G+ W+  ++IQI   GL      +
Sbjct: 115 LYEFAHYVTEGVTMQVGSYWSAFFVLLGTHGLHVTVGIFWISFILIQIKMHGLTPKTASK 174

Query: 183 LICLSMFWHFLDLIWICVFSFVYLMGVV 210
           +   S++WHFLD++WI +F+ VYL+G+V
Sbjct: 175 VFISSLYWHFLDVVWIFIFTGVYLLGMV 202


>gi|116871438|ref|YP_848219.1| cytochrome aa3 quinol oxidase, subunit III [Listeria welshimeri
           serovar 6b str. SLCC5334]
 gi|116740316|emb|CAK19434.1| cytochrome aa3 quinol oxidase, subunit III [Listeria welshimeri
           serovar 6b str. SLCC5334]
          Length = 203

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 68/208 (32%), Positives = 115/208 (55%), Gaps = 8/208 (3%)

Query: 4   QKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK-NYAAG 62
           + +  + N  + Y  ++    +      LGFWI+L ++  +FA  F TY V+ K    AG
Sbjct: 2   ESVEANKNLPIEYRSEQGRLNI------LGFWIFLGAEIALFATLFATYFVMRKAGSNAG 55

Query: 63  PAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIME 122
             P ++F++  + + T +LL SS +C  A +    K  +     + ++T   G  F+  E
Sbjct: 56  HPPAEMFELWLVLIMTFLLLTSSFTCGLA-IGEMRKGNVKMLTIYSIITLILGAGFVGFE 114

Query: 123 IYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRR 182
           +YEFAH ++     Q  ++ S+FF L+G HGLHV  G+ W+  ++IQI   GL      +
Sbjct: 115 LYEFAHYVTEGVTMQVGSYWSAFFVLLGTHGLHVTVGIFWISFILIQIKMHGLTPKTASK 174

Query: 183 LICLSMFWHFLDLIWICVFSFVYLMGVV 210
           +   S++WHFLD++WI +F+ VYL+G+V
Sbjct: 175 VFISSLYWHFLDVVWIFIFTGVYLLGMV 202


>gi|229010129|ref|ZP_04167342.1| Quinol oxidase subunit 3 [Bacillus mycoides DSM 2048]
 gi|228751126|gb|EEM00939.1| Quinol oxidase subunit 3 [Bacillus mycoides DSM 2048]
          Length = 168

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 101/168 (60%), Gaps = 1/168 (0%)

Query: 43  LMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIH 102
           ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C  A +    K    
Sbjct: 1   MLFATLFASYLVLAGRTADGPTPAQLFEVKTLLIQTLLLLTSSFTCGIA-IHEMRKHNQK 59

Query: 103 KTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIW 162
             ++W ++T   G  F+  EI EF   +   A  Q SAFLS+FF L+G HG HV  G+IW
Sbjct: 60  GMLAWFILTLLLGAGFLFFEIEEFILYVGEGATIQTSAFLSAFFVLLGTHGAHVTGGIIW 119

Query: 163 LFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
              ++IQILK+GL     R++  +S++WHFLDL+W+ +++ VYL G+V
Sbjct: 120 ATCVIIQILKRGLTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMV 167


>gi|46906241|ref|YP_012630.1| quinol oxidase AA3, subunit III [Listeria monocytogenes serotype 4b
           str. F2365]
 gi|47093030|ref|ZP_00230809.1| quinol oxidase AA3, subunit III [Listeria monocytogenes str. 4b
           H7858]
 gi|217965919|ref|YP_002351597.1| cytochrome aa3 quinol oxidase, subunit III [Listeria monocytogenes
           HCC23]
 gi|226222655|ref|YP_002756762.1| AA3-600 quinol oxidase subunit III [Listeria monocytogenes
           Clip81459]
 gi|254851826|ref|ZP_05241174.1| heme-copper oxidase subunit I+III [Listeria monocytogenes FSL
           R2-503]
 gi|254930851|ref|ZP_05264210.1| heme-copper oxidase subunit I+III [Listeria monocytogenes HPB2262]
 gi|254992951|ref|ZP_05275141.1| AA3-600 quinol oxidase subunit III [Listeria monocytogenes FSL
           J2-064]
 gi|255519796|ref|ZP_05387033.1| AA3-600 quinol oxidase subunit III [Listeria monocytogenes FSL
           J1-175]
 gi|289433388|ref|YP_003463260.1| quinol oxidase AA3, subunit III [Listeria seeligeri serovar 1/2b
           str. SLCC3954]
 gi|290892053|ref|ZP_06555050.1| heme-copper oxidase subunit I+III [Listeria monocytogenes FSL
           J2-071]
 gi|300763372|ref|ZP_07073370.1| quinol oxidase AA3, subunit III [Listeria monocytogenes FSL N1-017]
 gi|46879505|gb|AAT02807.1| quinol oxidase AA3, subunit III [Listeria monocytogenes serotype 4b
           str. F2365]
 gi|47018598|gb|EAL09352.1| quinol oxidase AA3, subunit III [Listeria monocytogenes str. 4b
           H7858]
 gi|217335189|gb|ACK40983.1| cytochrome aa3 quinol oxidase, subunit III [Listeria monocytogenes
           HCC23]
 gi|225875117|emb|CAS03807.1| Putative AA3-600 quinol oxidase subunit III [Listeria monocytogenes
           serotype 4b str. CLIP 80459]
 gi|258605118|gb|EEW17726.1| heme-copper oxidase subunit I+III [Listeria monocytogenes FSL
           R2-503]
 gi|289169632|emb|CBH26166.1| quinol oxidase AA3, subunit III [Listeria seeligeri serovar 1/2b
           str. SLCC3954]
 gi|290558647|gb|EFD92164.1| heme-copper oxidase subunit I+III [Listeria monocytogenes FSL
           J2-071]
 gi|293582395|gb|EFF94427.1| heme-copper oxidase subunit I+III [Listeria monocytogenes HPB2262]
 gi|300515649|gb|EFK42698.1| quinol oxidase AA3, subunit III [Listeria monocytogenes FSL N1-017]
 gi|307569538|emb|CAR82717.1| quinol oxidase AA3, subunit III [Listeria monocytogenes L99]
 gi|313611813|gb|EFR86303.1| cytochrome aa3 quinol oxidase, subunit III [Listeria monocytogenes
           FSL F2-208]
 gi|313640100|gb|EFS04726.1| cytochrome aa3 quinol oxidase, subunit III [Listeria seeligeri FSL
           S4-171]
 gi|328468339|gb|EGF39345.1| quinol oxidase AA3, subunit III [Listeria monocytogenes 1816]
 gi|328476158|gb|EGF46864.1| quinol oxidase AA3, subunit III [Listeria monocytogenes 220]
 gi|332310353|gb|EGJ23448.1| Quinol oxidase subunit 3 [Listeria monocytogenes str. Scott A]
          Length = 203

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 68/208 (32%), Positives = 115/208 (55%), Gaps = 8/208 (3%)

Query: 4   QKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK-NYAAG 62
           + +  + N  + Y  ++    +      LGFWI+L ++  +FA  F TY V+ K    AG
Sbjct: 2   ESVETNKNLPIEYRSEQGRLNI------LGFWIFLGAEIALFATLFATYFVMRKAGSNAG 55

Query: 63  PAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIME 122
             P ++F++  + + T +LL SS +C  A +    K  +     + ++T   G  F+  E
Sbjct: 56  HPPAEMFELWLVLIMTFLLLTSSFTCGLA-IGEMRKGNVKMLTIYSIITLILGAGFVGFE 114

Query: 123 IYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRR 182
           +YEFAH ++     Q  ++ S+FF L+G HGLHV  G+ W+  ++IQI   GL      +
Sbjct: 115 LYEFAHYVTEGVTMQIGSYWSAFFVLLGTHGLHVTVGIFWISFILIQIKMHGLTPKTASK 174

Query: 183 LICLSMFWHFLDLIWICVFSFVYLMGVV 210
           +   S++WHFLD++WI +F+ VYL+G+V
Sbjct: 175 VFISSLYWHFLDVVWIFIFTGVYLLGMV 202


>gi|16799094|ref|NP_469362.1| AA3-600 quinol oxidase subunit III [Listeria innocua Clip11262]
 gi|16412436|emb|CAC95248.1| AA3-600 quinol oxidase subunit III [Listeria innocua Clip11262]
          Length = 203

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 68/208 (32%), Positives = 115/208 (55%), Gaps = 8/208 (3%)

Query: 4   QKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK-NYAAG 62
           + +  + N  + Y  ++    +      LGFWI+L ++  +FA  F TY V+ K    AG
Sbjct: 2   ESVETNKNLPIEYRSEQGRLNI------LGFWIFLGAEIALFATLFATYFVMRKAGSNAG 55

Query: 63  PAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIME 122
             P ++F++  + + T +LL SS +C  A +    K  +     + ++T   G  F+  E
Sbjct: 56  HPPAEMFELWLVLIMTFLLLASSFTCGLA-IGEMRKGNVKMLTIYSIITLILGAGFVGFE 114

Query: 123 IYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRR 182
           +YEFAH ++     Q  ++ S+FF L+G HGLHV  G+ W+  ++IQI   GL      +
Sbjct: 115 LYEFAHYVTEGVTMQIGSYWSAFFVLLGTHGLHVTVGIFWISFILIQIKMHGLTPKTASK 174

Query: 183 LICLSMFWHFLDLIWICVFSFVYLMGVV 210
           +   S++WHFLD++WI +F+ VYL+G+V
Sbjct: 175 VFISSLYWHFLDVVWIFIFTGVYLLGMV 202


>gi|229061605|ref|ZP_04198947.1| Cytochrome c oxidase subunit 3 [Bacillus cereus AH603]
 gi|228717696|gb|EEL69349.1| Cytochrome c oxidase subunit 3 [Bacillus cereus AH603]
          Length = 186

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 110/184 (59%), Gaps = 2/184 (1%)

Query: 28  DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
           +  ++GFW++L  + ++FA  F TY  L  +   GP   ++F +  +F+ T++LL SSL+
Sbjct: 3   ENKFVGFWLFLGGETVLFASLFGTYLALKNSTNGGPTSQEMFQMPLVFIMTMLLLTSSLT 62

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI-SMEAVPQRSAFLSSFF 146
             +AM          K   WLLVT   G+ F+  EIYEF H     +   + SAF S+F+
Sbjct: 63  SVYAMYHMKNFNF-KKMQLWLLVTVLLGLGFLGFEIYEFYHYTHEFKHTMRSSAFGSAFY 121

Query: 147 ALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
           ALVG HGLHV FGL W+  L+ +  K+GL   N  +    S++WHF+D++W+ +F+ VYL
Sbjct: 122 ALVGTHGLHVLFGLCWILTLIFRNAKRGLNLYNAPKFYVASIYWHFIDVVWVFIFTVVYL 181

Query: 207 MGVV 210
           MG+V
Sbjct: 182 MGMV 185


>gi|229186182|ref|ZP_04313351.1| Cytochrome c oxidase subunit 3 [Bacillus cereus BGSC 6E1]
 gi|228597358|gb|EEK55009.1| Cytochrome c oxidase subunit 3 [Bacillus cereus BGSC 6E1]
          Length = 186

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 110/184 (59%), Gaps = 2/184 (1%)

Query: 28  DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
           +  ++GFW++L  + ++FA  F TY  L  +   GP   ++F +  +F+ T++LL SSL+
Sbjct: 3   ENKFVGFWLFLGGETVLFASLFGTYLALKNSTNGGPTSQEMFQMPLVFIMTMLLLTSSLT 62

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI-SMEAVPQRSAFLSSFF 146
             +AM          K   WLLVT   G+ F+  EIYEF H     +   + SAF S+F+
Sbjct: 63  SVYAMYHMKNFNF-KKMQLWLLVTVLLGLGFLGFEIYEFYHYAHEFKHTMRSSAFGSAFY 121

Query: 147 ALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
           ALVG HGLHV FGL W+  L+ +  K+GL   N  +    S++WHF+D++W+ +F+ VYL
Sbjct: 122 ALVGTHGLHVLFGLCWILTLIFRNAKRGLNLYNAPKFYVASIYWHFIDVVWVFIFTVVYL 181

Query: 207 MGVV 210
           MG+V
Sbjct: 182 MGMV 185


>gi|311068008|ref|YP_003972931.1| cytochrome c oxidase, subunit III [Bacillus atrophaeus 1942]
 gi|310868525|gb|ADP32000.1| cytochrome c oxidase, subunit III [Bacillus atrophaeus 1942]
          Length = 207

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 115/193 (59%), Gaps = 2/193 (1%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
             +++ ++    +LGFW++L  + ++FA  F T+  L  + A+ P   ++FD+S +F++T
Sbjct: 15  SPEKATLEGKNKFLGFWLFLGGETVLFASLFATFLALRNSNASDPPTSEMFDLSLVFIAT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP-Q 137
           ++LL SSL+  +AM          K   WLL+T   G  F+ +EIYEF H          
Sbjct: 75  MLLLTSSLTSVYAMY-HMKNFAFGKMQLWLLLTLLLGAGFLGVEIYEFKHYTHEFGFTIT 133

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
            SA  SSF+ LVG HG HV FGL+W+  L+I+  K+GL   N  +    S++WHF+D++W
Sbjct: 134 SSALGSSFYTLVGTHGAHVAFGLLWISALMIRNAKRGLSLYNAPKFYVASLYWHFIDVVW 193

Query: 198 ICVFSFVYLMGVV 210
           + +F+ VYLMG+V
Sbjct: 194 VFIFTVVYLMGMV 206


>gi|126651761|ref|ZP_01723963.1| cytochrome aa3 quinol oxidase subunit III [Bacillus sp. B14905]
 gi|126591439|gb|EAZ85546.1| cytochrome aa3 quinol oxidase subunit III [Bacillus sp. B14905]
          Length = 198

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/179 (34%), Positives = 102/179 (56%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFW+++ ++ ++F   F  Y VL      GP   D+F+I+ +   T +LL SS +    
Sbjct: 21  LGFWVFIGAEIMLFGTLFAAYFVLVDRTGTGPTGADIFEITPVLFETFILLTSSFTIGLG 80

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           + A   K  +   +++ ++T   G+ FI  E+YEF H + + A  Q SAF ++    +G 
Sbjct: 81  IHA-MRKGYMKAMITFYILTLLLGVAFIGFEVYEFIHYVHVGAGLQTSAFTATLLTTLGT 139

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV FG+ W   +V Q++ +GL      +    S++WHFLD++WI +FSF+YL G+V
Sbjct: 140 HGAHVTFGVFWGIFIVYQLITRGLTPETANKSFIFSLYWHFLDVVWIFIFSFIYLKGMV 198


>gi|169828387|ref|YP_001698545.1| cytochrome aa3 quinol oxidase subunit III [Lysinibacillus
           sphaericus C3-41]
 gi|168992875|gb|ACA40415.1| cytochrome aa3 quinol oxidase subunit III [Lysinibacillus
           sphaericus C3-41]
          Length = 198

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 62/179 (34%), Positives = 102/179 (56%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFW+++ ++ ++F   F  Y VL      GP   D+F+I+ +   T +LL SS +    
Sbjct: 21  LGFWVFIGAEIMLFGTLFAAYFVLVDRTGTGPTGADIFEITPVLFETFILLTSSFTIGLG 80

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           + A   K  +   +++ ++T   G+ FI  E+YEF H + + A  Q SAF ++    +G 
Sbjct: 81  IHA-MRKGYMKAMITFYVLTLLLGVAFIGFEVYEFIHYVHVGAGLQTSAFTATLLTTLGT 139

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV FG+ W   +V Q++ +GL      +    S++WHFLD++WI +FSF+YL G+V
Sbjct: 140 HGAHVTFGVFWGMFIVYQLITRGLTPETANKSFIFSLYWHFLDVVWIFIFSFIYLKGMV 198


>gi|253574492|ref|ZP_04851833.1| quinol oxidase subunit 3 [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251846197|gb|EES74204.1| quinol oxidase subunit 3 [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 198

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 105/185 (56%), Gaps = 1/185 (0%)

Query: 26  DHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS 85
           ++    LGFW++L ++ ++FA  F  Y  L     +GP   ++F+I  +   T +LL SS
Sbjct: 15  ENSNRVLGFWLFLGAEIVLFATLFSVYLTLWNRTGSGPNGAEIFEIGPVLGETFLLLTSS 74

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSF 145
            +C  A + S    L    +++  +T   G+ F+ +EI EF   +   A  Q SAFLSS 
Sbjct: 75  FTCGLA-VHSMRLGLRKPFMAFFAITLLLGLGFLGIEITEFVTYVHEGATMQTSAFLSSL 133

Query: 146 FALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
           F L+G HG HV  GL+W   L+IQ+ ++G       +    S++WHFLD++WI +FSFVY
Sbjct: 134 FVLLGTHGAHVTLGLLWGSGLMIQVKREGFTHDTANKSFIFSLYWHFLDVVWIFIFSFVY 193

Query: 206 LMGVV 210
           L G++
Sbjct: 194 LKGLM 198


>gi|228899384|ref|ZP_04063645.1| Quinol oxidase subunit 3 [Bacillus thuringiensis IBL 4222]
 gi|228860238|gb|EEN04637.1| Quinol oxidase subunit 3 [Bacillus thuringiensis IBL 4222]
          Length = 168

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 100/168 (59%), Gaps = 1/168 (0%)

Query: 43  LMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIH 102
           ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C   ++    K    
Sbjct: 1   MLFATLFASYLVLAGRTADGPTPAQLFELKTLLIQTLLLLTSSFTCGI-VIHEMRKHNQK 59

Query: 103 KTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIW 162
             + W ++T   G  F+  EI EF   I   A  Q SAFLS+FF L+G HG HV  G+IW
Sbjct: 60  AMLGWFVLTLLLGAGFLFFEIEEFIMYIGEGATIQTSAFLSAFFVLLGTHGAHVTGGIIW 119

Query: 163 LFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
              ++IQILK+GL     R++  +S++WHFLDL+W+ +++ VYL G+V
Sbjct: 120 AICVIIQILKRGLTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMV 167


>gi|126649761|ref|ZP_01721997.1| cytochrome c oxidase subunit III [Bacillus sp. B14905]
 gi|126593480|gb|EAZ87425.1| cytochrome c oxidase subunit III [Bacillus sp. B14905]
          Length = 208

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 68/196 (34%), Positives = 116/196 (59%), Gaps = 9/196 (4%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPID-----VFDISGI 74
            +++ ++     +GFWI+L  + ++FA  F TY  L KN   GPA ++     +F++   
Sbjct: 16  PEQATLEGKNKVVGFWIFLACEVVLFASLFATYLAL-KN--KGPAGMEFTTQGLFELPLA 72

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
           F  T++LL SSL+  +A+             +WL +T   G+ F+ +EIYEF H + +  
Sbjct: 73  FAMTMLLLTSSLTSVYAIYHMRNFNF-KGMQTWLAITLALGLGFLALEIYEFQHYVHLGF 131

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
              +SAF ++F++LVG HG HV  GL+W+  L+I+  K+GL   N  +    +++WHF+D
Sbjct: 132 TFNQSAFATAFYSLVGTHGFHVTLGLVWIATLMIRNAKRGLNLYNAPKFFVAALYWHFID 191

Query: 195 LIWICVFSFVYLMGVV 210
           ++W+ +F+ VYLMGV+
Sbjct: 192 VVWVFIFTVVYLMGVI 207


>gi|228942997|ref|ZP_04105502.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228816661|gb|EEM62781.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar berliner
           ATCC 10792]
          Length = 168

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 100/168 (59%), Gaps = 1/168 (0%)

Query: 43  LMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIH 102
           ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C   ++    K    
Sbjct: 1   MLFATLFASYLVLAGRTADGPTPAQLFELKTLLIQTLLLLTSSFTCGI-VIHEMRKHNQK 59

Query: 103 KTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIW 162
             + W ++T   G  F+  EI EF   I   A  Q SAFLS+FF L+G HG HV  G+IW
Sbjct: 60  AMLGWFILTLLLGAGFLFFEIEEFIMYIGEGATIQTSAFLSAFFVLLGTHGAHVTGGIIW 119

Query: 163 LFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
              ++IQILK+GL     R++  +S++WHFLDL+W+ +++ VYL G+V
Sbjct: 120 ATCVIIQILKRGLTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMV 167


>gi|196042085|ref|ZP_03109370.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus
           NVH0597-99]
 gi|218901895|ref|YP_002449729.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus AH820]
 gi|228925887|ref|ZP_04088971.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|229120350|ref|ZP_04249600.1| Quinol oxidase subunit 3 [Bacillus cereus 95/8201]
 gi|229183033|ref|ZP_04310265.1| Quinol oxidase subunit 3 [Bacillus cereus BGSC 6E1]
 gi|196027110|gb|EDX65732.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus
           NVH0597-99]
 gi|218538909|gb|ACK91307.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus AH820]
 gi|228600490|gb|EEK58078.1| Quinol oxidase subunit 3 [Bacillus cereus BGSC 6E1]
 gi|228663160|gb|EEL18750.1| Quinol oxidase subunit 3 [Bacillus cereus 95/8201]
 gi|228833902|gb|EEM79455.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
          Length = 168

 Score =  118 bits (296), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 97/168 (57%), Gaps = 1/168 (0%)

Query: 43  LMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIH 102
           ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C  A +    K    
Sbjct: 1   MLFATLFASYLVLAGRTADGPTPAQLFEVKTLLIQTLLLLTSSFTCGIA-IHEMRKHNQK 59

Query: 103 KTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIW 162
             + W ++T   G  F+  EI EF       A  Q SAFLS FF L+G HG HV  G+IW
Sbjct: 60  AMLGWFILTLLLGAGFLFFEIEEFIIYAGKGATIQTSAFLSGFFVLLGTHGAHVTGGIIW 119

Query: 163 LFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
              ++IQILK+GL     R++  +S++WHFLD +WI +++ VYL G+V
Sbjct: 120 AICVIIQILKRGLTPVTARKVFIISLYWHFLDFVWIFIYTLVYLNGMV 167


>gi|228919551|ref|ZP_04082915.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228944451|ref|ZP_04106824.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|229137498|ref|ZP_04266108.1| Quinol oxidase subunit 3 [Bacillus cereus BDRD-ST26]
 gi|229154401|ref|ZP_04282520.1| Quinol oxidase subunit 3 [Bacillus cereus ATCC 4342]
 gi|229195024|ref|ZP_04321801.1| Quinol oxidase subunit 3 [Bacillus cereus m1293]
 gi|228588459|gb|EEK46500.1| Quinol oxidase subunit 3 [Bacillus cereus m1293]
 gi|228629049|gb|EEK85757.1| Quinol oxidase subunit 3 [Bacillus cereus ATCC 4342]
 gi|228645945|gb|EEL02169.1| Quinol oxidase subunit 3 [Bacillus cereus BDRD-ST26]
 gi|228815353|gb|EEM61601.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228840194|gb|EEM85471.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 168

 Score =  118 bits (296), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 99/168 (58%), Gaps = 1/168 (0%)

Query: 43  LMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIH 102
           ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C   ++    K    
Sbjct: 1   MLFATLFASYLVLAGRTADGPTPAQLFELKTLLIQTLLLLTSSFTCGI-VIHEMRKHNQK 59

Query: 103 KTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIW 162
             + W ++T   G  F+  EI EF   I   A  Q SAFLS FF L+G HG HV  G+IW
Sbjct: 60  AMLGWFVLTLLLGAGFLFFEIEEFIMYIGEGATIQTSAFLSGFFVLLGTHGAHVTGGIIW 119

Query: 163 LFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
              ++IQILK+GL     R++  +S++WHFLDL+W+ +++ VYL G+V
Sbjct: 120 AICVIIQILKRGLTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMV 167


>gi|229089762|ref|ZP_04221022.1| Quinol oxidase subunit 3 [Bacillus cereus Rock3-42]
 gi|228693570|gb|EEL47273.1| Quinol oxidase subunit 3 [Bacillus cereus Rock3-42]
          Length = 168

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 97/168 (57%), Gaps = 1/168 (0%)

Query: 43  LMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIH 102
           ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C  A +    K    
Sbjct: 1   MLFATLFASYLVLAGRTADGPTPAQLFEVKTLLIQTLLLLTSSFTCGIA-IHEMRKHNQK 59

Query: 103 KTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIW 162
             + W ++T   G  F+  EI EF       A  Q SAFLS FF L+G HG HV  G+IW
Sbjct: 60  AMLGWFILTLLLGAGFLFFEIEEFIIYAGKGATLQTSAFLSGFFVLLGTHGAHVTGGIIW 119

Query: 163 LFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
              ++IQILK+GL     R++  +S++WHFLD +WI +++ VYL G+V
Sbjct: 120 AICVIIQILKRGLTPVTARKVFIISLYWHFLDFVWIFIYTLVYLNGMV 167


>gi|299534636|ref|ZP_07047968.1| cytochrome c oxidase subunit 3 [Lysinibacillus fusiformis ZC1]
 gi|298730009|gb|EFI70552.1| cytochrome c oxidase subunit 3 [Lysinibacillus fusiformis ZC1]
          Length = 208

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 68/196 (34%), Positives = 116/196 (59%), Gaps = 9/196 (4%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPID-----VFDISGI 74
            +++ ++     +GFWI+L  + ++FA  F TY  L KN   GPA ++     +F++   
Sbjct: 16  PEQATMEGKNKVVGFWIFLACEVVLFASLFATYLAL-KN--KGPAGMEFTTQGLFELPLA 72

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
           F  T++LL SSL+  +A+             +WL +T   G+ F+ +EIYEF H + +  
Sbjct: 73  FAMTMLLLTSSLTSVYAIYHMRNFNF-KGMQTWLAITLALGLGFLALEIYEFNHYVHLGF 131

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
              +SAF ++F++LVG HG HV  GL+W+  L+I+  K+GL   N  +    +++WHF+D
Sbjct: 132 TFNQSAFATAFYSLVGTHGFHVTLGLVWIGTLMIRNAKRGLNLYNAPKFFVAALYWHFID 191

Query: 195 LIWICVFSFVYLMGVV 210
           ++W+ +F+ VYLMGV+
Sbjct: 192 VVWVFIFTVVYLMGVI 207


>gi|229918524|ref|YP_002887170.1| Cytochrome-c oxidase [Exiguobacterium sp. AT1b]
 gi|229469953|gb|ACQ71725.1| Cytochrome-c oxidase [Exiguobacterium sp. AT1b]
          Length = 208

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 111/195 (56%), Gaps = 6/195 (3%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI---DVFDISGIF 75
           + +++ ++    Y+ FW +L  + ++FA  F TY  +G   +  P  +   ++F++  +F
Sbjct: 16  NPEKATLEGKNKYVAFWFFLGGETVLFASLFGTY--VGLLNSGAPEELRSYNIFEMELVF 73

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           + T++LL SSL+   AM+         +   WL+VT   G  F+  EIYEF H   +   
Sbjct: 74  IMTMLLLTSSLTSVLAMMNMKANN-PGRMKLWLIVTLLLGAGFLGAEIYEFIHYYHIGHT 132

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
              SAF S+F+ LVG HG HV FGL+W+  L+I+   + +   N  +    S++WHF+D+
Sbjct: 133 FTSSAFGSAFYTLVGFHGAHVTFGLLWITTLLIRNWNRPIDVYNAPKFYVSSLYWHFIDV 192

Query: 196 IWICVFSFVYLMGVV 210
           +W+ +FS VYL+G+V
Sbjct: 193 VWVFIFSIVYLLGMV 207


>gi|198282919|ref|YP_002219240.1| heme/copper-type cytochrome/quinol oxidase subunit 3-like protein
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218665051|ref|YP_002425122.1| cytochrome o ubiquinol oxidase, subunit III [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198247440|gb|ACH83033.1| heme/copper-type cytochrome/quinol oxidase subunit 3-like protein
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218517264|gb|ACK77850.1| cytochrome o ubiquinol oxidase, subunit III [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 211

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 73/210 (34%), Positives = 108/210 (51%), Gaps = 4/210 (1%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG--KN 58
           MS       P  +  + K   +  V    T+ G+++YL+SD ++FA  F  Y VL    +
Sbjct: 1   MSSHTSNVDPKTAELWDKSHYQHDVISTRTF-GYFMYLLSDGMLFATLFAAYGVLSYQHS 59

Query: 59  YAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIF 118
           Y  GP P D       F  T+ L +S L+  F M A   K      ++ LL    FG++F
Sbjct: 60  YFGGPTPADFVKPWYTFAQTMALFVSVLAYGFGMNALKHKNK-SAVINGLLAAFVFGVLF 118

Query: 119 IIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISG 178
           + ++I++   L S+      S  +S+F  L  +H  HVFFGLIW+ V++ Q+L KG  + 
Sbjct: 119 LALDIHDMTQLASLGITVATSGGISAFIILTQVHAAHVFFGLIWILVMMAQVLTKGFTTE 178

Query: 179 NQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
              RL+ L MFWH   +IW+ VF FVYL G
Sbjct: 179 VVGRLLTLRMFWHLQAIIWVFVFVFVYLWG 208


>gi|54296267|ref|YP_122636.1| cytochrome o ubiquinol oxidase subunit III cyoC [Legionella
           pneumophila str. Paris]
 gi|53750052|emb|CAH11444.1| Cytochrome o ubiquinol oxidase subunit III cyoC [Legionella
           pneumophila str. Paris]
          Length = 198

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 112/187 (59%), Gaps = 4/187 (2%)

Query: 26  DHDGTYL-GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLS 84
           D D T + GFW+Y+++DC++F   F T+ VL      GPA  +  ++  + + T +LL+S
Sbjct: 14  DSDSTDVFGFWMYILTDCILFGCLFATFLVLNNPGYPGPALKNYVNLHDVLIETFLLLIS 73

Query: 85  SLSCSFAMLA-SATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLS 143
           + +   A+L     KR  HK   WL +T   G  FI ME+ EF H+ +       S  +S
Sbjct: 74  NFTFCLAILNLYQDKR--HKVQLWLGITFLLGAGFISMEVTEFIHMANEGFRWDVSGAIS 131

Query: 144 SFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           SFF LVG HGLHV FGL+W+ +++IQ+    L    +RR+  L +FW+FLD++WI VF+ 
Sbjct: 132 SFFTLVGTHGLHVGFGLLWILIIIIQLPLIKLNHVKRRRMTYLGLFWNFLDIVWIFVFTI 191

Query: 204 VYLMGVV 210
           VYLMG +
Sbjct: 192 VYLMGAI 198


>gi|319649712|ref|ZP_08003868.1| cytochrome c oxidase subunit III [Bacillus sp. 2_A_57_CT2]
 gi|317398874|gb|EFV79556.1| cytochrome c oxidase subunit III [Bacillus sp. 2_A_57_CT2]
          Length = 209

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/195 (35%), Positives = 110/195 (56%), Gaps = 4/195 (2%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI--DVFDISGIFV 76
             ++  ++    +LGFW +L  + ++FA  F TY  L     +    +  D+F+I   F+
Sbjct: 15  SPEKQTLEAKNKFLGFWFFLGGETVLFASLFATYLALKDKVPSSDMALAKDLFEIPLAFI 74

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI-SMEAV 135
            T++LL SSL+  +AM          K   WL +T   G+ F+ +EIYEF H +      
Sbjct: 75  MTMLLLTSSLTSVYAMYHMKNFNF-KKMQLWLGITVLLGLGFLGLEIYEFNHYVHEFHHS 133

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
              SAF S+F+ LVG HG HV FGL+W+  L+I+  K+GL   N  +    S++WHF+D+
Sbjct: 134 FTSSAFGSAFYTLVGFHGGHVAFGLLWITTLMIRNSKRGLSLYNAPKFYVASLYWHFIDV 193

Query: 196 IWICVFSFVYLMGVV 210
           +W+ +F+ VYLMG+V
Sbjct: 194 VWVFIFTVVYLMGMV 208


>gi|289807960|ref|ZP_06538589.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhi str. AG3]
          Length = 103

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 70/93 (75%)

Query: 103 KTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIW 162
           + +SWL +T  FG  FI MEIYEF HLI     P RS FLS+FFALVG HGLHV  GLIW
Sbjct: 11  QVISWLALTFLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIW 70

Query: 163 LFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           + VL++Q+ ++GL S N+ R++CLS+FWHFLD+
Sbjct: 71  MAVLMVQVARRGLTSTNRTRIMCLSLFWHFLDV 103


>gi|222150984|ref|YP_002560137.1| cytochrome c oxidase subunit III [Macrococcus caseolyticus
           JCSC5402]
 gi|222120106|dbj|BAH17441.1| cytochrome c oxidase subunit III [Macrococcus caseolyticus
           JCSC5402]
          Length = 209

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 112/192 (58%), Gaps = 3/192 (1%)

Query: 21  KESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI--DVFDISGIFVST 78
           + + ++     LGFWI+L  +  +FA  F TY  L  +  +    +  D+F +   FV T
Sbjct: 18  ETASLEGKNKLLGFWIFLGGETALFASLFATYLALKDHVPSEDHLLAKDLFHLPLAFVMT 77

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           ++LL SSL+  +A L         K ++WL++T   G+ F+ +EIYEF   +      + 
Sbjct: 78  MLLLTSSLTSVYA-LYHMKNYDFKKMITWLIITVLLGLGFLGLEIYEFVEYVHKGHTFRS 136

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF S+F+ LVG HG HV  GL W+ +L+++ +K+GL   N  +    +++WHF+D++W+
Sbjct: 137 SAFGSAFYFLVGTHGFHVIIGLTWIILLIVRNMKRGLSVYNAAKFNTAALYWHFIDVVWV 196

Query: 199 CVFSFVYLMGVV 210
            +F+ VYL+GV+
Sbjct: 197 FIFTVVYLLGVL 208


>gi|319654029|ref|ZP_08008121.1| cytochrome aa3 quinol oxidase subunit III [Bacillus sp. 2_A_57_CT2]
 gi|317394222|gb|EFV74968.1| cytochrome aa3 quinol oxidase subunit III [Bacillus sp. 2_A_57_CT2]
          Length = 198

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 102/179 (56%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++  +F   F +Y  L     +GP   ++F+I+ + + TI+LL SS +    
Sbjct: 21  LGFWIFLGAEIALFGTLFASYFTLVDRTGSGPTGAEIFEITPVLIETILLLTSSFTIGLG 80

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           + A    +     +++  +T   G+ F+ +EIY+F   I   A  Q S F +  F  +G 
Sbjct: 81  IHAMRLGK-AKAMITFFAITLLLGLGFLGVEIYDFIVYIHEGATLQTSGFTAILFLTLGT 139

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV FGL W   +++Q++K+GL      +    S++WHFLD++WI +FSFV+L G++
Sbjct: 140 HGAHVTFGLFWGAFIILQVIKRGLTPETANKAFIFSLYWHFLDVVWIFIFSFVFLKGMM 198


>gi|255020823|ref|ZP_05292879.1| Cytochrome O ubiquinol oxidase subunit III [Acidithiobacillus
           caldus ATCC 51756]
 gi|254969614|gb|EET27120.1| Cytochrome O ubiquinol oxidase subunit III [Acidithiobacillus
           caldus ATCC 51756]
          Length = 212

 Score =  111 bits (277), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 64/179 (35%), Positives = 99/179 (55%), Gaps = 3/179 (1%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLG--KNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           LGF++YL+SD ++FA  F  Y VL    +Y  GP P D       F  TI L LS L+  
Sbjct: 32  LGFFLYLLSDGMIFATLFAAYGVLSYQHSYFGGPTPADFVKPWYTFSQTIALFLSVLAYG 91

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
             M A   +R     ++ LL     G++F++++I++   L +       S  +S+F  L 
Sbjct: 92  MGMTA-LKRRSRGGLINGLLGAFVLGVLFLVLDIHDVLDLAAHGITVATSGGISAFIVLT 150

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
            +H  H+FFGL+W+ V++ Q+L+ G  +    RL+ L MFWHF  ++W+ V+ FVYL G
Sbjct: 151 QVHAAHIFFGLLWILVMIYQVLRLGFTADTVGRLLSLRMFWHFQAVVWVFVYIFVYLWG 209


>gi|229025387|ref|ZP_04181805.1| Cytochrome c oxidase subunit 3 [Bacillus cereus AH1272]
 gi|228735972|gb|EEL86549.1| Cytochrome c oxidase subunit 3 [Bacillus cereus AH1272]
          Length = 169

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 100/169 (59%), Gaps = 2/169 (1%)

Query: 43  LMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIH 102
           ++FA  F TY  L  +   GP   ++F +  +F+ T++LL SSL+  +AM          
Sbjct: 1   MLFASLFGTYLALKNSTNGGPTSQEMFQMPLVFIMTMLLLTSSLTSVYAMYHMKNFNF-K 59

Query: 103 KTVSWLLVTAFFGMIFIIMEIYEFAHLI-SMEAVPQRSAFLSSFFALVGLHGLHVFFGLI 161
           K   WLLVT   G+ F+  EIYEF H     +   + SAF S+F+ALVG HGLHV FGL 
Sbjct: 60  KMQLWLLVTVLLGLGFLGFEIYEFYHYTHEFKHTMRSSAFGSAFYALVGTHGLHVLFGLC 119

Query: 162 WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           W+  L+ +  K+GL   N  +    S++WHF+D++W+ +F+ VYLMG+V
Sbjct: 120 WILTLIFRNAKRGLNLYNAPKFYVASIYWHFIDVVWVFIFTVVYLMGMV 168


>gi|226225912|ref|YP_002760018.1| cytochrome c oxidase subunit III [Gemmatimonas aurantiaca T-27]
 gi|226089103|dbj|BAH37548.1| cytochrome c oxidase subunit III [Gemmatimonas aurantiaca T-27]
          Length = 230

 Score =  107 bits (268), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 102/203 (50%), Gaps = 24/203 (11%)

Query: 28  DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVF-------------DISGI 74
           D   +  W ++ S+C++FA    TY +       GP P +V+             +I   
Sbjct: 28  DNRKIAIWTFIGSECMLFASLISTYLIYKGRSPEGPYPHEVWTNPATGQVFKPILNIPVT 87

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVS----------WLLVTAFFGMIFIIMEIY 124
             ST VLL+SSL+   A LA+   R + KT +          WL +T   G++F+  + Y
Sbjct: 88  SASTFVLLMSSLAMVLA-LAAVQNRHVPKTTTGERILGNSKLWLWMTCLLGIVFLGCQAY 146

Query: 125 EFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLI 184
           EF   I      + + F SSFF L G HG HV  G+IWLF L+    K+GL   +   + 
Sbjct: 147 EFTSFIHEGLTIRTNLFGSSFFTLTGFHGAHVTAGVIWLFTLLAIDYKRGLEPKDSLLVD 206

Query: 185 CLSMFWHFLDLIWICVFSFVYLM 207
             +++WHF+D+IWI +F+ VYL+
Sbjct: 207 IAALYWHFVDVIWIVIFTLVYLI 229


>gi|269837612|ref|YP_003319840.1| cytochrome c oxidase subunit III [Sphaerobacter thermophilus DSM
           20745]
 gi|269786875|gb|ACZ39018.1| cytochrome c oxidase subunit III [Sphaerobacter thermophilus DSM
           20745]
          Length = 208

 Score =  107 bits (268), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 67/174 (38%), Positives = 95/174 (54%), Gaps = 3/174 (1%)

Query: 35  WIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLA 94
           W +L SDC+ F    +TY V       GP P DVF+I    VS  VLLLSSL+   A+  
Sbjct: 35  WTFLASDCMFFGSLIMTYMVYRGRSLNGPYPDDVFNIPFTSVSAAVLLLSSLTMVLAL-- 92

Query: 95  SATKRLIHKTVS-WLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHG 153
           SA +R   K    W+L TA  G++F+  + YEF     +      + F SSFF L G+HG
Sbjct: 93  SALQRGKIKVFRVWILATALLGLLFLGGQYYEFTEFSHLGLGLGTNVFGSSFFVLTGIHG 152

Query: 154 LHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
            HV  G+IWL  L     +  +   N  ++    ++WHF+D++WI +F+FVYL+
Sbjct: 153 THVGLGIIWLLTLFAFSFRGLVRQDNAEKVEIAGLYWHFVDIVWIVIFTFVYLL 206


>gi|255019615|ref|ZP_05291696.1| Cytochrome O ubiquinol oxidase subunit III [Acidithiobacillus
           caldus ATCC 51756]
 gi|254970959|gb|EET28440.1| Cytochrome O ubiquinol oxidase subunit III [Acidithiobacillus
           caldus ATCC 51756]
          Length = 211

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 69/210 (32%), Positives = 109/210 (51%), Gaps = 4/210 (1%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG--KN 58
           MS  +    P+    + +D     V    T+ GFW+Y++SD ++FA  F  Y VL    +
Sbjct: 1   MSHAETVVDPDKVRLWSEDYDGHDVISTRTF-GFWMYVLSDAMLFATLFAAYGVLSYPHS 59

Query: 59  YAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIF 118
           Y  GP P         F  T+ L LS L   +AM  S  +      ++ LL     G++F
Sbjct: 60  YYTGPTPAQFVTPWYTFTQTMALFLSVLIYGWAM-TSLKEGNKSGVINGLLGALVLGVLF 118

Query: 119 IIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISG 178
           + ++I++   LI+    P+ S  LS+F+ L  +H  H+F GLIW+ V++ Q+ +KG+   
Sbjct: 119 LALDIHDVMRLIAAGITPEVSGGLSAFYCLTQVHAAHIFAGLIWIVVMLWQVARKGVTED 178

Query: 179 NQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
              RLI L MFW F  ++W+ ++ FVYL G
Sbjct: 179 VVGRLISLRMFWQFQAVMWVFIYVFVYLWG 208


>gi|116515213|ref|YP_802842.1| CyoC [Buchnera aphidicola str. Cc (Cinara cedri)]
 gi|116257067|gb|ABJ90749.1| cytochrome o ubiquinol oxidase subunit III [Buchnera aphidicola
           str. Cc (Cinara cedri)]
          Length = 194

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 64/183 (34%), Positives = 103/183 (56%), Gaps = 4/183 (2%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKN-YAAGPAPIDVFDISGIFV 76
           KD        + + LGFWIYLMSDC++F+V F+ + ++ ++ Y        +F    +F+
Sbjct: 5   KDYVSYSSLKNNSILGFWIYLMSDCIIFSVLFIVHIIMSRHGYNGFLRENKLFSKFVLFL 64

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLL-VTAFFGMIFIIMEIYEFAHLISMEAV 135
            T++LL  SLS  F+++    K+   K + + L +T   G  FI +E +EF ++I     
Sbjct: 65  ETLILLFCSLS--FSLIKYFLKKSYKKCILFFLFITLILGSTFISLEFFEFLNIIEKGFF 122

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           P  + + SSF+ L+ +HGLHV FGL+W+ + + Q       +     LIC  +FWHFLD+
Sbjct: 123 PNTNGYFSSFYVLLCIHGLHVIFGLLWIIISIFQFFFLKFSNFLYISLICCCLFWHFLDI 182

Query: 196 IWI 198
           IWI
Sbjct: 183 IWI 185


>gi|262279559|ref|ZP_06057344.1| LOW QUALITY PROTEIN: cytochrome o ubiquinol oxidase subunit III
           [Acinetobacter calcoaceticus RUH2202]
 gi|262259910|gb|EEY78643.1| LOW QUALITY PROTEIN: cytochrome o ubiquinol oxidase subunit III
           [Acinetobacter calcoaceticus RUH2202]
          Length = 74

 Score =  104 bits (259), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 50/74 (67%), Positives = 58/74 (78%)

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
             SAFLSSFF LVG HG+HV  GL+W+ VL+ QI K GL   N RRL CLS+FWHFLD++
Sbjct: 1   THSAFLSSFFTLVGTHGIHVTSGLVWMLVLMYQIKKNGLTLPNTRRLACLSLFWHFLDIV 60

Query: 197 WICVFSFVYLMGVV 210
           WICVFS VYLMGV+
Sbjct: 61  WICVFSVVYLMGVL 74


>gi|182413887|ref|YP_001818953.1| cytochrome c oxidase subunit III [Opitutus terrae PB90-1]
 gi|177841101|gb|ACB75353.1| cytochrome c oxidase subunit III [Opitutus terrae PB90-1]
          Length = 204

 Score =  103 bits (258), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 59/175 (33%), Positives = 96/175 (54%), Gaps = 3/175 (1%)

Query: 35  WIYLMSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVFDISGIFVSTIVLLLSSLSCSFAML 93
           W +L SDC+ F     ++ +      AG P+P ++FD+     ST +LL+SSL  + A+ 
Sbjct: 28  WAFLASDCMFFGTLIASHLIYRLYPPAGTPSPKEIFDLPLTSFSTFILLMSSLMMALAVN 87

Query: 94  ASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFL-SSFFALVGLH 152
           A     +     S LL TAFFG IF+  ++YEF H +  + +    + L S+F+ L G H
Sbjct: 88  AIQKGNVRSMRFS-LLTTAFFGAIFLGCQVYEFTHFVHEKGLTITGSILGSTFYTLTGTH 146

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           GLHV  G+IWL  + +      +       +  + ++WHF+D++WI +F+ VYL+
Sbjct: 147 GLHVLIGVIWLMSMYLYSFTGRVTQKEAIDVESMGLYWHFVDIVWIVIFTAVYLL 201


>gi|167581213|ref|ZP_02374087.1| Cytochrome c oxidase subunit III [Burkholderia thailandensis TXDOH]
          Length = 126

 Score =  103 bits (257), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 71/113 (62%), Gaps = 3/113 (2%)

Query: 26  DHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLL 83
           DH  ++   GFW+YLM+DC++FA  F T+AVLG  +A GP   D+FDI G+ + T  LLL
Sbjct: 15  DHPPSHSVFGFWLYLMTDCVLFAALFATFAVLGNQFAGGPTAKDLFDIPGVALETAALLL 74

Query: 84  SSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
           SS++  FAM+  A KR       WL VT   G  F+ ME+ EF+HLI+  A P
Sbjct: 75  SSITYGFAMI-GAHKRRRGAVFGWLAVTFVLGAAFLAMELREFSHLIAEGAGP 126


>gi|221632719|ref|YP_002521940.1| CoxC [Thermomicrobium roseum DSM 5159]
 gi|221156906|gb|ACM06033.1| CoxC [Thermomicrobium roseum DSM 5159]
          Length = 201

 Score =  101 bits (251), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 64/202 (31%), Positives = 94/202 (46%), Gaps = 3/202 (1%)

Query: 6   IGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAP 65
           +G S         +   + + H+   L  W +L SDC+ F      Y      Y   P P
Sbjct: 1   MGHSVTAQAHPAGEHTTTGISHN--RLMMWTFLASDCMFFVSLIWVYFAYRGRYFEPPYP 58

Query: 66  IDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYE 125
            DV DI    VS  VLLLSS +   + L +  +  +     WLL T   G +F+  + YE
Sbjct: 59  RDVLDIPYTSVSAAVLLLSSFAIVMS-LTALERGDMRGFRGWLLGTILLGALFLGGQYYE 117

Query: 126 FAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLIC 185
           F            + F ++FF L G HG HVF G++WL V  +  L   L + +  R   
Sbjct: 118 FTTFYHEGLTLTSNLFGTTFFVLTGFHGTHVFIGIVWLLVQWLLSLFGKLTTAHVERFFV 177

Query: 186 LSMFWHFLDLIWICVFSFVYLM 207
            +++WHF+D++WI +F  VYLM
Sbjct: 178 TTLYWHFVDIVWIVIFMLVYLM 199


>gi|156743494|ref|YP_001433623.1| cytochrome c oxidase subunit III [Roseiflexus castenholzii DSM
           13941]
 gi|156234822|gb|ABU59605.1| cytochrome c oxidase subunit III [Roseiflexus castenholzii DSM
           13941]
          Length = 203

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 64/184 (34%), Positives = 91/184 (49%), Gaps = 6/184 (3%)

Query: 28  DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPA---PIDVFDISGIFVSTIVLLLS 84
           D   LG W ++ S+ L FA    TY V      A P    P +  DI    V   +LL S
Sbjct: 22  DNRKLGVWAFIGSETLFFATLITTYFVFAPVNRARPDFQDPREFLDIELTTVLASILLAS 81

Query: 85  SLSCSFAMLASATKRLIHKT-VSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLS 143
           SL+   A+  SA+KR   +   +WLL T   G+ FI  ++YEF HL         S F +
Sbjct: 82  SLTMVLAL--SASKRGDRRWFTTWLLATVGLGLAFIGGQVYEFNHLYHEGLTLSSSLFGT 139

Query: 144 SFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           +FF L G HG HV  G+IWL  +  ++        N   +    ++WHF+DL+W+ +F  
Sbjct: 140 TFFVLTGFHGTHVAIGVIWLLSVFFKVRTYPNSPENAMDVEIAGLYWHFVDLVWVAIFVL 199

Query: 204 VYLM 207
           VYL+
Sbjct: 200 VYLI 203


>gi|297625014|ref|YP_003706448.1| cytochrome c oxidase subunit III [Truepera radiovictrix DSM 17093]
 gi|297166194|gb|ADI15905.1| cytochrome c oxidase subunit III [Truepera radiovictrix DSM 17093]
          Length = 203

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 103/194 (53%), Gaps = 8/194 (4%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF 75
           + + +  S  D     L  WI+L SDC+ FA    TY V       GP P ++ DI    
Sbjct: 13  HAEHRSTSLSDRK---LLMWIFLASDCMFFAALIGTYLVYKGRSLVGPYPTEILDIPLTT 69

Query: 76  VSTIVLLLSSLSCSFAMLASATKRL--IHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           +ST VLL+SS      +LA    RL  I K   W L    FG IF+  ++YEF+H +   
Sbjct: 70  ISTFVLLMSSF---LMVLALHAIRLGDIPKFRLWTLGVCLFGSIFLGFQVYEFSHFVHEG 126

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
              QR+ F ++FF L G HG+HV  G++WL  L+I    + + + +   +    ++WHF+
Sbjct: 127 LTLQRNLFGTTFFTLTGTHGIHVSVGVLWLLSLLITSYVRPMSAKDALGVEIAGLYWHFV 186

Query: 194 DLIWICVFSFVYLM 207
           D++WI +F+ VYL+
Sbjct: 187 DIVWIVIFTAVYLV 200


>gi|148656389|ref|YP_001276594.1| cytochrome c oxidase subunit III [Roseiflexus sp. RS-1]
 gi|148568499|gb|ABQ90644.1| cytochrome c oxidase, subunit III [Roseiflexus sp. RS-1]
          Length = 202

 Score = 98.6 bits (244), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 91/184 (49%), Gaps = 6/184 (3%)

Query: 28  DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPA---PIDVFDISGIFVSTIVLLLS 84
           D   LG W ++ S+ L FA    TY V      A P    P +  DI    V   +LL S
Sbjct: 21  DNRKLGVWAFIGSETLFFATLITTYFVFAPVNRARPDFQDPREFLDIELTTVLASILLAS 80

Query: 85  SLSCSFAMLASATKRLIHKT-VSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLS 143
           SL+   A+  SA++R   ++  +WLL T   G+ FI  + YEF HL         S F +
Sbjct: 81  SLTMVLAL--SASRRGDRRSFTTWLLATVGLGLAFIGGQAYEFNHLYHEGLTLSSSLFGT 138

Query: 144 SFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           +FF L G HG HV  G+IWL  +  ++        N   +    ++WHF+DL+W+ +F  
Sbjct: 139 TFFVLTGFHGTHVAIGVIWLLSVFFKVRAYPDSPENVMDVEIAGLYWHFVDLVWVAIFVL 198

Query: 204 VYLM 207
           VYL+
Sbjct: 199 VYLI 202


>gi|297566737|ref|YP_003685709.1| cytochrome c oxidase subunit III [Meiothermus silvanus DSM 9946]
 gi|296851186|gb|ADH64201.1| cytochrome c oxidase subunit III [Meiothermus silvanus DSM 9946]
          Length = 225

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 105/193 (54%), Gaps = 25/193 (12%)

Query: 35  WIYLMSDCLMFAVFFVTYA---VLGKNYAAGPAPIDVFDIS---------GIFVSTIVLL 82
           WI+L+SD  +F  F  +YA   +      + P+P +VF +           I + T+VL+
Sbjct: 36  WIFLLSDTFIFGSFITSYASARLAASATNSWPSPKEVFALRIGETEVPLLLIAIMTVVLI 95

Query: 83  LSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI---------SME 133
            SS + + A+  +  KR + +T  ++++TA  G+ F+ M+ +E+ HLI         +  
Sbjct: 96  SSSGTMAIAVYHAYAKRKV-QTAIFMVLTALLGLTFVSMQAFEWTHLIVDLGFRPWANPM 154

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
             PQ   F SSFF L G HGLHV  G+I+L  + +++LK     G+   +    ++WHF+
Sbjct: 155 GAPQ---FGSSFFMLTGFHGLHVTIGVIYLTAVAVRVLKGVYDRGSYVGVEICGLYWHFV 211

Query: 194 DLIWICVFSFVYL 206
           DL+W+ +F+F YL
Sbjct: 212 DLVWVFIFAFFYL 224


>gi|228941103|ref|ZP_04103659.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228818556|gb|EEM64625.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           berliner ATCC 10792]
          Length = 144

 Score = 93.2 bits (230), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/144 (41%), Positives = 88/144 (61%), Gaps = 2/144 (1%)

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
           +F +  +F+ T++LL SSL+  +AM          K   WLLVT   G+ F+  EIYEF 
Sbjct: 1   MFQMPLVFIMTMLLLTSSLTSVYAMYHMKNFNF-KKMQLWLLVTVLLGLGFLGFEIYEFY 59

Query: 128 HLI-SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
           H     +   + SAF S+F+ALVG HGLHV FGL W+  L+ +  K+GL   N  +    
Sbjct: 60  HYTHEFKHTMRSSAFGSAFYALVGTHGLHVLFGLCWILTLIFRNAKRGLNLYNAPKFYVA 119

Query: 187 SMFWHFLDLIWICVFSFVYLMGVV 210
           S++WHF+D++W+ +F+ VYLMG+V
Sbjct: 120 SIYWHFIDVVWVFIFTVVYLMGMV 143


>gi|294054191|ref|YP_003547849.1| cytochrome c oxidase subunit III [Coraliomargarita akajimensis DSM
           45221]
 gi|293613524|gb|ADE53679.1| cytochrome c oxidase subunit III [Coraliomargarita akajimensis DSM
           45221]
          Length = 208

 Score = 92.4 bits (228), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 54/183 (29%), Positives = 98/183 (53%), Gaps = 6/183 (3%)

Query: 28  DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS-- 85
           D   L  W++L SDC+ F     T+ +  K Y     P  +F +     ST +LL+SS  
Sbjct: 19  DNKKLLMWLFLGSDCMFFGTLISTHLIYRKLYPDEFEPTTLFSLELTSFSTFILLMSSFL 78

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSF 145
           ++ S + +     +   + VS ++   FFG+IF+  ++YEF+  +  +   Q   F S+F
Sbjct: 79  MALSVSAMHKGQLKSFRRNVSGVI---FFGLIFLGCQVYEFSEFVHHDLTLQTGTFGSTF 135

Query: 146 FALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS-MFWHFLDLIWICVFSFV 204
           F L G+HG+HV  G+ WL  ++   +   + +      + ++ ++WHF+D++WI +F+ V
Sbjct: 136 FLLTGIHGVHVAIGVFWLISMLFYSMNGKMDAHESAVDVEVAGLYWHFVDIVWIIIFTAV 195

Query: 205 YLM 207
           YL+
Sbjct: 196 YLI 198


>gi|167577011|ref|ZP_02369885.1| Cytochrome c oxidase subunit III [Burkholderia thailandensis TXDOH]
          Length = 129

 Score = 92.0 bits (227), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 45/113 (39%), Positives = 70/113 (61%), Gaps = 3/113 (2%)

Query: 26  DHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLL 83
           DH  ++   GFW+YLM+DC++FA  F  +AV+   +A GP  +D+FDI G+ + T +LL+
Sbjct: 18  DHPPSHSVFGFWLYLMTDCVIFAALFAVFAVMAHQFAGGPTAVDLFDIPGVALETALLLV 77

Query: 84  SSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
           SS++  FAM+ +   R       WL VT   G  F+ +E+ EF+H+I+  A P
Sbjct: 78  SSITYGFAMIGAQRGRR-GALFGWLAVTFALGAAFLGLELREFSHMIAEGAGP 129


>gi|73537470|ref|YP_297837.1| cytochrome-C oxidase subunit III oxidoreductase protein [Ralstonia
           eutropha JMP134]
 gi|72120807|gb|AAZ62993.1| probable cytochrome-C oxidase subunit III oxidoreductase protein
           [Ralstonia eutropha JMP134]
          Length = 231

 Score = 91.3 bits (225), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 102/191 (53%), Gaps = 22/191 (11%)

Query: 35  WIYLMSDCLMFAVFFVTY-AVLGKNYAAGPAPIDVF-------DISGIFVSTIVLLLSSL 86
           WI+L+SD  +F+ F   Y  V        P P +VF       D+  + ++ +  +L + 
Sbjct: 43  WIFLLSDTFVFSCFLTGYMTVRMATTVPWPNPSEVFGLRIGGHDVPLLLIAIMTFVLITS 102

Query: 87  SCSFAMLAS-ATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV---------P 136
           S + AM  + A +R   +    +LVTA FG  F+ M+ +E+  LI  E V         P
Sbjct: 103 SGTMAMAVNFAYRRQRRQCALLMLVTALFGATFVCMQAFEWTKLIVEEGVRPWGNPMGAP 162

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILK-KGLISGNQRRLICLSMFWHFLDL 195
           Q   F S+FF + G HGLHV  G+I+L ++  ++L+ +  ++GN + +    ++WHF+DL
Sbjct: 163 Q---FGSTFFMITGFHGLHVSCGVIYLLIVATKVLRGRYEVTGNYQIVEIAGLYWHFVDL 219

Query: 196 IWICVFSFVYL 206
           +W+ +F+  YL
Sbjct: 220 VWVFIFALFYL 230


>gi|194292512|ref|YP_002008419.1| cytochrome-c oxidase subunit iii oxidoreductase protein
           [Cupriavidus taiwanensis LMG 19424]
 gi|193226416|emb|CAQ72365.1| cytochrome-C oxidase subunit III oxidoreductase protein
           [Cupriavidus taiwanensis LMG 19424]
          Length = 238

 Score = 91.3 bits (225), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 104/188 (55%), Gaps = 16/188 (8%)

Query: 35  WIYLMSDCLMFAVFFVTY-AVLGKNYAAGPAPIDVF-------DISGIFVSTIVLLLSSL 86
           WI+L+SD  +F+ F   Y  V        P P +VF       DI  + ++ +  +L + 
Sbjct: 50  WIFLLSDTFVFSCFLTGYMTVRMSTTVPWPNPSEVFALHVGGADIPLLLIAIMTFVLITS 109

Query: 87  SCSFAMLAS-ATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV-----PQRSA 140
           S + AM  + A +R   +  + + VTA FG++F+ M+ +E+  LI  E V     P  +A
Sbjct: 110 SGTMAMAVNFAYRRARRECATLMFVTAAFGVLFVGMQAFEWTKLIVDEGVRPWSNPMGAA 169

Query: 141 -FLSSFFALVGLHGLHVFFGLIWLFVLVIQILK-KGLISGNQRRLICLSMFWHFLDLIWI 198
            F S+FF + G HGLHV  G+I+L V+  ++L+ +   +GN + +    ++WHF+DL+W+
Sbjct: 170 QFGSTFFMITGFHGLHVSCGVIYLLVVATRVLRGRYEATGNYQIVEIAGLYWHFVDLVWV 229

Query: 199 CVFSFVYL 206
            +F+  YL
Sbjct: 230 FIFALFYL 237


>gi|213417283|ref|ZP_03350427.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhi str. E01-6750]
          Length = 130

 Score = 90.5 bits (223), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/98 (47%), Positives = 63/98 (64%), Gaps = 1/98 (1%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSDC++F++ F TYAVL    A GP   D+F++  + V T +LL SS++   A 
Sbjct: 28  GFWVYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAA 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
           +A   K    + +SWL +T  FG  FI MEIYEF HLI
Sbjct: 88  IA-MHKNNKSQVISWLALTFLFGAGFIGMEIYEFHHLI 124


>gi|75674965|ref|YP_317386.1| cytochrome o ubiquinol oxidase subunit III [Nitrobacter
           winogradskyi Nb-255]
 gi|74419835|gb|ABA04034.1| cytochrome bo3 quinol oxidase subunit 3 [Nitrobacter winogradskyi
           Nb-255]
          Length = 241

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/214 (30%), Positives = 105/214 (49%), Gaps = 37/214 (17%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GF + L+SD ++FA+ F  +  + ++ A       +  +  IF  T++LL SS +  FA 
Sbjct: 29  GFRLCLVSDAIIFALLFAIFIAMTRDAADVSTERPLLRLPRIFPETMLLLASSATLGFAS 88

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
           +A+A ++     + WL +T   G+ F++ EI E   + +  A P +S FLS+FF L+G H
Sbjct: 89  IAAAARQRWRAII-WLGLTFVLGLGFVVTEILELYGMAAAHAGPWQSGFLSAFFTLIGAH 147

Query: 153 GLHVFFGLIWLFVLVIQILKKG------------------------------------LI 176
           G HV  GLIW+ +L  ++  +G                                      
Sbjct: 148 GAHVSLGLIWIALLGGELAWRGPALDHDGFGSNRSKTMSVIDSSILERDAGGKPLHTHPA 207

Query: 177 SGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
            G   RL  LS+FWHFL ++WI +F+ VYL G++
Sbjct: 208 PGAVSRLHRLSLFWHFLVIVWISIFALVYLPGLL 241


>gi|150397628|ref|YP_001328095.1| cytochrome c oxidase subunit III [Sinorhizobium medicae WSM419]
 gi|150029143|gb|ABR61260.1| cytochrome c oxidase subunit III [Sinorhizobium medicae WSM419]
          Length = 240

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 103/196 (52%), Gaps = 24/196 (12%)

Query: 35  WIYLMSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVF--DISG-----IFVSTIVLLLSSL 86
           WI+L+SD  +F  F + Y     + A   P P +VF  +I G     I ++ +  +L S 
Sbjct: 44  WIFLLSDTFVFGCFLIAYMAARMSTAVPWPNPSEVFALEIGGTHMPLILIAIMTFVLISS 103

Query: 87  SCSFAMLAS-ATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA----- 140
           S + AM  +   +R   KT + +L+TA FG  F+ M+ +E++ LI+    P  +      
Sbjct: 104 SGTMAMAVNYGYRRDRRKTAALMLLTALFGAAFVGMQAFEWSKLIAEGVRPWANPWGAAQ 163

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQILK-------KGLISGNQRR---LICLSMFW 190
           F SSFF + G HG HV FG+I+L ++  ++ +        G  +  + R   +    ++W
Sbjct: 164 FGSSFFMITGFHGTHVTFGVIFLLIIARKVWRGDFETERPGFFTSRKGRYEIVEITGLYW 223

Query: 191 HFLDLIWICVFSFVYL 206
           HF+DL+W+ +F+F YL
Sbjct: 224 HFVDLVWVFIFAFFYL 239


>gi|239818085|ref|YP_002946995.1| cytochrome C oxidase subunit III [Variovorax paradoxus S110]
 gi|239804662|gb|ACS21729.1| cytochrome c oxidase subunit III [Variovorax paradoxus S110]
          Length = 234

 Score = 89.7 bits (221), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/188 (32%), Positives = 102/188 (54%), Gaps = 16/188 (8%)

Query: 35  WIYLMSDCLMFAVFFVTY-AVLGKNYAAGPAPIDVF-------DISGIFVSTIVLLLSSL 86
           WI+L+SD  +F+ F   Y  V        P P +VF       DI  + ++ +  +L S 
Sbjct: 46  WIFLLSDTFVFSCFLTGYMTVRASTTVPWPNPSEVFALHVGGADIPLLLIAIMTFVLISS 105

Query: 87  SCSFAMLAS-ATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV-----PQRSA 140
           S + AM  + A +R      + +LVTA  G IF+ M+ +E++ LI  E V     P  +A
Sbjct: 106 SGTMAMAVNFAYRRDRVNAATLMLVTATCGEIFVGMQAFEWSKLILEEGVRPWGNPMGAA 165

Query: 141 -FLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGL-ISGNQRRLICLSMFWHFLDLIWI 198
            F S+FF + G HGLHV  G+++LF +  ++++     SGN + +    ++WHF+DL+W+
Sbjct: 166 QFGSAFFMITGFHGLHVSAGVVFLFTVAFKLMRGDYDKSGNYQIVEIAGLYWHFVDLVWV 225

Query: 199 CVFSFVYL 206
            +F+  YL
Sbjct: 226 FIFALFYL 233


>gi|167837279|ref|ZP_02464162.1| Cytochrome c oxidase subunit III [Burkholderia thailandensis
           MSMB43]
          Length = 112

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 61/99 (61%), Gaps = 3/99 (3%)

Query: 26  DHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLL 83
           DH  ++   GFW+YLM+DC++FA  F T+AVLG  +A GP   D+FDI G+ + T  LLL
Sbjct: 15  DHPPSHSVFGFWLYLMTDCVLFAALFATFAVLGNQFAGGPTGRDLFDIPGVALETAALLL 74

Query: 84  SSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIME 122
           SS++  FAM+  A KR       WL VT   G  F+ ME
Sbjct: 75  SSITYGFAMI-GAHKRQRGAVFGWLAVTFVLGAAFLAME 112


>gi|313621620|gb|EFR92436.1| cytochrome aa3 quinol oxidase, subunit III [Listeria innocua FSL
           S4-378]
 gi|313625769|gb|EFR95400.1| cytochrome aa3 quinol oxidase, subunit III [Listeria innocua FSL
           J1-023]
          Length = 176

 Score = 89.0 bits (219), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 52/153 (33%), Positives = 84/153 (54%), Gaps = 2/153 (1%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGK-NYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSF 90
           LGFWI+L ++  +FA  F TY V+ K    AG  P ++F++  + + T +LL SS +C  
Sbjct: 24  LGFWIFLGAEIALFATLFATYFVMRKAGSNAGHPPAEMFELWLVLIMTFLLLASSFTCGL 83

Query: 91  AMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVG 150
           A +    K  +     + ++T   G  F+  E+YEFAH ++     Q  ++ S+FF L+G
Sbjct: 84  A-IGEMRKGNVKMLTIYSIITLILGAGFVGFELYEFAHYVTEGVTMQIGSYWSAFFVLLG 142

Query: 151 LHGLHVFFGLIWLFVLVIQILKKGLISGNQRRL 183
            HGLHV  G+ W+  ++IQI   GL      ++
Sbjct: 143 THGLHVTVGIFWISFILIQIKMHGLTPKTASKV 175


>gi|116695995|ref|YP_841571.1| bb3-type cytochrome oxidase subunit III [Ralstonia eutropha H16]
 gi|113530494|emb|CAJ96841.1| similar to bb3-type cytochrome oxidase subunit III [Ralstonia
           eutropha H16]
          Length = 235

 Score = 89.0 bits (219), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 103/188 (54%), Gaps = 16/188 (8%)

Query: 35  WIYLMSDCLMFAVFFVTY-AVLGKNYAAGPAPIDVF-------DISGIFVSTIVLLLSSL 86
           WI+L+SD  +F+ F   Y  V        P P +VF       DI  + ++ +  +L + 
Sbjct: 47  WIFLLSDTFVFSCFLTGYMTVRMSTTVPWPNPSEVFALHVGGADIPLLLIAIMTFVLITS 106

Query: 87  SCSFAMLASATKRLIHKTVSWLL-VTAFFGMIFIIMEIYEFAHLISMEAV-----PQRSA 140
           S + AM  +   R   +  + L+ VTA FG++F+ M+ +E+  LI  E V     P  +A
Sbjct: 107 SGTMAMAVNFAYRRARRECALLMFVTALFGVMFVGMQAFEWTKLIVDEGVRPWTNPMGAA 166

Query: 141 -FLSSFFALVGLHGLHVFFGLIWLFVLVIQILK-KGLISGNQRRLICLSMFWHFLDLIWI 198
            F S+FF + G HGLHV  G+++L ++  ++L+ +   +GN + +    ++WHF+DL+W+
Sbjct: 167 QFGSTFFMITGFHGLHVSCGVVYLLIVATRVLRGRYEATGNYQIVEIAGLYWHFVDLVWV 226

Query: 199 CVFSFVYL 206
            +F+  YL
Sbjct: 227 FIFALFYL 234


>gi|330975782|gb|EGH75848.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. aptata str. DSM 50252]
          Length = 140

 Score = 89.0 bits (219), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 67/111 (60%), Gaps = 1/111 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLM+DC++FA FF  YAV+  + A GP+  D+F +  + V T  LL+SS++  
Sbjct: 31  TVYGFWLYLMTDCVLFASFFAVYAVMVNSVAGGPSGQDIFLLPFVAVETAFLLVSSITYG 90

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA 140
           FAMLA   K    + + WL +T   G  FI ME+YEF HLI     P RS 
Sbjct: 91  FAMLA-LYKGNKSQVLGWLALTFLCGAAFIGMEVYEFHHLIEEGFGPSRSG 140


>gi|15966272|ref|NP_386625.1| cytochrome-c oxidase protein [Sinorhizobium meliloti 1021]
 gi|307307741|ref|ZP_07587470.1| cytochrome c oxidase subunit III [Sinorhizobium meliloti BL225C]
 gi|307317401|ref|ZP_07596841.1| cytochrome c oxidase subunit III [Sinorhizobium meliloti AK83]
 gi|15075543|emb|CAC47098.1| Cytochrome c oxidase subunit III [Sinorhizobium meliloti 1021]
 gi|306896990|gb|EFN27736.1| cytochrome c oxidase subunit III [Sinorhizobium meliloti AK83]
 gi|306901607|gb|EFN32209.1| cytochrome c oxidase subunit III [Sinorhizobium meliloti BL225C]
          Length = 240

 Score = 88.2 bits (217), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 103/196 (52%), Gaps = 24/196 (12%)

Query: 35  WIYLMSDCLMFAVFFVTY-AVLGKNYAAGPAPIDVF--DISG-----IFVSTIVLLLSSL 86
           WI+L+SD  +F  F + Y +         P P +VF  +I G     I ++ +  +L S 
Sbjct: 44  WIFLLSDTFVFGCFLLAYMSARMSTSVPWPNPSEVFALEIGGTHMPLILIAIMTFVLISS 103

Query: 87  SCSFAMLAS-ATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP-----QRSA 140
           S + AM  +   +R   KT + +L+TA FG  F+ M+ +E++ LI+    P       + 
Sbjct: 104 SGTMAMAVNYGYRRDRRKTAALMLLTALFGAAFVGMQAFEWSKLIAEGVRPWGNPWGAAQ 163

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQILK-------KGLISGNQRR---LICLSMFW 190
           F S+FF + G HG HV FG+I+L ++  ++ +       +G  +  + R   +    ++W
Sbjct: 164 FGSTFFMITGFHGTHVTFGVIFLLIVARKVWRGDFETERRGFFTSRKGRYEIVEITGLYW 223

Query: 191 HFLDLIWICVFSFVYL 206
           HF+DL+W+ +F+F YL
Sbjct: 224 HFVDLVWVFIFAFFYL 239


>gi|223937932|ref|ZP_03629831.1| cytochrome c oxidase, subunit I [bacterium Ellin514]
 gi|223893333|gb|EEF59795.1| cytochrome c oxidase, subunit I [bacterium Ellin514]
          Length = 745

 Score = 88.2 bits (217), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 63/211 (29%), Positives = 102/211 (48%), Gaps = 12/211 (5%)

Query: 8   KSPNFSLFYVKDKKES---CVDHDGTYL-----GFWIYLMSDCLMFAVFFVTYAVLGKNY 59
           + P + L + ++        V+ D  YL     G W +++S+   FA+    Y      +
Sbjct: 534 RRPVWDLMHPENPDPPISGVVNQDSPYLEKNFVGMWSFILSEATFFALLISGYIYYNAYW 593

Query: 60  -AAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVS-WLLVTAFFGMI 117
            + GP      + +   V T+ LL SSL+  F +      R  H +   WL++T   G++
Sbjct: 594 HSTGPDAAAHLNRNLATVFTLFLLASSLT--FWLAEKNLHRGNHHSFRFWLVITILLGLV 651

Query: 118 FIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLIS 177
           FI+ + +E+  L         + F SSFF L G HGLHV  GLI L +++    K    S
Sbjct: 652 FIVGQGHEYFDLFRRGVTIDTTLFASSFFTLTGFHGLHVCVGLIGLLIVLWLAFKGDFKS 711

Query: 178 GNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           G    +  +  +WHF+D++WI VF+ VYL+G
Sbjct: 712 GRIEAVRTIGFYWHFVDVVWIFVFTTVYLVG 742


>gi|227823093|ref|YP_002827065.1| cytochrome c oxidase, subunit III [Sinorhizobium fredii NGR234]
 gi|227342094|gb|ACP26312.1| cytochrome c oxidase, subunit III [Sinorhizobium fredii NGR234]
          Length = 240

 Score = 87.8 bits (216), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 102/196 (52%), Gaps = 24/196 (12%)

Query: 35  WIYLMSDCLMFAVFFVTY-AVLGKNYAAGPAPIDVF--DISG-----IFVSTIVLLLSSL 86
           WI+L+SD  +F  F + Y +         P P +VF  +I+G     I ++ +  +L S 
Sbjct: 44  WIFLLSDTFVFGCFLLAYMSARMSTTVPWPNPSEVFALEIAGAHVPLILIAIMTFVLISS 103

Query: 87  SCSFAMLAS-ATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP-----QRSA 140
           S + AM  +   +R   KT   +LVTA FG  F+ M+ +E++ LIS    P       + 
Sbjct: 104 SGTMAMAVNCGYRRDRRKTAILMLVTALFGATFVGMQAFEWSKLISEGVRPWGNPWGAAQ 163

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQILK-------KGLISGNQRR---LICLSMFW 190
           F SSFF + G HG HV  G+I+L ++  ++ +       +G  +  + R   +    ++W
Sbjct: 164 FGSSFFMITGFHGTHVTIGVIFLLIVARKVWRGDYDTERRGFFTSRKGRYEIVEITGLYW 223

Query: 191 HFLDLIWICVFSFVYL 206
           HF+DL+W+ +F+F YL
Sbjct: 224 HFVDLVWVFIFAFFYL 239


>gi|91786631|ref|YP_547583.1| cytochrome c oxidase subunit III [Polaromonas sp. JS666]
 gi|91695856|gb|ABE42685.1| cytochrome c oxidase, subunit III [Polaromonas sp. JS666]
          Length = 236

 Score = 87.8 bits (216), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 64/189 (33%), Positives = 104/189 (55%), Gaps = 18/189 (9%)

Query: 35  WIYLMSDCLMFAVFFVTY-AVLGKNYAAGPAPIDVF--DISG-------IFVSTIVLLLS 84
           WI+L+SD  +F+ F   Y  V        P P  VF   + G       I + T VL+ S
Sbjct: 48  WIFLLSDTFIFSCFLTGYMTVRVSTTVPWPNPSQVFALHVGGTEVPLLLIAIMTFVLISS 107

Query: 85  SLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV-----PQRS 139
           S + + A+  +  +  I+  V  ++VTA  G  F+ M+ +E++ LI  E V     P  +
Sbjct: 108 SGTMAMAVNCAYRRDRINAAVL-MIVTATLGETFVAMQAFEWSKLILEEGVRPWGNPMGA 166

Query: 140 A-FLSSFFALVGLHGLHVFFGLIWLFVLVIQILK-KGLISGNQRRLICLSMFWHFLDLIW 197
           A F S+FF + G HGLHV  G+I+L V+  ++L+ +   SGN + +  + ++WHF+DL+W
Sbjct: 167 AQFGSAFFMITGFHGLHVTAGVIYLLVVATRLLRGRYEQSGNYQIVEIVGLYWHFVDLVW 226

Query: 198 ICVFSFVYL 206
           + +F+F YL
Sbjct: 227 VFIFAFFYL 235


>gi|209549852|ref|YP_002281769.1| cytochrome C oxidase subunit III [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209535608|gb|ACI55543.1| cytochrome c oxidase subunit III [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 239

 Score = 87.4 bits (215), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 99/196 (50%), Gaps = 24/196 (12%)

Query: 35  WIYLMSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVF-------DISGIFVSTIVLLLSSL 86
           WI+L+SD  +F  F + Y     +     P P +VF       D+  I ++ +  +L S 
Sbjct: 43  WIFLLSDTFVFGCFLIAYMTARMSTPVPWPNPSEVFALHIGGQDVPLILIAIMTFVLISS 102

Query: 87  SCSFAMLAS-ATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA----- 140
           S + AM  +   +R  HKT   +L+TA  G  F+ M+ +E+  LI+    P  +      
Sbjct: 103 SGTMAMAVNFGYRRDRHKTAVLMLLTALLGACFVGMQAFEWTKLITEGVRPWENPWGAAQ 162

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQILK-------KGLISGNQRR---LICLSMFW 190
           F S+FF + G HG HV  G+I+L +   ++ +       +G  +  + R   +  + ++W
Sbjct: 163 FGSTFFMITGFHGTHVTIGVIFLIITARKVWRGDFDVERRGFFTSRRGRYEAVEIMGLYW 222

Query: 191 HFLDLIWICVFSFVYL 206
           HF+DL+W+ +F+F YL
Sbjct: 223 HFVDLVWVFIFAFFYL 238


>gi|21220628|ref|NP_626407.1| cytochrome c oxidase subunit III [Streptomyces coelicolor A3(2)]
 gi|289772124|ref|ZP_06531502.1| cytochrome c oxidase subunit III [Streptomyces lividans TK24]
 gi|62900050|sp|Q9X809|COX3_STRCO RecName: Full=Probable cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome aa3 subunit 3; AltName: Full=Cytochrome
           c oxidase polypeptide III
 gi|4539220|emb|CAB39878.1| cytochrome c oxidase subunit III [Streptomyces coelicolor A3(2)]
 gi|289702323|gb|EFD69752.1| cytochrome c oxidase subunit III [Streptomyces lividans TK24]
          Length = 206

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/184 (32%), Positives = 97/184 (52%), Gaps = 9/184 (4%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTY----AVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS 85
           T +G  I+L S+ + FA  F  Y    +V G ++ +  A  D  +I     +T +L+LSS
Sbjct: 25  TSVGTIIWLSSELMFFAALFAMYFTLRSVTGPDFWSEKA--DALNIPFSATNTTILVLSS 82

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS-AFLSS 144
           L+C   + A A +  + K   W +VT   G IFI  +++E+  L+  E +   S  + S+
Sbjct: 83  LTCQLGVFA-AERGDVKKLRMWFIVTFVMGAIFIGGQVFEYTELVKHEGISLSSDPYGSA 141

Query: 145 FFALVGLHGLHVFFGLI-WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           F+   G HGLHV  GLI +L VL      +          I +S +WHF+D++WI +F+ 
Sbjct: 142 FYLTTGFHGLHVTGGLIAFLLVLGRTYAARRFTHEQATAAIVVSYYWHFVDVVWIGLFAT 201

Query: 204 VYLM 207
           +YL+
Sbjct: 202 IYLI 205


>gi|323158302|gb|EFZ44375.1| cytochrome o ubiquinol oxidase subunit 3 domain protein
           [Escherichia coli E128010]
          Length = 104

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 63/105 (60%), Gaps = 1/105 (0%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATK 98
           MSDC++F++ F TYAVL    A GP   D+F++  + V T +LL SS++   A +A   K
Sbjct: 1   MSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIA-MYK 59

Query: 99  RLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLS 143
               + +SWL +T  FG  FI MEIYEF HLI     P RS FLS
Sbjct: 60  NNKSQVISWLALTWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLS 104


>gi|169826977|ref|YP_001697135.1| cytochrome c oxidase subunit 3 [Lysinibacillus sphaericus C3-41]
 gi|168991465|gb|ACA39005.1| Cytochrome c oxidase subunit 3 [Lysinibacillus sphaericus C3-41]
          Length = 178

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 92/160 (57%), Gaps = 9/160 (5%)

Query: 21  KESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPID-----VFDISGIF 75
           +++ ++     +GFWI+L  + ++FA  F TY  L KN   GPA ++     +F++   F
Sbjct: 17  EQATLEGKNKVVGFWIFLACEVVLFASLFATYLAL-KN--KGPAGMEFTTQGLFELPLAF 73

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
             T++LL SSL+  +A+             +WL +T   G+ F+ +EIYEF H + +   
Sbjct: 74  AMTMLLLTSSLTSVYAIYHMRNFNF-KGMQTWLAITLALGLGFLALEIYEFQHYVHLGFT 132

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGL 175
             +SAF ++F++LVG HG HV  GL+W+  L+I+  K+GL
Sbjct: 133 FNQSAFATAFYSLVGTHGFHVTLGLVWIATLMIRNAKRGL 172


>gi|324998039|ref|ZP_08119151.1| cytochrome c oxidase, subunit III [Pseudonocardia sp. P1]
          Length = 202

 Score = 86.3 bits (212), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 92/201 (45%), Gaps = 7/201 (3%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY-AVLGKNYAAGPAPI 66
            +PN S       + + V      +G  ++L S+ + FA  F  Y     +N    P P 
Sbjct: 7   AAPNISARIHSLNRPNLVS-----IGTIVWLSSELMFFAGLFAMYFTARAQNDGPWPPPP 61

Query: 67  DVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEF 126
              ++      TIVL+ SS +C F + A A +  +     W L+T   G  F++ + YE+
Sbjct: 62  THLNVPYALAITIVLVASSFTCQFGVFA-AERGDVFGLRRWYLLTLAMGTFFVVGQAYEY 120

Query: 127 AHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
             L+        S++ + F+   G HGLHV  GL+    L+I+              I +
Sbjct: 121 YELVETGTTMAASSYGTVFYMATGFHGLHVIGGLVAFVYLIIRTRLSKFTPAQATAAIVV 180

Query: 187 SMFWHFLDLIWICVFSFVYLM 207
           S +WHF+D++WI +F+ +Y +
Sbjct: 181 SYYWHFVDVVWIGLFAVIYFI 201


>gi|134094349|ref|YP_001099424.1| cytochrome-C oxidase subunit III oxidoreductase protein
           [Herminiimonas arsenicoxydans]
 gi|133738252|emb|CAL61297.1| Cytochrome-c oxidase [Herminiimonas arsenicoxydans]
          Length = 230

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 59/187 (31%), Positives = 99/187 (52%), Gaps = 15/187 (8%)

Query: 35  WIYLMSDCLMFAVFFVTY-AVLGKNYAAGPAPIDVF-------DISGIFVSTIVLLLSSL 86
           WI+L+SD  +F+ F   Y  V     AA P P +VF       D+  + ++ +  +L S 
Sbjct: 43  WIFLLSDTFIFSCFLTGYMTVRLTTTAAWPNPSEVFSLNIGGTDMPLLLIAIMTFVLISS 102

Query: 87  SCSFAMLASATKRLIHKTVSWL-LVTAFFGMIFIIMEIYEFAHLISMEAVP-----QRSA 140
           S + AM  +   R    T   L L TA  G  F+ M+ +E++ LI+    P       + 
Sbjct: 103 SGTMAMAVNYAYRRNRVTTGILMLATALLGASFVGMQAFEWSKLIAEGVRPWGNPMGAAQ 162

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQILK-KGLISGNQRRLICLSMFWHFLDLIWIC 199
           F S+FF + G HGLHV  G+I+L ++  ++L+ +   +GN + +    ++WHF+DL+W+ 
Sbjct: 163 FGSTFFMITGFHGLHVSAGVIYLVIVASRVLRGRYEKTGNYQIVEIAGLYWHFVDLVWVF 222

Query: 200 VFSFVYL 206
           +F+  YL
Sbjct: 223 IFALFYL 229


>gi|87312213|ref|ZP_01094315.1| cytochrome C oxidase subunit III [Blastopirellula marina DSM 3645]
 gi|87285089|gb|EAQ77021.1| cytochrome C oxidase subunit III [Blastopirellula marina DSM 3645]
          Length = 203

 Score = 85.5 bits (210), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 92/194 (47%), Gaps = 3/194 (1%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
           +    ES        +G   +L S+   F+   V Y +       GP P +   ++   +
Sbjct: 12  IPPPVESEFPLSPAQVGMATFLCSEAAFFSTLVVAYLIYLGEDQTGPTPAESLSLTRAVI 71

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
           ++  LL SS +   AM A   K L   +V W+  T   G++F++   YE+  LI  + + 
Sbjct: 72  NSAFLLGSSGTIMLAMNARKAKSLNGFSV-WMFGTITLGVLFLVGTAYEWEELIYQDGLT 130

Query: 137 -QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
             R+ F ++F+ L+G H  HV  GL+ L V+   + + G +S        +S +WHF+D 
Sbjct: 131 IGRNLFGTTFYTLIGFHAFHVTLGLVLLTVITF-LERAGRLSAKSEATELVSWYWHFVDA 189

Query: 196 IWICVFSFVYLMGV 209
           +WI +F  VY MG 
Sbjct: 190 VWIVIFGVVYWMGT 203


>gi|145296154|ref|YP_001138975.1| hypothetical protein cgR_2074 [Corynebacterium glutamicum R]
 gi|140846074|dbj|BAF55073.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 217

 Score = 85.5 bits (210), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 91/179 (50%), Gaps = 4/179 (2%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPA---PIDVFDISGIFVSTIVLLLSSLSC 88
           +G  ++L  + + FA  F  Y V   N  A  +     D  ++    + T++L+ SS++C
Sbjct: 39  VGTIVFLSQELMFFAGLFAMYFVSRANGLANGSWGEQTDHLNVPYALLITVILVSSSVTC 98

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            F + A A +  ++    W LVT   G IF+I + YE+  L+      Q S + S+FF  
Sbjct: 99  QFGVFA-AERGDVYGLRKWFLVTIILGSIFVIGQAYEYITLVGHGLTIQSSVYGSAFFIT 157

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
            G H LHV  G+I   V++++I K           + +S +WHF+D++WI +F  +Y +
Sbjct: 158 TGFHALHVIAGVIAFVVVLMRIQKSKFTPAQATAAMVVSYYWHFVDVVWIGLFITIYFI 216


>gi|254390607|ref|ZP_05005821.1| cytochrome c oxidase subunit III [Streptomyces clavuligerus ATCC
           27064]
 gi|294812204|ref|ZP_06770847.1| Probable cytochrome c oxidase subunit 3 [Streptomyces clavuligerus
           ATCC 27064]
 gi|326440641|ref|ZP_08215375.1| cytochrome c oxidase subunit III [Streptomyces clavuligerus ATCC
           27064]
 gi|197704308|gb|EDY50120.1| cytochrome c oxidase subunit III [Streptomyces clavuligerus ATCC
           27064]
 gi|294324803|gb|EFG06446.1| Probable cytochrome c oxidase subunit 3 [Streptomyces clavuligerus
           ATCC 27064]
          Length = 205

 Score = 85.5 bits (210), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 92/181 (50%), Gaps = 8/181 (4%)

Query: 32  LGFWIYLMSDCLMFAVFFVTY----AVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
           +G  I+L S+ + FA  F  Y    +V G  Y +  A +  F  S    +T +L+LSSL+
Sbjct: 27  VGTIIWLSSELMFFAALFAMYFTLRSVTGAEYWSSRADLLNFPFS--MTNTTILVLSSLT 84

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
           C   + A A +  + K  +W ++T   G IF+  ++YE+  L+          + S F+ 
Sbjct: 85  CQLGVFA-AERGDVKKLRTWFIITFVMGAIFVGGQVYEYTELVQHGVTLSSDPYGSVFYL 143

Query: 148 LVGLHGLHVFFGLI-WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
             G HGLHV  GLI +L VL      +          I +S +WHF+D++WI +F+ +YL
Sbjct: 144 TTGFHGLHVTGGLIAFLLVLGRTYAARRFTHEQATSAIVVSYYWHFVDVVWIGLFATIYL 203

Query: 207 M 207
           +
Sbjct: 204 I 204


>gi|307294180|ref|ZP_07574024.1| cytochrome c oxidase subunit III [Sphingobium chlorophenolicum L-1]
 gi|306880331|gb|EFN11548.1| cytochrome c oxidase subunit III [Sphingobium chlorophenolicum L-1]
          Length = 227

 Score = 85.1 bits (209), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 98/188 (52%), Gaps = 16/188 (8%)

Query: 35  WIYLMSDCLMFAVFFVTY-AVLGKNYAAGPAPIDVF-------DISGIFVSTIVLLLSSL 86
           WI+L+SD  +F+ F   Y  V        P   +VF       DI  + ++ +   L S 
Sbjct: 39  WIFLLSDTFIFSCFLTGYMTVRASATLPWPNTAEVFALNIGGQDIPLVLIAIMTFALISS 98

Query: 87  SCSFAMLAS-ATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS------ 139
           S + AM  +   +R   KT + +L+TA FG+ F+ M+ +E++ LI  E V   S      
Sbjct: 99  SGTMAMAVNFGYQRDRRKTTALMLLTALFGLTFLGMQAFEWSKLIFEEGVRPWSNPMGAP 158

Query: 140 AFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGL-ISGNQRRLICLSMFWHFLDLIWI 198
            F ++FF + G HGLHV  G+I L ++  ++ +     SG+   +    ++WHF+DL+W+
Sbjct: 159 QFGAAFFMITGFHGLHVTCGVILLLIIASKVARGHYDKSGDYSAVEIAGLYWHFVDLVWV 218

Query: 199 CVFSFVYL 206
            +F+F YL
Sbjct: 219 FIFAFFYL 226


>gi|329941014|ref|ZP_08290294.1| cytochrome C oxidase subunit III [Streptomyces griseoaurantiacus
           M045]
 gi|329300308|gb|EGG44206.1| cytochrome C oxidase subunit III [Streptomyces griseoaurantiacus
           M045]
          Length = 203

 Score = 85.1 bits (209), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 60/184 (32%), Positives = 95/184 (51%), Gaps = 9/184 (4%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTY----AVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS 85
           T +G  I+L S+ + FA  F  Y    +V G ++    A     ++     +T +L+LSS
Sbjct: 22  TSVGTIIWLSSELMFFAALFAMYFTLRSVTGPDHWKEMA--SALNVPFSATNTTILVLSS 79

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS-AFLSS 144
           L+C   + A A +  + K   W +VT   G IFI  +IYE+  L+  + +   S  + S 
Sbjct: 80  LTCQLGVFA-AERGDVKKLRGWFIVTFIMGAIFIGGQIYEYTELVKKDGISLSSDPYGSV 138

Query: 145 FFALVGLHGLHVFFGLI-WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           F+   G HGLHV  GL+ +LFVL      K          I +S +WHF+D++WI +F+ 
Sbjct: 139 FYLTTGFHGLHVTGGLLAFLFVLGRTYAAKRFTHDQATAAIVVSYYWHFVDVVWIGLFAT 198

Query: 204 VYLM 207
           +YL+
Sbjct: 199 IYLI 202


>gi|28493213|ref|NP_787374.1| cytochrome c oxidase subunit III [Tropheryma whipplei str. Twist]
 gi|28572673|ref|NP_789453.1| cytochrome c oxidase subunit III [Tropheryma whipplei TW08/27]
 gi|28410805|emb|CAD67191.1| cytochrome c oxidase subunit III [Tropheryma whipplei TW08/27]
 gi|28476254|gb|AAO44343.1| cytochrome c oxidase subunit III [Tropheryma whipplei str. Twist]
          Length = 207

 Score = 84.7 bits (208), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 84/143 (58%), Gaps = 9/143 (6%)

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKT--------VSWLLVTAFFGMIFIIMEIYEFA 127
           V+T++L+LSS++C FA+ AS   +   ++        + W  ++AF G+IF+  ++ E+A
Sbjct: 65  VNTVILILSSVTCQFAVRASERFQPRRRSWQPRDWGAIEWFYLSAFLGLIFLAGQVNEYA 124

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILK-KGLISGNQRRLICL 186
            L +     + SAF S F+   G HGLHV  G+  + VL+ +    K   + +    I +
Sbjct: 125 SLYAEGITLKSSAFGSVFYLTTGFHGLHVLGGIAAMLVLIGRFYAVKRFSTHDAVAAIAV 184

Query: 187 SMFWHFLDLIWICVFSFVYLMGV 209
           S +WHF+D++W+ +FS +Y++GV
Sbjct: 185 SYYWHFVDIVWVFLFSSIYILGV 207


>gi|15609330|ref|NP_216709.1| cytochrome C oxidase subunit III [Mycobacterium tuberculosis H37Rv]
 gi|15841684|ref|NP_336721.1| cytochrome c oxidase, subunit III [Mycobacterium tuberculosis
           CDC1551]
 gi|31793372|ref|NP_855865.1| cytochrome C oxidase subunit III [Mycobacterium bovis AF2122/97]
 gi|121638074|ref|YP_978298.1| putative cytochrome C oxidase (subunit III) ctaE [Mycobacterium
           bovis BCG str. Pasteur 1173P2]
 gi|148662010|ref|YP_001283533.1| cytochrome c oxidase subunit III [Mycobacterium tuberculosis H37Ra]
 gi|148823400|ref|YP_001288154.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           F11]
 gi|215403583|ref|ZP_03415764.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           02_1987]
 gi|215411918|ref|ZP_03420692.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           94_M4241A]
 gi|215446422|ref|ZP_03433174.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           T85]
 gi|218753917|ref|ZP_03532713.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           GM 1503]
 gi|219558172|ref|ZP_03537248.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           T17]
 gi|224990568|ref|YP_002645255.1| putative cytochrome c oxidase subunit III [Mycobacterium bovis BCG
           str. Tokyo 172]
 gi|253798742|ref|YP_003031743.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           KZN 1435]
 gi|254232346|ref|ZP_04925673.1| cytochrome C oxidase (subunit III) ctaE [Mycobacterium tuberculosis
           C]
 gi|254364990|ref|ZP_04981036.1| cytochrome C oxidase (subunit III) ctaE [Mycobacterium tuberculosis
           str. Haarlem]
 gi|260187189|ref|ZP_05764663.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           CPHL_A]
 gi|260201310|ref|ZP_05768801.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           T46]
 gi|289443700|ref|ZP_06433444.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           T46]
 gi|289447821|ref|ZP_06437565.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           CPHL_A]
 gi|289554020|ref|ZP_06443230.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           KZN 605]
 gi|289570309|ref|ZP_06450536.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           T17]
 gi|289574879|ref|ZP_06455106.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           K85]
 gi|289745466|ref|ZP_06504844.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           02_1987]
 gi|289750787|ref|ZP_06510165.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           T92]
 gi|289754301|ref|ZP_06513679.1| cytochrome c oxidase subunit III [Mycobacterium tuberculosis
           EAS054]
 gi|289758313|ref|ZP_06517691.1| cytochrome c oxidase [Mycobacterium tuberculosis T85]
 gi|289762355|ref|ZP_06521733.1| cytochrome C oxidase (subunit III) ctaE [Mycobacterium tuberculosis
           GM 1503]
 gi|294993578|ref|ZP_06799269.1| cytochrome C oxidase subunit III [Mycobacterium tuberculosis 210]
 gi|297634782|ref|ZP_06952562.1| cytochrome C oxidase subunit III [Mycobacterium tuberculosis KZN
           4207]
 gi|297731773|ref|ZP_06960891.1| cytochrome C oxidase subunit III [Mycobacterium tuberculosis KZN
           R506]
 gi|298525685|ref|ZP_07013094.1| cytochrome C oxidase (subunit III) ctaE [Mycobacterium tuberculosis
           94_M4241A]
 gi|306776445|ref|ZP_07414782.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           SUMu001]
 gi|306780222|ref|ZP_07418559.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           SUMu002]
 gi|306784969|ref|ZP_07423291.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           SUMu003]
 gi|306789336|ref|ZP_07427658.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           SUMu004]
 gi|306793661|ref|ZP_07431963.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           SUMu005]
 gi|306798052|ref|ZP_07436354.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           SUMu006]
 gi|306803932|ref|ZP_07440600.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           SUMu008]
 gi|306808503|ref|ZP_07445171.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           SUMu007]
 gi|306968330|ref|ZP_07480991.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           SUMu009]
 gi|306972557|ref|ZP_07485218.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           SUMu010]
 gi|307080264|ref|ZP_07489434.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           SUMu011]
 gi|307084854|ref|ZP_07493967.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           SUMu012]
 gi|313659107|ref|ZP_07815987.1| cytochrome C oxidase subunit III [Mycobacterium tuberculosis KZN
           V2475]
 gi|54036893|sp|P63857|COX3_MYCBO RecName: Full=Probable cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome aa3 subunit 3; AltName: Full=Cytochrome
           c oxidase polypeptide III
 gi|54040917|sp|P63856|COX3_MYCTU RecName: Full=Probable cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome aa3 subunit 3; AltName: Full=Cytochrome
           c oxidase polypeptide III
 gi|1237046|emb|CAA94262.1| PROBABLE CYTOCHROME C OXIDASE (SUBUNIT III) CTAE [Mycobacterium
           tuberculosis H37Rv]
 gi|13881939|gb|AAK46535.1| cytochrome c oxidase, subunit III [Mycobacterium tuberculosis
           CDC1551]
 gi|31618964|emb|CAD97069.1| PROBABLE CYTOCHROME C OXIDASE (SUBUNIT III) CTAE [Mycobacterium
           bovis AF2122/97]
 gi|121493722|emb|CAL72197.1| Probable cytochrome C oxidase (subunit III) ctaE [Mycobacterium
           bovis BCG str. Pasteur 1173P2]
 gi|124601405|gb|EAY60415.1| cytochrome C oxidase (subunit III) ctaE [Mycobacterium tuberculosis
           C]
 gi|134150504|gb|EBA42549.1| cytochrome C oxidase (subunit III) ctaE [Mycobacterium tuberculosis
           str. Haarlem]
 gi|148506162|gb|ABQ73971.1| cytochrome c oxidase subunit III [Mycobacterium tuberculosis H37Ra]
 gi|148721927|gb|ABR06552.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           F11]
 gi|224773681|dbj|BAH26487.1| putative cytochrome c oxidase subunit III [Mycobacterium bovis BCG
           str. Tokyo 172]
 gi|253320245|gb|ACT24848.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           KZN 1435]
 gi|289416619|gb|EFD13859.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           T46]
 gi|289420779|gb|EFD17980.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           CPHL_A]
 gi|289438652|gb|EFD21145.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           KZN 605]
 gi|289539310|gb|EFD43888.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           K85]
 gi|289544063|gb|EFD47711.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           T17]
 gi|289685994|gb|EFD53482.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           02_1987]
 gi|289691374|gb|EFD58803.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           T92]
 gi|289694888|gb|EFD62317.1| cytochrome c oxidase subunit III [Mycobacterium tuberculosis
           EAS054]
 gi|289709861|gb|EFD73877.1| cytochrome C oxidase (subunit III) ctaE [Mycobacterium tuberculosis
           GM 1503]
 gi|289713877|gb|EFD77889.1| cytochrome c oxidase [Mycobacterium tuberculosis T85]
 gi|298495479|gb|EFI30773.1| cytochrome C oxidase (subunit III) ctaE [Mycobacterium tuberculosis
           94_M4241A]
 gi|308215086|gb|EFO74485.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           SUMu001]
 gi|308326839|gb|EFP15690.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           SUMu002]
 gi|308330192|gb|EFP19043.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           SUMu003]
 gi|308334028|gb|EFP22879.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           SUMu004]
 gi|308337836|gb|EFP26687.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           SUMu005]
 gi|308341596|gb|EFP30447.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           SUMu006]
 gi|308345004|gb|EFP33855.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           SUMu007]
 gi|308349315|gb|EFP38166.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           SUMu008]
 gi|308354023|gb|EFP42874.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           SUMu009]
 gi|308357965|gb|EFP46816.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           SUMu010]
 gi|308361899|gb|EFP50750.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           SUMu011]
 gi|308365562|gb|EFP54413.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           SUMu012]
 gi|323719093|gb|EGB28238.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           CDC1551A]
 gi|326903807|gb|EGE50740.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           W-148]
 gi|328458505|gb|AEB03928.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           KZN 4207]
          Length = 203

 Score = 84.3 bits (207), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 96/195 (49%), Gaps = 8/195 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCL----MFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
           +  +  S    +   +G  ++L S+ +    +FA +F   A  G N+   P  ++++   
Sbjct: 12  ITSRVHSLNRPNMVSVGTIVWLSSELMFFAGLFAFYFSARAQAGGNWPPPPTELNLYQAV 71

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            +   T+VL+ SS +C   + A A +  I     W ++T   G+ F++ + YE+ +L+S 
Sbjct: 72  PV---TLVLIASSFTCQMGVFA-AERGDIFGLRRWYVITFLMGLFFVLGQAYEYRNLMSH 127

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                 SA+ S F+   G HGLHV  GLI    L+++              I +S +WHF
Sbjct: 128 GTSIPSSAYGSVFYLATGFHGLHVTGGLIAFIFLLVRTGMSKFTPAQATASIVVSYYWHF 187

Query: 193 LDLIWICVFSFVYLM 207
           +D++WI +F+ +Y +
Sbjct: 188 VDIVWIALFTVIYFI 202


>gi|322435774|ref|YP_004217986.1| cytochrome c oxidase subunit III [Acidobacterium sp. MP5ACTX9]
 gi|321163501|gb|ADW69206.1| cytochrome c oxidase subunit III [Acidobacterium sp. MP5ACTX9]
          Length = 200

 Score = 84.3 bits (207), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 95/173 (54%), Gaps = 6/173 (3%)

Query: 38  LMSDCLMFAVFFVTYA-VLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASA 96
           ++++  +F +F V Y   LGK+ + GPAP +V  +    V+T+ LL SSL+    + A  
Sbjct: 31  IVAETTIFVIFVVAYIFYLGKSLS-GPAPHEVLSLP--IVATVCLLSSSLTVHQGV-AEL 86

Query: 97  TKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP-QRSAFLSSFFALVGLHGLH 155
            K        W+ +TA  G+IF+     E+  LI    +  + + F ++F++LVGLH  H
Sbjct: 87  RKGKSAAATFWIGITALLGLIFLGFTGAEWFDLIVHHGLTIKTNLFGTTFYSLVGLHATH 146

Query: 156 VFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           V  GLI L ++    L K L   +  RL  LS++WHF+D +W+ VF  VYL G
Sbjct: 147 VVVGLIMLLLVTFFGLNKQLEERHAERLEILSLYWHFVDAVWVIVFCVVYLFG 199


>gi|328881856|emb|CCA55095.1| Cytochrome c oxidase polypeptide III [Streptomyces venezuelae ATCC
           10712]
          Length = 206

 Score = 84.3 bits (207), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 60/184 (32%), Positives = 95/184 (51%), Gaps = 9/184 (4%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTY----AVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS 85
           T +G  I+L S+ + FA  F  Y    +V G  + A  A    F  S    +T +L+LSS
Sbjct: 25  TSVGTIIWLSSELMFFAALFAMYFTLRSVTGAEFWAEKASALNFPFSA--TNTTILVLSS 82

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS-AFLSS 144
           L+C   + A A +  + K  +W ++T   G IFI  +++E+  L+  E +   S  + S 
Sbjct: 83  LTCQLGVFA-AERGDVKKLRTWFIITFVMGAIFIGGQVFEYTELVKHEGLSLSSDPYGSV 141

Query: 145 FFALVGLHGLHVFFGLI-WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           F+   G HGLHV  GLI +L VL      K          I +S +WHF+D++WI +F+ 
Sbjct: 142 FYLTTGFHGLHVTGGLIAFLLVLGRTYAAKRFTHEQATAAIVVSYYWHFVDVVWIGLFAT 201

Query: 204 VYLM 207
           +Y++
Sbjct: 202 IYMI 205


>gi|294628921|ref|ZP_06707481.1| cytoChrome c oxidase subunit III [Streptomyces sp. e14]
 gi|292832254|gb|EFF90603.1| cytoChrome c oxidase subunit III [Streptomyces sp. e14]
          Length = 206

 Score = 84.3 bits (207), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 93/184 (50%), Gaps = 9/184 (4%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAP----IDVFDISGIFVSTIVLLLSS 85
           T +G  I+L S+ + FA  F  Y  L      GPA      D  ++     +T +L+LSS
Sbjct: 25  TSVGTIIWLSSELMFFAALFAMYFTL--RSVTGPAHWKEMADHLNVPFSSANTTILVLSS 82

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS-AFLSS 144
           L+C   + A A +  + K   W +VT   G IFI  +IYE+  L+  + +   S  + S 
Sbjct: 83  LTCQLGVFA-AERGDVKKLRGWFIVTFIMGAIFIGGQIYEYTSLVKEDGLSLSSDPYGSV 141

Query: 145 FFALVGLHGLHVFFGLI-WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           F+   G HGLHV  GLI +L VL      +          I +S +WHF+D++WI +F+ 
Sbjct: 142 FYLTTGFHGLHVTGGLIAFLLVLGRTYAARRFTHEQATAAIVVSYYWHFVDVVWIGLFAT 201

Query: 204 VYLM 207
           +YL+
Sbjct: 202 IYLI 205


>gi|297199129|ref|ZP_06916526.1| cytochrome aa3 quinol oxidase, subunit III [Streptomyces sviceus
           ATCC 29083]
 gi|197715151|gb|EDY59185.1| cytochrome aa3 quinol oxidase, subunit III [Streptomyces sviceus
           ATCC 29083]
          Length = 206

 Score = 84.3 bits (207), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 60/184 (32%), Positives = 95/184 (51%), Gaps = 9/184 (4%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTY----AVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS 85
           T +G  I+L S+ + FA  F  Y    +V G ++    A    F  S    +T +L+LSS
Sbjct: 25  TSVGTIIWLSSELMFFAALFAMYFTLRSVTGPDHWKEMASSLNFPFSA--TNTTILVLSS 82

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS-AFLSS 144
           L+C   + A A +  + K   W ++T   G IFI  +IYE+  L+  + +   S  + S 
Sbjct: 83  LTCQLGVFA-AERGDVKKLRGWFIITFIMGAIFIGGQIYEYTELVKKDGLSLSSDPYGSV 141

Query: 145 FFALVGLHGLHVFFGLI-WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           F+   G HG+HV  GLI +LFVL      K          I +S +WHF+D++WI +F+ 
Sbjct: 142 FYLTTGFHGMHVTGGLIAFLFVLGRTYAAKRFTHEQATAAIVVSYYWHFVDVVWIGLFAT 201

Query: 204 VYLM 207
           +Y++
Sbjct: 202 IYMI 205


>gi|240168252|ref|ZP_04746911.1| cytochrome C oxidase (subunit III) CtaE [Mycobacterium kansasii
           ATCC 12478]
          Length = 203

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 83/164 (50%), Gaps = 4/164 (2%)

Query: 44  MFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHK 103
           +FA++F   A  G  +   P  ++++    +   T+VL+ SS +C   + A A +  +  
Sbjct: 43  LFAMYFTARAQSGGKWPPPPTELNLYQAVPV---TLVLIASSFTCQMGVFA-AERGDVFG 98

Query: 104 TVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWL 163
              W ++T   G+ FI+ + YE+ HL +       SA+ S F+   G HGLHV  GLI  
Sbjct: 99  LRRWYVITFLMGLFFILGQAYEYYHLATHGTTIPGSAYGSVFYLATGFHGLHVTGGLIAF 158

Query: 164 FVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
             L+I+              I +S +WHF+D++WI +F+ +Y +
Sbjct: 159 IFLLIRTGMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYFI 202


>gi|159896639|ref|YP_001542886.1| cytochrome c oxidase subunit III [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159889678|gb|ABX02758.1| cytochrome c oxidase subunit III [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 208

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 97/200 (48%), Gaps = 12/200 (6%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA--AGPAPIDVFDISGIFV 76
           DK +     D   LG W +L S+   F    VT+  +    A  +  A  DV  +  +F 
Sbjct: 10  DKNDPGRGLDLRKLGMWTFLGSEVFFFGALVVTHLSMRGVVAPSSSKANYDVAAVRNLFG 69

Query: 77  STI-------VLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
             +       +LL SSL+   A+    T     +   WL  T   G++F+  ++YEF H+
Sbjct: 70  DNVLTSILAFILLTSSLTMVLALDGVKTNNQ-KRFRFWLGATIACGLVFLGGQVYEFYHI 128

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILK--KGLISGNQRRLICLS 187
           +      +   F S+FF + G HG HV  G++WL  L++  ++  +   +GN   +    
Sbjct: 129 VHEGVTIKNMMFGSTFFFVTGFHGTHVAVGVVWLTSLLVSAIRHPERYNAGNYMAVELGG 188

Query: 188 MFWHFLDLIWICVFSFVYLM 207
           ++WHF+DL+W+ +F+ +YL+
Sbjct: 189 LYWHFVDLVWVLIFTVIYLI 208


>gi|301165572|emb|CBW25143.1| putative transmembrane cytochrome oxidase subunit [Bacteriovorax
           marinus SJ]
          Length = 211

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/186 (31%), Positives = 99/186 (53%), Gaps = 15/186 (8%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS---TIVLLLSSLSC 88
           +G W++L +D + F+   + YAVL +     P P++   + G+ +S   T +L+ SS+S 
Sbjct: 31  IGMWLFLGTDGMSFSGLLIAYAVL-RWTRHWPHPVEA--LGGVALSGFMTFILICSSVS- 86

Query: 89  SFAMLASATKRLIHKTV-SWLLVTAFFGMIFIIMEIYEFAHLISMEAVP------QRSAF 141
              +   A K+   K + +WL +T   G+IF+ ++ YE+ HL     +         + F
Sbjct: 87  -MVLCIDACKQRDRKGILNWLALTILGGVIFLGIQAYEYIHLSQDLGMTFSTYAHGNNLF 145

Query: 142 LSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVF 201
            S+FFA+ G HGLHV  G+ +L  +           G+   L    +FWHF+DL+WI VF
Sbjct: 146 ASTFFAVTGFHGLHVLTGVCYLCYMWKLAYDGRFDKGDYTLLELAGLFWHFVDLVWILVF 205

Query: 202 SFVYLM 207
           +F+YL+
Sbjct: 206 TFIYLL 211


>gi|167969414|ref|ZP_02551691.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           H37Ra]
 gi|215427568|ref|ZP_03425487.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           T92]
 gi|215431127|ref|ZP_03429046.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           EAS054]
 gi|254551233|ref|ZP_05141680.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           '98-R604 INH-RIF-EM']
 gi|260205489|ref|ZP_05772980.1| cytochrome C oxidase subunit III ctaE [Mycobacterium tuberculosis
           K85]
          Length = 180

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 84/164 (51%), Gaps = 4/164 (2%)

Query: 44  MFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHK 103
           +FA +F   A  G N+   P  ++++    +   T+VL+ SS +C   + A A +  I  
Sbjct: 20  LFAFYFSARAQAGGNWPPPPTELNLYQAVPV---TLVLIASSFTCQMGVFA-AERGDIFG 75

Query: 104 TVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWL 163
              W ++T   G+ F++ + YE+ +L+S       SA+ S F+   G HGLHV  GLI  
Sbjct: 76  LRRWYVITFLMGLFFVLGQAYEYRNLMSHGTSIPSSAYGSVFYLATGFHGLHVTGGLIAF 135

Query: 164 FVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
             L+++              I +S +WHF+D++WI +F+ +Y +
Sbjct: 136 IFLLVRTGMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYFI 179


>gi|298294191|ref|YP_003696130.1| cytochrome C oxidase subunit III [Starkeya novella DSM 506]
 gi|296930702|gb|ADH91511.1| cytochrome c oxidase subunit III [Starkeya novella DSM 506]
          Length = 240

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/196 (29%), Positives = 98/196 (50%), Gaps = 24/196 (12%)

Query: 35  WIYLMSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVF--DISG-----IFVSTIVLLLSSL 86
           WI+L+SD  +F+ F ++Y     +     P P +VF  +I G     + ++ +  +L S 
Sbjct: 44  WIFLLSDTFVFSCFLISYMTARMSTTVPWPNPSEVFALEIGGTSFPLLLIAIMTFVLISS 103

Query: 87  SCSFAMLASATKRLIHKTVSWL-LVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA----- 140
           S + AM  +   R    T + L L TA  G  F+ M+ +E+  LI     P  +      
Sbjct: 104 SGTMAMAVNYGYRRDRVTTAMLMLATAVLGAAFVGMQAFEWTKLIHEGVRPWENPWGAAQ 163

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ----------RRLICLSMFW 190
           F SSFF + G HG HV FG+I+L  +  ++L+    +G +            +  + ++W
Sbjct: 164 FGSSFFMITGFHGTHVTFGVIFLIAIARKVLRGDFDTGRRGFFTSRKGSYESVEIMGLYW 223

Query: 191 HFLDLIWICVFSFVYL 206
           HF+DL+W+ +F+F YL
Sbjct: 224 HFVDLVWVFIFAFFYL 239


>gi|118618835|ref|YP_907167.1| cytochrome C oxidase (subunit III) CtaE [Mycobacterium ulcerans
           Agy99]
 gi|183983228|ref|YP_001851519.1| cytochrome C oxidase (subunit III) CtaE [Mycobacterium marinum M]
 gi|118570945|gb|ABL05696.1| cytochrome C oxidase (subunit III) CtaE [Mycobacterium ulcerans
           Agy99]
 gi|183176554|gb|ACC41664.1| cytochrome C oxidase (subunit III) CtaE [Mycobacterium marinum M]
          Length = 203

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 93/193 (48%), Gaps = 4/193 (2%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAG--PAPIDVFDISGI 74
           +  +  S    +   +G  ++L S+ + FA  F  Y    ++ A G  P P    ++   
Sbjct: 12  ITSRVHSLNRPNMVSVGTIVWLSSELMFFAGLFAMY-FTARSQAGGKWPPPPTELNLYQA 70

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
              T+VL+ SS +C   + A A +  +     W ++T   G+ F++ + YE+ HL++   
Sbjct: 71  VPVTLVLIASSFTCQMGVFA-AERGDVFGLRRWYVITFLMGLFFVLGQGYEYYHLVTHGT 129

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
               SA+ S F+   G HGLHV  GLI    L+++              I +S +WHF+D
Sbjct: 130 TIPGSAYGSVFYLATGFHGLHVTGGLIAFIFLLVRTGMSKFTPAQATASIVVSYYWHFVD 189

Query: 195 LIWICVFSFVYLM 207
           ++WI +F+ +Y +
Sbjct: 190 IVWIALFTVIYFI 202


>gi|123965741|ref|YP_001010822.1| cytochrome c oxidase, subunit III [Prochlorococcus marinus str. MIT
           9515]
 gi|123200107|gb|ABM71715.1| Cytochrome c oxidase, subunit III [Prochlorococcus marinus str. MIT
           9515]
          Length = 200

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 65/205 (31%), Positives = 102/205 (49%), Gaps = 28/205 (13%)

Query: 17  VKDKKESCVDH--DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAP---IDVFDI 71
           +K  +    +H  D    G   +L++D + FA FF  Y       A  P P   I   ++
Sbjct: 10  IKKNESELREHHEDFRMFGLITFLIADGMTFAGFFAAYLTYK---AVNPLPDGAIYELEL 66

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHK----TVSWLLVTAFFGMIFIIMEIYEFA 127
               ++TI+LL+SS     A    A K L+      T  WLLVTA  G++F+I +++E+ 
Sbjct: 67  PIPTLNTILLLVSS-----ATFHKAGKALLKNKNSDTQKWLLVTALLGIVFLICQLFEYF 121

Query: 128 HLISMEAVP---QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQR--R 182
           +L      P     + F S+F+AL G HGLHV  G + + ++  Q   KG    NQ    
Sbjct: 122 NL------PFGLTDNLFASTFYALTGFHGLHVTLGTLMILIISWQARSKGGRITNQNMFP 175

Query: 183 LICLSMFWHFLDLIWICVFSFVYLM 207
           L  + ++WHF+D IW+ +F  +YL+
Sbjct: 176 LEAVELYWHFVDGIWVVLFIILYLL 200


>gi|256788231|ref|ZP_05526662.1| cytochrome c oxidase subunit III [Streptomyces lividans TK24]
          Length = 169

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 54/166 (32%), Positives = 90/166 (54%), Gaps = 5/166 (3%)

Query: 44  MFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHK 103
           +FA++F   +V G ++ +  A  D  +I     +T +L+LSSL+C   + A A +  + K
Sbjct: 6   LFAMYFTLRSVTGPDFWSEKA--DALNIPFSATNTTILVLSSLTCQLGVFA-AERGDVKK 62

Query: 104 TVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS-AFLSSFFALVGLHGLHVFFGLI- 161
              W +VT   G IFI  +++E+  L+  E +   S  + S+F+   G HGLHV  GLI 
Sbjct: 63  LRMWFIVTFVMGAIFIGGQVFEYTELVKHEGISLSSDPYGSAFYLTTGFHGLHVTGGLIA 122

Query: 162 WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           +L VL      +          I +S +WHF+D++WI +F+ +YL+
Sbjct: 123 FLLVLGRTYAARRFTHEQATAAIVVSYYWHFVDVVWIGLFATIYLI 168


>gi|296269276|ref|YP_003651908.1| cytochrome-c oxidase [Thermobispora bispora DSM 43833]
 gi|296092063|gb|ADG88015.1| Cytochrome-c oxidase [Thermobispora bispora DSM 43833]
          Length = 205

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 93/176 (52%), Gaps = 6/176 (3%)

Query: 36  IYLMSDCLMFAVFFVTYAVLGKNYAAG---PAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           ++L S+ + FA  F  Y  + + +A G   P P    DI     +T +L+LSS++C   +
Sbjct: 31  VWLSSELMFFAALFAMYFTI-RAFALGQGQPWPEAHLDIPFATANTTILVLSSVTCQLGV 89

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
            A   +  + K   W  V+   G IF+  +++E+ +L+        S + S F+   G H
Sbjct: 90  WA-VERGQVGKLQFWYWVSFLLGAIFVAGQLWEYGNLVHEGHTLSHSPYDSIFYLATGFH 148

Query: 153 GLHVFFGLI-WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           GLHV  GL+ +LF+L    + K L    Q   I +S +WHF+D++WI +F+ +Y++
Sbjct: 149 GLHVTGGLVAFLFLLGRTYVAKRLTHEQQTSAIVVSYYWHFVDVVWIGLFATIYII 204


>gi|172040916|ref|YP_001800630.1| cytochrome c oxidase subunit III [Corynebacterium urealyticum DSM
           7109]
 gi|171852220|emb|CAQ05196.1| cytochrome c oxidase subunit III [Corynebacterium urealyticum DSM
           7109]
          Length = 194

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 87/164 (53%), Gaps = 4/164 (2%)

Query: 44  MFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHK 103
           +FA++FV+ A  G N+ + P  ++V   + I   TI+L+ SS++  F + A A +  +  
Sbjct: 34  LFAMYFVSKANSGGNWPSEPTELNVPFAATI---TIILISSSVTAQFGVFA-AERGDVFA 89

Query: 104 TVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWL 163
              W  ++A  G +F+I + YE+ HL+        S + S FF   G HG HV  G+I  
Sbjct: 90  LRRWYALSALLGTVFLIGQGYEYFHLVQTGTTIPGSVYGSVFFITTGFHGAHVLAGVIAF 149

Query: 164 FVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
            V++++  K           + +S +WHF+D++WI ++  +Y +
Sbjct: 150 LVVLLRTFKSKFTPAQATAAVVVSYYWHFVDVVWIGLWITIYFV 193


>gi|315290023|ref|ZP_07872198.1| quinol oxidase, subunit 3 [Listeria ivanovii FSL F6-596]
 gi|313630855|gb|EFR98564.1| quinol oxidase, subunit 3 [Listeria ivanovii FSL F6-596]
          Length = 96

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/93 (41%), Positives = 61/93 (65%)

Query: 118 FIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLIS 177
           F+  E+YEFAH ++     Q  ++ S+FF L+G HGLHV  G+ W+  ++IQI   GL  
Sbjct: 3   FVGFELYEFAHYVTEGVTMQVGSYWSAFFVLLGTHGLHVTVGIFWISFILIQIKMHGLTP 62

Query: 178 GNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
               ++   S++WHFLD++WI +F+ VYL+G+V
Sbjct: 63  KTASKVFISSLYWHFLDVVWIFIFTGVYLLGMV 95


>gi|13471153|ref|NP_102722.1| cytochrome c oxidase subunit III [Mesorhizobium loti MAFF303099]
 gi|14021897|dbj|BAB48508.1| cytochrome c oxidase subunit III [Mesorhizobium loti MAFF303099]
          Length = 239

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 96/196 (48%), Gaps = 24/196 (12%)

Query: 35  WIYLMSDCLMFAVFFVTYAVLG-KNYAAGPAPIDVF-------DISGIFVSTIVLLLSSL 86
           WI+L+SD  +F  F + Y           P P +VF       +I  I ++ +  +L S 
Sbjct: 43  WIFLLSDTFIFGCFLLAYMTARISTREPWPNPSEVFALRIGGSEIPLILIAIMTFVLISS 102

Query: 87  SCSFAMLAS-ATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP-----QRSA 140
           S + AM  +   +R   KT   +L+TA  G  F+ M+ +E+  LI+    P       + 
Sbjct: 103 SGTMAMAVNFGYRRDRRKTAILMLLTAALGATFVGMQAFEWTKLITEGVRPWGNPWGAAQ 162

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ----------RRLICLSMFW 190
           F SSFF + G HG HV  G+I+L ++  ++ +    +G +            +  + ++W
Sbjct: 163 FGSSFFMITGFHGTHVTIGVIFLIIVARKVWRGDFDTGRRGFFTSRKGRYENVEIMGLYW 222

Query: 191 HFLDLIWICVFSFVYL 206
           HF+DL+W+ +F+F YL
Sbjct: 223 HFVDLVWVFIFAFFYL 238


>gi|294011124|ref|YP_003544584.1| cytochrome c oxidase subunit III [Sphingobium japonicum UT26S]
 gi|292674454|dbj|BAI95972.1| cytochrome c oxidase subunit III [Sphingobium japonicum UT26S]
          Length = 227

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 95/187 (50%), Gaps = 15/187 (8%)

Query: 35  WIYLMSDCLMFAVFFVTY-AVLGKNYAAGPAPIDVF-------DISGIFVSTIVLLLSSL 86
           WI+L+SD  +F+ F   Y  V        P   +VF        I  I ++ +  +L S 
Sbjct: 40  WIFLLSDTFIFSCFLTGYMTVRASAVLPWPNTAEVFALTIGGQSIPLILIAIMTFVLISS 99

Query: 87  SCSFAMLAS-ATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA----- 140
           S + AM  +   +R   KT + +L+TA FG  F+ M+ +E+  LI     P  +      
Sbjct: 100 SGTMAMAVNFGYRRDRRKTAALMLLTALFGTTFVSMQAFEWTKLIEEGVRPWSNPMGAPQ 159

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGL-ISGNQRRLICLSMFWHFLDLIWIC 199
           F +SFF + G HGLHV  G+I L ++  ++ +     +G+   +    ++WHF+DL+W+ 
Sbjct: 160 FGASFFMITGFHGLHVTCGVILLLIIAYKVARGHYDRTGDYSAVEIAGLYWHFVDLVWVF 219

Query: 200 VFSFVYL 206
           +F+F YL
Sbjct: 220 IFAFFYL 226


>gi|255023634|ref|ZP_05295620.1| AA3-600 quinol oxidase subunit III [Listeria monocytogenes FSL
           J1-208]
          Length = 161

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 84/161 (52%), Gaps = 8/161 (4%)

Query: 4   QKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK-NYAAG 62
           + +  + N  + Y  ++    +      LGFWI+L ++  +FA  F TY V+ K    AG
Sbjct: 2   ESVETNKNLPIEYRSEQGRLNI------LGFWIFLGAEIALFATLFATYFVMRKAGSNAG 55

Query: 63  PAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIME 122
             P ++F++  + + T +LL SS +C  A +    K  +     + ++T   G  F+  E
Sbjct: 56  HPPAEMFELWLVLIMTFLLLTSSFTCGLA-IGEMRKGNVKMLTIYSIITLILGAGFVGFE 114

Query: 123 IYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWL 163
           +YEFAH ++     Q  ++ S+FF L+G HGLHV  G+ W+
Sbjct: 115 LYEFAHYVTEGVTMQIGSYWSAFFVLLGTHGLHVTVGIFWI 155


>gi|145223396|ref|YP_001134074.1| cytochrome c oxidase, subunit III [Mycobacterium gilvum PYR-GCK]
 gi|145215882|gb|ABP45286.1| cytochrome c oxidase, subunit III [Mycobacterium gilvum PYR-GCK]
          Length = 197

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 85/174 (48%), Gaps = 1/174 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           +G  ++L S+ + FA  F  Y          P P    +++     T++L+ SS +C   
Sbjct: 22  VGTIVWLSSELMFFAGLFAMYFTARAQADEWPPPPTELNLALAVPVTLILIASSFTCQMG 81

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           + A A +  +     W +VT   G+IF++ + YE+  L+        SA+ S F+   G 
Sbjct: 82  VFA-AERGDVFGLRRWYVVTLLMGLIFVLGQGYEYISLVREGTTIAGSAYGSVFYLTTGF 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
           HGLHV  GL+   +L+I+              I +S +WHF+D++WI +F+ +Y
Sbjct: 141 HGLHVIGGLVAFILLLIRTRMSKFTPAQATAAIVVSYYWHFVDIVWIALFATIY 194


>gi|297194819|ref|ZP_06912217.1| cytochrome c oxidase subunit III [Streptomyces pristinaespiralis
           ATCC 25486]
 gi|197720720|gb|EDY64628.1| cytochrome c oxidase subunit III [Streptomyces pristinaespiralis
           ATCC 25486]
          Length = 206

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 95/184 (51%), Gaps = 9/184 (4%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTY----AVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS 85
           T +G  I+L S+ + FA  F  Y    +V G  + A  A    F  S    +T +L+LSS
Sbjct: 25  TSVGTIIWLSSELMFFAALFAMYFTLRSVTGAEFWAEKADALNFPFSA--TNTTILVLSS 82

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS-AFLSS 144
           L+C   + A A +  + K  +W ++T   G IFI  +++E+  L+  E +   S  + S 
Sbjct: 83  LTCQLGVFA-AERGDVKKLRTWFVITFVMGAIFIGGQVFEYTELVKHEGLSLSSDPYGSV 141

Query: 145 FFALVGLHGLHVFFGLI-WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           F+   G HGLHV  GLI +L VL      +          I +S +WHF+D++WI +F+ 
Sbjct: 142 FYLTTGFHGLHVTGGLIAFLLVLGRTYAARRFTHEQATAAIVVSYYWHFVDVVWIGLFAT 201

Query: 204 VYLM 207
           +Y++
Sbjct: 202 IYMI 205


>gi|218659781|ref|ZP_03515711.1| putative transmembrane cytochrome oxidase subunit [Rhizobium etli
           IE4771]
          Length = 239

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 99/196 (50%), Gaps = 24/196 (12%)

Query: 35  WIYLMSDCLMFAVFFVTYAVLGKNYA-AGPAPIDVF-------DISGIFVSTIVLLLSSL 86
           WI+L+SD  +F  F + Y     +   A P P +VF       D+  I ++ +  +L S 
Sbjct: 43  WIFLLSDTFVFGCFLLAYMTARMSTPVAWPNPSEVFALHIGGQDVPLILIAIMTFVLISS 102

Query: 87  SCSFAMLAS-ATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA----- 140
           S + AM  +   +R   +T   +L+TA  G  F+ M  +E+  LI+    P  +      
Sbjct: 103 SGTMAMAVNFGYRRDRGRTAVLMLLTALLGACFVGMHAFEWTKLITERVRPWENPWGAAQ 162

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQILK-------KGLIS---GNQRRLICLSMFW 190
           F S+FF + G HG HV  G+I+L ++  ++ +       +G  +   G+   +  + ++W
Sbjct: 163 FGSTFFMITGFHGTHVTIGVIFLLIVARKVWRGDFDVERRGFFTSRRGHYEAVEIMGLYW 222

Query: 191 HFLDLIWICVFSFVYL 206
           HF+DL+W+ +F+F YL
Sbjct: 223 HFVDLVWVFIFAFFYL 238


>gi|23308908|ref|NP_601396.2| cytochrome C oxidase subunit III [Corynebacterium glutamicum ATCC
           13032]
 gi|62391032|ref|YP_226434.1| cytochrome c oxidase subunit 3 [Corynebacterium glutamicum ATCC
           13032]
 gi|62900043|sp|Q9AEL8|COX3_CORGL RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome aa3 subunit 3; AltName: Full=Cytochrome
           c oxidase polypeptide III
 gi|13274108|emb|CAC33825.1| cytochrome aa3 oxidase subunit III [Corynebacterium glutamicum]
 gi|15430576|dbj|BAB64408.1| cytochrome c oxidase subunit III [Corynebacterium glutamicum]
 gi|21324962|dbj|BAB99585.1| Heme/copper-type cytochrome/quinol oxidase, subunit 3
           [Corynebacterium glutamicum ATCC 13032]
 gi|41326371|emb|CAF20533.1| CYTOCHROME C OXIDASE SUBUNIT 3 [Corynebacterium glutamicum ATCC
           13032]
          Length = 205

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 91/179 (50%), Gaps = 4/179 (2%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPA---PIDVFDISGIFVSTIVLLLSSLSC 88
           +G  ++L  + + FA  F  Y V   N  A  +     D  ++    + T++L+ SS++C
Sbjct: 27  VGTIVFLSQELMFFAGLFAMYFVSRANGLANGSWGEQTDHLNVPYALLITVILVSSSVTC 86

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            F + A A +  ++    W LVT   G IF+I + YE+  L+      Q S + S+FF  
Sbjct: 87  QFGVFA-AERGDVYGLRKWFLVTIILGSIFVIGQGYEYITLVGHGLTIQSSVYGSAFFIT 145

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
            G H LHV  G++   V++++I K           + +S +WHF+D++WI +F  +Y +
Sbjct: 146 TGFHALHVIAGVMAFVVVLMRIHKSKFTPAQATAAMVVSYYWHFVDVVWIGLFITIYFI 204


>gi|241205302|ref|YP_002976398.1| cytochrome C oxidase subunit III [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240859192|gb|ACS56859.1| cytochrome c oxidase subunit III [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 239

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 99/196 (50%), Gaps = 24/196 (12%)

Query: 35  WIYLMSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVF-------DISGIFVSTIVLLLSSL 86
           WI+L+SD  +F  F + Y     +     P P +VF       D+  I ++ +  +L S 
Sbjct: 43  WIFLLSDTFVFGCFLIAYMTARMSTPVPWPNPSEVFALHIGGQDVPLILIAIMTFVLISS 102

Query: 87  SCSFAMLASATKRLIHKTVSWL-LVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA----- 140
           S + AM  +   R   +T + L L+TA  G  F+ M+ +E+  LI+    P  +      
Sbjct: 103 SGTMAMAVNFGYRRDRRTTAILMLLTAVLGACFVGMQAFEWTKLITEGVRPWENPWGAAQ 162

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQILK-------KGLISGNQRR---LICLSMFW 190
           F S+FF + G HG HV  G+I+L ++  ++ +       +G  +  + R   +  + ++W
Sbjct: 163 FGSTFFMITGFHGTHVTIGVIFLLIVARKVWRGDFDEERRGFFTSRKGRYEAVEIMGLYW 222

Query: 191 HFLDLIWICVFSFVYL 206
           HF+DL+W+ +F+F YL
Sbjct: 223 HFVDLVWVFIFAFFYL 238


>gi|72161426|ref|YP_289083.1| cytochrome c oxidase subunit III [Thermobifida fusca YX]
 gi|71915158|gb|AAZ55060.1| cytochrome c oxidase subunit III [Thermobifida fusca YX]
          Length = 194

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/166 (33%), Positives = 84/166 (50%), Gaps = 3/166 (1%)

Query: 44  MFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHK 103
           +FA++F   +V   N   GP P    +I      T +L+ SS +  F + A A +  + K
Sbjct: 29  LFAMYFTIRSVTKGNPDLGPWPDAHLNIVLSTTITTILVASSFTAQFGVWA-AERGDVKK 87

Query: 104 TVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS-AFLSSFFALVGLHGLHVFFGLI- 161
              W  ++   G IFII + YE+  LI  E +  RS A+ S FF   G HGLHV  GL  
Sbjct: 88  LRKWFFISFLLGAIFIIGQGYEYYELIVHEGLTMRSSAYGSMFFLTTGFHGLHVLGGLFA 147

Query: 162 WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           +L VL      K          I +S +WHF+D++W+ +F+ +YL+
Sbjct: 148 FLLVLGRTYAAKRFTHQQATSAIVVSYYWHFVDVVWVGLFASIYLL 193


>gi|302561060|ref|ZP_07313402.1| cytoChrome c oxidase subunit III [Streptomyces griseoflavus Tu4000]
 gi|302478678|gb|EFL41771.1| cytoChrome c oxidase subunit III [Streptomyces griseoflavus Tu4000]
          Length = 203

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 96/184 (52%), Gaps = 9/184 (4%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTY----AVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS 85
           T +G  I+L S+ + FA  F  Y    +V G ++ +  A +  F  S    +T +L+LSS
Sbjct: 22  TSVGTIIWLSSELMFFAALFAMYFTLRSVTGPDFWSEKADLLNFPFSA--TNTTILVLSS 79

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS-AFLSS 144
           L+C   + A A +  + K   W +VT   G +FI  +++E+  L+  E +   S  + S 
Sbjct: 80  LTCQLGVFA-AERGDVKKLRMWFIVTFIMGAVFIGGQVFEYTELVKHEGLSLSSDPYGSV 138

Query: 145 FFALVGLHGLHVFFGLI-WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           F+   G HGLHV  GLI +L VL      +          I +S +WHF+D++WI +F+ 
Sbjct: 139 FYLTTGFHGLHVTGGLIAFLLVLGRTYAARRFTHEQATAAIVVSYYWHFVDVVWIGLFAT 198

Query: 204 VYLM 207
           +Y++
Sbjct: 199 IYMI 202


>gi|254382659|ref|ZP_04998017.1| cytochrome c oxidase subunit III [Streptomyces sp. Mg1]
 gi|194341562|gb|EDX22528.1| cytochrome c oxidase subunit III [Streptomyces sp. Mg1]
          Length = 206

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 92/182 (50%), Gaps = 9/182 (4%)

Query: 32  LGFWIYLMSDCLMFAVFFVTY----AVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
           +G  I+L S+ + FA  F  Y    +V G  Y    A       S    +T +L+LSSL+
Sbjct: 27  VGTIIWLSSELMFFAALFAMYFTLRSVTGAEYWTEQASALNLPFSA--TNTTILVLSSLT 84

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA-FLSSFF 146
           C   + A A +  + K  +W ++T   G IFI  +++E+  L+  E +   S  + S F+
Sbjct: 85  CQLGVFA-AERGDVKKLRTWFIITFVMGAIFIGGQVFEYTELVKHEGMSLSSGPYGSVFY 143

Query: 147 ALVGLHGLHVFFGLI-WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
              G HGLHV  GLI +L VL      K          I +S +WHF+D++WI +F+ +Y
Sbjct: 144 LTTGFHGLHVTGGLIAFLLVLGRTYAAKRFTHEQATSAIVVSYYWHFVDVVWIGLFATIY 203

Query: 206 LM 207
           L+
Sbjct: 204 LI 205


>gi|126695806|ref|YP_001090692.1| cytochrome c oxidase, subunit III [Prochlorococcus marinus str. MIT
           9301]
 gi|126542849|gb|ABO17091.1| Cytochrome c oxidase, subunit III [Prochlorococcus marinus str. MIT
           9301]
          Length = 200

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 102/203 (50%), Gaps = 27/203 (13%)

Query: 18  KDKKESCVDH-DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAP---IDVFDISG 73
           K+  E    H D    G   +L++D + FA FF  Y       A  P P   I   ++  
Sbjct: 12  KNNSEVNETHEDFRMFGLITFLIADGMTFAGFFAAYLTYK---AVNPLPDGAIYELELPI 68

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVS----WLLVTAFFGMIFIIMEIYEFAHL 129
             ++TI+LL+SS     A    A K L+    S    WL  TAF G+IF+I +++E+ HL
Sbjct: 69  PTLNTILLLVSS-----ATFHKAGKALLKDKNSESQKWLFFTAFLGIIFLICQLFEYFHL 123

Query: 130 ISMEAVP---QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQI-LKKG-LISGNQRRLI 184
                 P     + F S+F+AL G HGLHV  G + + ++  Q  +K G L S N   L 
Sbjct: 124 ------PFGLTDNLFASTFYALTGFHGLHVTLGTLMILIIAWQSRIKSGRLTSQNMFPLE 177

Query: 185 CLSMFWHFLDLIWICVFSFVYLM 207
            + ++WHF+D IW+ +F  +YL+
Sbjct: 178 AVELYWHFVDGIWVILFIILYLL 200


>gi|302534026|ref|ZP_07286368.1| cytochrome aa3 quinol oxidase, subunit III [Streptomyces sp. C]
 gi|302442921|gb|EFL14737.1| cytochrome aa3 quinol oxidase, subunit III [Streptomyces sp. C]
          Length = 206

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 94/182 (51%), Gaps = 9/182 (4%)

Query: 32  LGFWIYLMSDCLMFAVFFVTY----AVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
           +G  I+L S+ + FA  F  Y    +V G  Y    A  +  ++     +T +L+LSSL+
Sbjct: 27  VGTIIWLSSELMFFAALFAMYFTLRSVTGAEYWTEQA--EALNLPFSATNTTILVLSSLT 84

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA-FLSSFF 146
           C   + A A +  + K  +W ++T   G IFI  +++E+  L+  E +   S  + + F+
Sbjct: 85  CQLGVFA-AERGDVKKLRTWFIITFVMGAIFIGGQVFEYTELVKHEGMSLSSGPYGTVFY 143

Query: 147 ALVGLHGLHVFFGLI-WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
              G HGLHV  GLI +L VL      K          I +S +WHF+D++WI +F+ +Y
Sbjct: 144 LTTGFHGLHVTGGLIAFLLVLGRTYAAKRFTHEQATSAIVVSYYWHFVDVVWIGLFATIY 203

Query: 206 LM 207
           L+
Sbjct: 204 LI 205


>gi|116252786|ref|YP_768624.1| transmembrane cytochrome oxidase subunit [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115257434|emb|CAK08530.1| putative transmembrane cytochrome oxidase subunit [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 239

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 99/196 (50%), Gaps = 24/196 (12%)

Query: 35  WIYLMSDCLMFAVFFVTYAVLGKNYA-AGPAPIDVF-------DISGIFVSTIVLLLSSL 86
           WI+L+SD  +F  F + Y     +   A P P +VF       D+  I ++ +  +L S 
Sbjct: 43  WIFLLSDTFVFGCFLIAYMTARMSTPVAWPNPSEVFALHIGGQDVPLILIAIMTFVLISS 102

Query: 87  SCSFAMLAS-ATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA----- 140
           S + AM  +   +R    T   +L+TA  G  F+ M+ +E+  LI+    P  +      
Sbjct: 103 SGTMAMAVNFGYRRDRRMTAMLMLLTAVLGAGFVGMQAFEWTKLITEGVRPWENPWGAAQ 162

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQILK-------KGLISGNQRR---LICLSMFW 190
           F S+FF + G HG HV  G+I+L ++  ++ +       +G  +  + R   +  + ++W
Sbjct: 163 FGSTFFMITGFHGTHVTIGVIFLLIVARKVWRGDFDVERRGFFTSRKGRYEAVEIMGLYW 222

Query: 191 HFLDLIWICVFSFVYL 206
           HF+DL+W+ +F+F YL
Sbjct: 223 HFVDLVWVFIFAFFYL 238


>gi|190892331|ref|YP_001978873.1| cytochrome c oxidase, subunit III [Rhizobium etli CIAT 652]
 gi|190697610|gb|ACE91695.1| cytochrome c oxidase protein, subunit III [Rhizobium etli CIAT 652]
          Length = 239

 Score = 82.4 bits (202), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 98/196 (50%), Gaps = 24/196 (12%)

Query: 35  WIYLMSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVF-------DISGIFVSTIVLLLSSL 86
           WI+L+SD  +F  F + Y     +     P P +VF       D+  I ++ +  +L S 
Sbjct: 43  WIFLLSDTFVFGCFLIAYMTARMSTPVPWPNPSEVFALHIGGADVPLILIAIMTFVLISS 102

Query: 87  SCSFAMLAS-ATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA----- 140
           S + AM  +   +R    T   +L+TA  G  F+ M+ +E+  LI+    P  +      
Sbjct: 103 SGTMAMAVNFGYRRDRRVTAILMLLTALLGATFVSMQAFEWTKLITEGVRPWENPWGAAQ 162

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQILK-------KGLISGNQRR---LICLSMFW 190
           F S+FF + G HG HV  G+I+L ++  ++ +       +G  +  + R   +  + ++W
Sbjct: 163 FGSTFFMITGFHGTHVTIGVIFLLIIARKVWRGDFDVERRGFFTSRKGRYEAVEIMGLYW 222

Query: 191 HFLDLIWICVFSFVYL 206
           HF+DL+W+ +F+F YL
Sbjct: 223 HFVDLVWVFIFAFFYL 238


>gi|119869385|ref|YP_939337.1| cytochrome c oxidase, subunit III [Mycobacterium sp. KMS]
 gi|126435880|ref|YP_001071571.1| cytochrome c oxidase, subunit III [Mycobacterium sp. JLS]
 gi|119695474|gb|ABL92547.1| cytochrome c oxidase, subunit III [Mycobacterium sp. KMS]
 gi|126235680|gb|ABN99080.1| cytochrome c oxidase, subunit III [Mycobacterium sp. JLS]
          Length = 203

 Score = 82.4 bits (202), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 91/191 (47%), Gaps = 4/191 (2%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAG--PAPIDVFDISGI 74
           +  +  S    +   +G  ++L S+ + FA  F  Y    +  A G  P P    +++  
Sbjct: 12  ITSRVHSLNRPNMVSVGTIVWLSSELMFFAGLFAMY-FTARAQAGGEWPPPPTELNLALA 70

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
              T+VL+ SS +C   + A A +  +     W ++T   G+ F++ ++YE+ HL+    
Sbjct: 71  VPVTLVLIASSFTCQMGVFA-AERGDVFGLRRWYVLTFLMGLFFVLGQLYEYYHLVHEGT 129

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
               SA+ S F+   G HGLHV  GL+    L+ +              I +S +WHF+D
Sbjct: 130 TIPGSAYGSVFYLATGFHGLHVIGGLVAFLFLLARTKMSKFTPAQATAAIVVSYYWHFVD 189

Query: 195 LIWICVFSFVY 205
           ++WI +F+ +Y
Sbjct: 190 IVWIALFAVIY 200


>gi|91070413|gb|ABE11325.1| cytochrome c oxidase, subunit III [uncultured Prochlorococcus
           marinus clone HOT0M-10D2]
          Length = 200

 Score = 82.4 bits (202), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 100/203 (49%), Gaps = 27/203 (13%)

Query: 18  KDKKESCVDH-DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAP---IDVFDISG 73
           K+  E    H D    G   +L++D + FA FF  Y       A  P P   I   ++  
Sbjct: 12  KNNSEVNETHEDFRMFGLITFLIADGMTFAGFFAAYLTYK---AVNPLPDGAIYELELPI 68

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIH----KTVSWLLVTAFFGMIFIIMEIYEFAHL 129
             ++TI+LL+SS     A    A K L+      +  WL +TA  G+IF+I +++E+ HL
Sbjct: 69  PTLNTILLLVSS-----ATFHKAGKALLKDKNFNSQKWLFITASLGIIFLICQLFEYFHL 123

Query: 130 ISMEAVP---QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLI 184
                 P     + F S+F+AL G HGLHV  G + + ++  Q    G  L S N   L 
Sbjct: 124 ------PFGLTDNLFASTFYALTGFHGLHVTLGTLMILIIAWQSRSNGGRLTSQNMFPLE 177

Query: 185 CLSMFWHFLDLIWICVFSFVYLM 207
            + ++WHF+D IW+ +F  +YL+
Sbjct: 178 AVELYWHFVDGIWVILFIILYLL 200


>gi|68535794|ref|YP_250499.1| cytochrome c oxidase subunit III [Corynebacterium jeikeium K411]
 gi|68263393|emb|CAI36881.1| cytochrome c oxidase subunit III [Corynebacterium jeikeium K411]
          Length = 194

 Score = 82.4 bits (202), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 86/164 (52%), Gaps = 4/164 (2%)

Query: 44  MFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHK 103
           +FA++FV+ A  G N+ + P  ++V   + I   T++L+ SS +  + + A A +  +  
Sbjct: 34  LFAMYFVSKANSGGNWPSEPTELNVPFAATI---TVILISSSFTAQWGVFA-AERGDVFA 89

Query: 104 TVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWL 163
              W  ++A  G IF+I + YE+ HL+        S + S FF   G HG HV  G+I  
Sbjct: 90  LRKWYALSALLGTIFLIGQGYEYVHLVQHGTTIPGSVYGSVFFITTGFHGAHVLAGVIAF 149

Query: 164 FVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
            V++++  K           + +S +WHF+D++WI ++  +Y +
Sbjct: 150 LVVLLRTAKSKFTPAQATAAVVVSYYWHFVDVVWIGLWITIYFI 193


>gi|312140186|ref|YP_004007522.1| cytochrome c oxidase subunit iii [Rhodococcus equi 103S]
 gi|311889525|emb|CBH48842.1| cytochrome c oxidase subunit III [Rhodococcus equi 103S]
          Length = 188

 Score = 82.4 bits (202), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 83/164 (50%), Gaps = 4/164 (2%)

Query: 44  MFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHK 103
           +FA++FV  A    N+   P P ++ +++     T+VL+ SS +C   + A A K  +  
Sbjct: 28  LFAMYFVARAQANGNWP--PEPTEL-NLTLAVPVTLVLIASSFTCQMGVFA-AEKGDVFG 83

Query: 104 TVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWL 163
              W LVT   G  F++ + YE+ HL+        S + S F+   G HGLHV  GLI  
Sbjct: 84  LRRWYLVTLAMGTFFVLGQGYEYYHLVHEGTTISSSVYGSVFYMTTGFHGLHVIGGLIAF 143

Query: 164 FVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
             L+++              I +S +WHF+D++WI +F+ +Y +
Sbjct: 144 VFLIVRTKVSKFTPAQATAAIVVSYYWHFVDIVWIGLFATIYFI 187


>gi|78778828|ref|YP_396940.1| cytochrome c oxidase, subunit III [Prochlorococcus marinus str. MIT
           9312]
 gi|78712327|gb|ABB49504.1| cytochrome c oxidase, subunit III [Prochlorococcus marinus str. MIT
           9312]
          Length = 200

 Score = 82.0 bits (201), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 99/203 (48%), Gaps = 27/203 (13%)

Query: 18  KDKKESCVDHDG-TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAP---IDVFDISG 73
           K+  E    HD     G   +L++D + FA FF  Y       A  P P   I   ++  
Sbjct: 12  KNNSEVNEKHDDFRMFGLITFLIADGMTFAGFFAAYLTYK---AVNPLPDGAIYELELPI 68

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHK----TVSWLLVTAFFGMIFIIMEIYEFAHL 129
             ++TI+LL+SS     A    A K L+         WL  TAF G+IF+I +++E+ HL
Sbjct: 69  PTLNTILLLVSS-----ATFHKAGKALLKDKNPDAQKWLFCTAFLGIIFLICQLFEYFHL 123

Query: 130 ISMEAVP---QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLI 184
                 P     + F S+F+AL G HGLHV  G + + ++  Q    G  + S N   L 
Sbjct: 124 ------PFGLTDNLFASTFYALTGFHGLHVTLGTLMILIIAWQSRINGGRVTSQNMFPLE 177

Query: 185 CLSMFWHFLDLIWICVFSFVYLM 207
            + ++WHF+D IW+ +F  +YL+
Sbjct: 178 AVELYWHFVDGIWVILFIILYLL 200


>gi|325676932|ref|ZP_08156604.1| cytochrome c oxidase, subunit III [Rhodococcus equi ATCC 33707]
 gi|325552232|gb|EGD21922.1| cytochrome c oxidase, subunit III [Rhodococcus equi ATCC 33707]
          Length = 180

 Score = 82.0 bits (201), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 83/164 (50%), Gaps = 4/164 (2%)

Query: 44  MFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHK 103
           +FA++FV  A    N+   P P ++ +++     T+VL+ SS +C   + A A K  +  
Sbjct: 20  LFAMYFVARAQANGNWP--PEPTEL-NLTLAVPVTLVLIASSFTCQMGVFA-AEKGDVFG 75

Query: 104 TVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWL 163
              W LVT   G  F++ + YE+ HL+        S + S F+   G HGLHV  GLI  
Sbjct: 76  LRRWYLVTLAMGTFFVLGQGYEYYHLVHEGTTISSSVYGSVFYMTTGFHGLHVIGGLIAF 135

Query: 164 FVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
             L+++              I +S +WHF+D++WI +F+ +Y +
Sbjct: 136 VFLIVRTKVSKFTPAQATAAIVVSYYWHFVDIVWIGLFATIYFI 179


>gi|260578118|ref|ZP_05846039.1| cytochrome c oxidase, subunit III [Corynebacterium jeikeium ATCC
           43734]
 gi|258603757|gb|EEW17013.1| cytochrome c oxidase, subunit III [Corynebacterium jeikeium ATCC
           43734]
          Length = 180

 Score = 82.0 bits (201), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 86/164 (52%), Gaps = 4/164 (2%)

Query: 44  MFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHK 103
           +FA++FV+ A  G N+ + P  ++V   + I   T++L+ SS +  + + A A +  +  
Sbjct: 20  LFAMYFVSKANSGGNWPSEPTELNVPFAATI---TVILISSSFTAQWGVFA-AERGDVFA 75

Query: 104 TVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWL 163
              W  ++A  G IF+I + YE+ HL+        S + S FF   G HG HV  G+I  
Sbjct: 76  LRKWYALSALLGTIFLIGQGYEYVHLVQHGTTIPGSVYGSVFFITTGFHGAHVLAGVIAF 135

Query: 164 FVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
            V++++  K           + +S +WHF+D++WI ++  +Y +
Sbjct: 136 LVVLLRTAKSKFTPAQATAAVVVSYYWHFVDVVWIGLWITIYFI 179


>gi|196233769|ref|ZP_03132608.1| cytochrome c oxidase subunit III [Chthoniobacter flavus Ellin428]
 gi|196222131|gb|EDY16662.1| cytochrome c oxidase subunit III [Chthoniobacter flavus Ellin428]
          Length = 214

 Score = 81.6 bits (200), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 57/206 (27%), Positives = 106/206 (51%), Gaps = 26/206 (12%)

Query: 21  KESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISG----IFV 76
           +++    +   LG W++L ++ L F   F+ Y V    Y       +VF ++     I +
Sbjct: 12  EDAAQQREAATLGMWVFLATEVLFFGAMFLGYTVYRLKYP------EVFRMASEHTIIVI 65

Query: 77  STI---VLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS-- 131
            TI   +LLLSS +   A+ A+  KR +   +++L VTA FG+ F++++ +E+AH I+  
Sbjct: 66  GTINTGILLLSSFTMVLAVRAAEFKRRM-ALIAFLSVTALFGIAFLVLKGFEYAHEINEG 124

Query: 132 ---------MEAVPQRSA-FLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQR 181
                     EA P  +  F   +F + G+H LHV  G+I L +  ++ +    +     
Sbjct: 125 LFPGSHFQFTEADPYTARMFFYLYFLMTGVHALHVTIGVIMLVIFALRAMLTLKLERLST 184

Query: 182 RLICLSMFWHFLDLIWICVFSFVYLM 207
            +  L ++WHF+D++W+ +F  +YL+
Sbjct: 185 AVDLLGLYWHFVDIVWVFLFPLIYLV 210


>gi|184200926|ref|YP_001855133.1| cytochrome c oxidase subunit III [Kocuria rhizophila DC2201]
 gi|183581156|dbj|BAG29627.1| cytochrome c oxidase subunit III [Kocuria rhizophila DC2201]
          Length = 212

 Score = 81.6 bits (200), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 101/207 (48%), Gaps = 22/207 (10%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPA----PIDVFDISG 73
           K    S    + T +G  ++L S+ + FA  F  Y  L    A  P       ++ ++  
Sbjct: 10  KPVGASITRPNLTSVGTIVWLSSEVMFFAGLFAMYFTL---RATSPEVWAENTEILNVPM 66

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTV------------SWLLVTAFFGMIFIIM 121
             V+T++L+LSS++C F + A+  +RL  +               W  +T   G +F+ +
Sbjct: 67  ASVNTLILVLSSVTCQFGVFAA--ERLQPRRTGGLFQVSKWGLTEWFALTFLMGAVFVSV 124

Query: 122 EIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLI-WLFVLVIQILKKGLISGNQ 180
           ++YE+A L+S       SA+ S+F+   G H LHV  GLI +LF++    + K       
Sbjct: 125 QVYEYASLVSEGVTIAASAYGSAFYITTGFHALHVTGGLIAFLFIMGRAFVAKRFGHYEA 184

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLM 207
              I +S +WHF+D++WI +F  VY +
Sbjct: 185 TSAIVVSYYWHFVDVVWIVLFFLVYFI 211


>gi|302546079|ref|ZP_07298421.1| cytoChrome c oxidase subunit III [Streptomyces hygroscopicus ATCC
           53653]
 gi|302463697|gb|EFL26790.1| cytoChrome c oxidase subunit III [Streptomyces himastatinicus ATCC
           53653]
          Length = 206

 Score = 81.6 bits (200), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 60/184 (32%), Positives = 94/184 (51%), Gaps = 9/184 (4%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTY----AVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS 85
           T +G  I+L S+ + FA  F  Y    +V G  +    A    F  S    +T +L+LSS
Sbjct: 25  TSVGTIIWLSSELMFFAALFAMYFTLRSVTGAEHWKEMASSLNFPFSA--TNTTILVLSS 82

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS-AFLSS 144
           L+C   + A A +  + K  SW ++T   G IFI  +I+E+  L+  + +   S  + S 
Sbjct: 83  LTCQLGVFA-AERGDVRKLRSWFVITFIMGAIFIGGQIFEYTELVKKDGLSLSSDPYGSV 141

Query: 145 FFALVGLHGLHVFFGLI-WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           F+   G HGLHV  GLI +L VL      K          I +S +WHF+D++WI +F+ 
Sbjct: 142 FYLTTGFHGLHVTGGLIAFLLVLGRTYAAKRFTHQQATAAIVVSYYWHFVDVVWIGLFAT 201

Query: 204 VYLM 207
           +Y++
Sbjct: 202 IYMI 205


>gi|290961091|ref|YP_003492273.1| cytochrome C oxidase subunit III [Streptomyces scabiei 87.22]
 gi|260650617|emb|CBG73733.1| cytochrome c oxidase subunit III [Streptomyces scabiei 87.22]
          Length = 203

 Score = 81.6 bits (200), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 60/184 (32%), Positives = 93/184 (50%), Gaps = 9/184 (4%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTY----AVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS 85
           T +G  I+L S+ + FA  F  Y    +V G  +    A    F  S    +T +L+LSS
Sbjct: 22  TSVGTIIWLSSELMFFAALFAMYFTLRSVTGPEFWHEKASTLNFPFSA--TNTTILVLSS 79

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS-AFLSS 144
           L+C   + A A +  + K   W +VT   G IFI  +++E+  L+  E +   S  + S 
Sbjct: 80  LTCQLGVFA-AERGDVKKLRMWFIVTFVMGAIFIGGQVFEYTELVKHEGLSLSSDPYGSV 138

Query: 145 FFALVGLHGLHVFFGLI-WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           F+   G HGLHV  GLI +L VL      K          I +S +WHF+D++WI +F+ 
Sbjct: 139 FYLTTGFHGLHVTGGLIAFLLVLGRTYAAKRFTHEQATAAIVVSYYWHFVDVVWIGLFAT 198

Query: 204 VYLM 207
           +Y++
Sbjct: 199 IYMI 202


>gi|108800257|ref|YP_640454.1| cytochrome c oxidase, subunit III [Mycobacterium sp. MCS]
 gi|108770676|gb|ABG09398.1| cytochrome c oxidase, subunit III [Mycobacterium sp. MCS]
          Length = 180

 Score = 81.6 bits (200), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 85/172 (49%), Gaps = 4/172 (2%)

Query: 36  IYLMSDCLMFAVFFVTYAVLGKNYAAG--PAPIDVFDISGIFVSTIVLLLSSLSCSFAML 93
           ++L S+ + FA  F  Y    +  A G  P P    +++     T+VL+ SS +C   + 
Sbjct: 8   VWLSSELMFFAGLFAMY-FTARAQAGGEWPPPPTELNLALAVPVTLVLIASSFTCQMGVF 66

Query: 94  ASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHG 153
           A A +  +     W ++T   G+ F++ ++YE+ HL+        SA+ S F+   G HG
Sbjct: 67  A-AERGDVFGLRRWYVLTFLMGLFFVLGQLYEYYHLVHEGTTIPGSAYGSVFYLATGFHG 125

Query: 154 LHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
           LHV  GL+    L+ +              I +S +WHF+D++WI +F+ +Y
Sbjct: 126 LHVIGGLVAFLFLLARTKMSKFTPAQATAAIVVSYYWHFVDIVWIALFAVIY 177


>gi|302869017|ref|YP_003837654.1| cytochrome-c oxidase [Micromonospora aurantiaca ATCC 27029]
 gi|315504512|ref|YP_004083399.1| cytochrome-c oxidase [Micromonospora sp. L5]
 gi|302571876|gb|ADL48078.1| Cytochrome-c oxidase [Micromonospora aurantiaca ATCC 27029]
 gi|315411131|gb|ADU09248.1| Cytochrome-c oxidase [Micromonospora sp. L5]
          Length = 199

 Score = 81.6 bits (200), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 91/192 (47%), Gaps = 8/192 (4%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAP----IDVFDISG 73
           K +  S    +   +G  ++L S+ + FA  F  Y  +    AA P       +V +I  
Sbjct: 9   KSRIHSLTRPNMVSVGTIVWLSSELMFFAALFAMYFSI---RAAAPEQWEKHTEVLNIPY 65

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
               T++L+LSS++C   + A A +  +H    W  +T   G+IF++ ++ E+  L+   
Sbjct: 66  ATTFTVILVLSSITCQIGVFA-AERGDVHALRRWFTITFVMGLIFVLGQLNEYRTLVHEG 124

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
                  + S F+   G HGLHV  GLI   + +I+              I +S +WHF+
Sbjct: 125 VKINEDGYGSMFYLTTGFHGLHVTGGLIAFVIFMIRTTMGRFTPAQATSAIVVSYYWHFV 184

Query: 194 DLIWICVFSFVY 205
           D++WI +++ +Y
Sbjct: 185 DVVWIGLYAMIY 196


>gi|300784112|ref|YP_003764403.1| cytochrome C oxidase subunit III [Amycolatopsis mediterranei U32]
 gi|299793626|gb|ADJ44001.1| cytochrome c oxidase subunit III [Amycolatopsis mediterranei U32]
          Length = 185

 Score = 81.6 bits (200), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 87/178 (48%), Gaps = 7/178 (3%)

Query: 36  IYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFD------ISGIFVSTIVLLLSSLSCS 89
           ++L S+ + FA  F  +  +    ++G  P  + D      ++     T++L+LSSL+C 
Sbjct: 8   VWLSSELMFFAGLFAMFFTVKAQNSSGQWPPPLHDEPFHLNVAYAIPFTVILVLSSLTCQ 67

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           F + A A +  ++    W +VT   G IF+  +  E+ +L+          F + FF   
Sbjct: 68  FGVFA-AERGDVYGLRRWYIVTLIMGAIFVAGQANEYHNLVEEGMTIPSGPFGTVFFLAT 126

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           G HGLHV  GLI    L+I+              I +S +WHF+D++W+ +F  +YL+
Sbjct: 127 GFHGLHVIGGLIAFVYLLIRTKLSKFTPAQATSAIVVSYYWHFVDIVWVGLFGVIYLL 184


>gi|119717358|ref|YP_924323.1| cytochrome c oxidase, subunit III [Nocardioides sp. JS614]
 gi|119538019|gb|ABL82636.1| cytochrome c oxidase, subunit III [Nocardioides sp. JS614]
          Length = 215

 Score = 81.6 bits (200), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 63/192 (32%), Positives = 98/192 (51%), Gaps = 20/192 (10%)

Query: 32  LGFWIYLMSDCLMFAVFFVTY----AVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
           +G  I+L S+ + FA  F +Y    AV    +A     ++V   S   V+T +L+LSSL+
Sbjct: 27  VGTIIWLSSELMFFAALFASYFTIRAVSPDLWAENTQHLNVPFAS---VNTTILVLSSLT 83

Query: 88  CSFAMLASATKRLIHKTVS-----------WLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
           C   + A A +  + +T S           W ++T   G IFI  +  E+A LI      
Sbjct: 84  CQLGVFA-AERGQVGRTGSILNVPGWGLREWFVLTYIMGAIFIGGQATEYAELIRENITI 142

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLI-WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           Q SA+ + F+   G HGLHV  GLI +LFVL    + +          I +S +WHF+D+
Sbjct: 143 QDSAYGTMFYLTTGFHGLHVTGGLIAFLFVLGRTYVARKFTHEQAVSAIVVSYYWHFVDV 202

Query: 196 IWICVFSFVYLM 207
           +WI +F+ +YL+
Sbjct: 203 VWIGLFATIYLV 214


>gi|297161223|gb|ADI10935.1| cytochrome c oxidase subunit III [Streptomyces bingchenggensis
           BCW-1]
          Length = 206

 Score = 81.6 bits (200), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 94/184 (51%), Gaps = 9/184 (4%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTY----AVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS 85
           T +G  I+L S+ + FA  F  Y    +V G  +    A    F  S    +T +L+LSS
Sbjct: 25  TSVGTIIWLSSELMFFAALFAMYFTLRSVTGAEHWKEMASALNFPFSA--TNTTILVLSS 82

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS-AFLSS 144
           L+C   + A A +  + K  +W ++T   G IF+  +I+E+  L+  E +   S  + S 
Sbjct: 83  LTCQLGVFA-AERGDVKKLRAWFVITFIMGAIFVGGQIFEYTELVKHEGLSLSSDPYGSV 141

Query: 145 FFALVGLHGLHVFFGLI-WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           F+   G HGLHV  GLI +L VL      K          I +S +WHF+D++WI +F+ 
Sbjct: 142 FYLTTGFHGLHVTGGLIAFLLVLGRTYAAKRFTHQQATAAIVVSYYWHFVDVVWIGLFAT 201

Query: 204 VYLM 207
           +Y++
Sbjct: 202 IYMI 205


>gi|109900541|ref|YP_663796.1| cytochrome c oxidase, subunit III [Pseudoalteromonas atlantica T6c]
 gi|109702822|gb|ABG42742.1| cytochrome c oxidase, subunit III [Pseudoalteromonas atlantica T6c]
          Length = 293

 Score = 81.3 bits (199), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 78/134 (58%), Gaps = 4/134 (2%)

Query: 76  VSTIVLLLSSLSCSFAMLA-SATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI-SME 133
           ++T++LL+SS++C FA +A    KR   K +  L +T   G IF+ +++ E+ H    M 
Sbjct: 162 INTVILLISSVTCHFAHVALEENKRGRLKLM--LGITVLLGAIFMSLQVEEYIHAYQEMG 219

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
              Q   + ++FF L G HGLHV  G I LF+++++I K      N       S +WHF+
Sbjct: 220 LTLQSGVYGNTFFLLTGFHGLHVTLGAIILFIMLLRIFKGHFTPENHFAFQAGSWYWHFV 279

Query: 194 DLIWICVFSFVYLM 207
           D++W+ +F FVY++
Sbjct: 280 DVVWVMLFFFVYIL 293


>gi|271964190|ref|YP_003338386.1| cytochrome-c oxidase [Streptosporangium roseum DSM 43021]
 gi|270507365|gb|ACZ85643.1| Cytochrome-c oxidase [Streptosporangium roseum DSM 43021]
          Length = 205

 Score = 81.3 bits (199), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 91/174 (52%), Gaps = 6/174 (3%)

Query: 36  IYLMSDCLMFAVFFVTYAVLGKNYAAG---PAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           ++L S+ + FA  F  Y  + ++ + G   P P    ++     +TI+L+LSS++C   +
Sbjct: 31  VWLSSELMFFAALFAMYFTI-RSVSLGQGLPWPEAHLNVPFSLANTIILVLSSVTCQLGV 89

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
            A A K  + K   W +V+   G +F+  ++YE++ L+        SA+ S F+   G H
Sbjct: 90  WA-AEKGQVAKLRFWYIVSFLMGAVFVGGQLYEYSQLVHEGHTLSHSAYDSVFYLTTGFH 148

Query: 153 GLHVFFGLI-WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
           GLHV  GLI +LF+L      K          I +S +WHF+D++WI +F  +Y
Sbjct: 149 GLHVTGGLIAFLFMLGRTYAAKRFTREQATSAIVVSYYWHFVDVVWIGLFVTIY 202


>gi|123968036|ref|YP_001008894.1| cytochrome c oxidase, subunit III [Prochlorococcus marinus str.
           AS9601]
 gi|123198146|gb|ABM69787.1| Cytochrome c oxidase, subunit III [Prochlorococcus marinus str.
           AS9601]
          Length = 200

 Score = 81.3 bits (199), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 66/203 (32%), Positives = 100/203 (49%), Gaps = 27/203 (13%)

Query: 18  KDKKESCVDH-DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAP---IDVFDISG 73
           K+  E    H D    G   +L++D + FA FF  Y       A  P P   I   ++  
Sbjct: 12  KNNSEVNETHEDFRMFGLVTFLIADGMTFAGFFAAYLTYK---AVNPLPDGAIYELELPI 68

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVS----WLLVTAFFGMIFIIMEIYEFAHL 129
             ++TI+LL+SS     A    A K L+    S    WL +TA  G+IF+I +++E+ HL
Sbjct: 69  PTLNTILLLVSS-----ATFHKAGKALLKDKNSDSQKWLFITASLGIIFLICQLFEYFHL 123

Query: 130 ISMEAVP---QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLI 184
                 P     + F S+F+AL G HGLHV  G + + ++  Q    G  L S N   L 
Sbjct: 124 ------PFGLTDNLFASTFYALTGFHGLHVTLGTLMILIIAWQSRINGGRLTSQNMFPLE 177

Query: 185 CLSMFWHFLDLIWICVFSFVYLM 207
            + ++WHF+D IW+ +F  +YL+
Sbjct: 178 AVELYWHFVDGIWVILFIILYLL 200


>gi|145225979|ref|YP_001136633.1| cytochrome c oxidase, subunit III [Mycobacterium gilvum PYR-GCK]
 gi|145218442|gb|ABP47845.1| cytochrome c oxidase, subunit III [Mycobacterium gilvum PYR-GCK]
          Length = 197

 Score = 81.3 bits (199), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 84/174 (48%), Gaps = 1/174 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           +G  ++L S+ + FA  F  Y          P P    +++     T+VL+ SS +C   
Sbjct: 22  VGTIVWLSSELMFFAGLFAMYFTARAQAEEWPPPPTELNLALAVPVTLVLIASSFTCQMG 81

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           + A A +  +     W +VT   G+ F++ + YE+  L+        SA+ S F+   G 
Sbjct: 82  VFA-AERGDVFGLRRWYVVTFVMGLFFVLGQGYEYLSLVREGTTIAGSAYGSVFYLTTGF 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
           HGLHV  GL+   +L+++              I +S +WHF+D++WI +F+ +Y
Sbjct: 141 HGLHVIGGLVAFILLLVRTRMSKFTPAQATAAIVVSYYWHFVDIVWIALFAVIY 194


>gi|62900021|sp|Q8FNQ9|COX3_COREF RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome aa3 subunit 3; AltName: Full=Cytochrome
           c oxidase polypeptide III
          Length = 205

 Score = 81.3 bits (199), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 89/179 (49%), Gaps = 4/179 (2%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPA---PIDVFDISGIFVSTIVLLLSSLSC 88
           +G  ++L  + + FA  F  Y V   N  A  +     D  ++      T++L+ SS++C
Sbjct: 27  VGTIVFLSQELMFFAGLFAMYFVSRANGLANGSWAEQTDYLNVPYALAITVILVSSSVTC 86

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            F + A A +  ++    W L+T   G IF+I + YE+  L+      Q S + S+F+  
Sbjct: 87  QFGVFA-AERGDVYGLRKWFLITIILGSIFVIGQAYEYFTLVGHGLSIQSSVYGSAFYIT 145

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
            G H  HV  G+I   V++++I K           + +S +WHF+D++WI +F  +Y +
Sbjct: 146 TGFHAAHVIAGVIAFVVVLMRIQKAKFTPAQATAAMVVSYYWHFVDVVWIGLFITIYFI 204


>gi|111018143|ref|YP_701115.1| cytochrome c oxidase [Rhodococcus jostii RHA1]
 gi|110817673|gb|ABG92957.1| cytochrome c oxidase [Rhodococcus jostii RHA1]
          Length = 246

 Score = 81.3 bits (199), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 93/195 (47%), Gaps = 8/195 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCL----MFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
           +  +  S    +   +G  ++L S+ +    +FA++FV  A    N+   P  +++F   
Sbjct: 55  ITQRVHSLNRPNMVSVGTIVWLSSELMFFAGLFAMYFVARAQANGNWPPEPTELNLFLAV 114

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            +   T+VL+ SS +C   + A A +  +     W L+T   G  F++ + YE+ HL+  
Sbjct: 115 PV---TLVLIASSFTCQMGVFA-AERGDVFGLRRWYLLTLAMGTFFVLGQAYEYIHLVEH 170

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                 S + S F+   G HG+HV  GLI    L+ +              I +S +WHF
Sbjct: 171 GTSISSSVYGSVFYMTTGFHGMHVIGGLIAFVFLIARTKVSKFTPAQATAAIVVSYYWHF 230

Query: 193 LDLIWICVFSFVYLM 207
           +D++WI +F+ +Y +
Sbjct: 231 VDIVWIGLFATIYFI 245


>gi|25028641|ref|NP_738695.1| putative cytochrome c oxidase subunit III [Corynebacterium
           efficiens YS-314]
 gi|23493927|dbj|BAC18895.1| putative cytochrome c oxidase subunit III [Corynebacterium
           efficiens YS-314]
          Length = 217

 Score = 81.3 bits (199), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 89/179 (49%), Gaps = 4/179 (2%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPA---PIDVFDISGIFVSTIVLLLSSLSC 88
           +G  ++L  + + FA  F  Y V   N  A  +     D  ++      T++L+ SS++C
Sbjct: 39  VGTIVFLSQELMFFAGLFAMYFVSRANGLANGSWAEQTDYLNVPYALAITVILVSSSVTC 98

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            F + A A +  ++    W L+T   G IF+I + YE+  L+      Q S + S+F+  
Sbjct: 99  QFGVFA-AERGDVYGLRKWFLITIILGSIFVIGQAYEYFTLVGHGLSIQSSVYGSAFYIT 157

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
            G H  HV  G+I   V++++I K           + +S +WHF+D++WI +F  +Y +
Sbjct: 158 TGFHAAHVIAGVIAFVVVLMRIQKAKFTPAQATAAMVVSYYWHFVDVVWIGLFITIYFI 216


>gi|123966498|ref|YP_001011579.1| cytochrome c oxidase subunit III [Prochlorococcus marinus str. MIT
           9515]
 gi|123200864|gb|ABM72472.1| possible cytochrome c oxidase subunit III [Prochlorococcus marinus
           str. MIT 9515]
          Length = 198

 Score = 80.9 bits (198), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 97/190 (51%), Gaps = 6/190 (3%)

Query: 19  DKKESCVDHDGTYL-GFWIYLMSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVFDISGIFV 76
           + K   + HDG  + GF I+L S+ ++F  FFV Y+VL  +     P+ I+  D+    +
Sbjct: 11  NHKPGHIKHDGHNMTGFIIFLCSESIIFFAFFVGYSVLKISAPVWYPSGINGIDVKMPLI 70

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
           +T++L+ SS    FA      K L    + W  +T   G  F+  +  E++ L       
Sbjct: 71  NTVILVSSSFVIYFAEKYLHKKNLWGFRIVWF-ITMIMGSYFVYGQYVEWSEL---TFSL 126

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
           Q  AF   F+ L G HGLHV  G++ + +++ +        G +  +  +S+FWHF+D+I
Sbjct: 127 QSGAFGGMFYLLTGFHGLHVITGILLMGLMLYRSFLPNNYKGGEMGVESVSLFWHFVDVI 186

Query: 197 WICVFSFVYL 206
           W+ +F  +YL
Sbjct: 187 WLLLFGLIYL 196


>gi|226360272|ref|YP_002778050.1| cytochrome c oxidase subunit III [Rhodococcus opacus B4]
 gi|226238757|dbj|BAH49105.1| cytochrome c oxidase subunit III [Rhodococcus opacus B4]
          Length = 203

 Score = 80.9 bits (198), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 93/195 (47%), Gaps = 8/195 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCL----MFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
           +  +  S    +   +G  ++L S+ +    +FA++FV  A    N+   P  +++F   
Sbjct: 12  ITQRVHSLNRPNMVSVGTIVWLSSELMFFAGLFAMYFVARAQANGNWPPEPTELNLFLAV 71

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            +   T+VL+ SS +C   + A A +  +     W L+T   G  F++ + YE+ HL+  
Sbjct: 72  PV---TLVLIASSFTCQMGVFA-AERGDVFGLRRWYLLTLAMGTFFVLGQAYEYIHLVEH 127

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                 S + S F+   G HG+HV  GLI    L+ +              I +S +WHF
Sbjct: 128 GTSISSSVYGSVFYMTTGFHGMHVIGGLIAFVFLIARTKVSKFTPAQATAAIVVSYYWHF 187

Query: 193 LDLIWICVFSFVYLM 207
           +D++WI +F+ +Y +
Sbjct: 188 VDIVWIGLFATIYFI 202


>gi|118465650|ref|YP_881503.1| cytochrome C oxidase, subunit 3 [Mycobacterium avium 104]
 gi|254774972|ref|ZP_05216488.1| cytochrome c oxidase, subunit 3 [Mycobacterium avium subsp. avium
           ATCC 25291]
 gi|118166937|gb|ABK67834.1| cytochrome c oxidase, subunit 3 [Mycobacterium avium 104]
          Length = 180

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 82/164 (50%), Gaps = 4/164 (2%)

Query: 44  MFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHK 103
           +FA++F   A  G  +   P  ++++    +   T+VL+ SS +C   + A A +  +  
Sbjct: 20  LFAMYFTARAQSGGKWPPPPTELNLYQAVPV---TLVLIASSFTCQMGVFA-AERGDVFG 75

Query: 104 TVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWL 163
              W ++T   G+ F++ + YE+ HL+        SA+ S F+   G HGLHV  GL+  
Sbjct: 76  LRRWYVITFLMGLFFVLGQGYEYYHLMGHGTTIPGSAYGSVFYLATGFHGLHVTGGLVAF 135

Query: 164 FVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
             L+ +              I +S +WHF+D++WI +F+ +Y +
Sbjct: 136 IFLLARTAMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYFI 179


>gi|119855051|ref|YP_935656.1| cytochrome c oxidase, subunit III [Mycobacterium sp. KMS]
 gi|120404674|ref|YP_954503.1| cytochrome c oxidase subunit III [Mycobacterium vanbaalenii PYR-1]
 gi|145225946|ref|YP_001136600.1| cytochrome c oxidase, subunit III [Mycobacterium gilvum PYR-GCK]
 gi|119697769|gb|ABL94841.1| cytochrome c oxidase, subunit III [Mycobacterium sp. KMS]
 gi|119957492|gb|ABM14497.1| cytochrome c oxidase, subunit III [Mycobacterium vanbaalenii PYR-1]
 gi|145218409|gb|ABP47812.1| cytochrome c oxidase, subunit III [Mycobacterium gilvum PYR-GCK]
          Length = 197

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 84/174 (48%), Gaps = 1/174 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           +G  ++L S+ + FA  F  Y          P P    +++     T+VL+ SS +C   
Sbjct: 22  VGTIVWLSSELMFFAGLFAMYFTARAQADEWPPPPTELNLALAVPVTLVLIASSFTCQMG 81

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           + A A +  +     W +VT   G+ F++ + YE+  L+        SA+ S F+   G 
Sbjct: 82  VFA-AERGDVFGLRRWYVVTFVMGLFFVLGQGYEYLSLVREGTTIAGSAYGSVFYLTTGF 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
           HGLHV  GL+   +L+I+              I +S +WHF+D++WI +F+ +Y
Sbjct: 141 HGLHVIGGLVAFILLLIRTRMSKFTPAQATAAIVVSYYWHFVDIVWIALFATIY 194


>gi|33861001|ref|NP_892562.1| cytochrome c oxidase, subunit III [Prochlorococcus marinus subsp.
           pastoris str. CCMP1986]
 gi|33639733|emb|CAE18903.1| Cytochrome c oxidase, subunit III [Prochlorococcus marinus subsp.
           pastoris str. CCMP1986]
          Length = 200

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 66/203 (32%), Positives = 103/203 (50%), Gaps = 27/203 (13%)

Query: 18  KDKKESCVDH-DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAP---IDVFDISG 73
           K+  E+   H D    G   +L++D + FA FF  Y       A  P P   I   ++  
Sbjct: 12  KNDIEASEHHEDFRMFGLITFLIADGMTFAGFFAAYLTYK---AVNPLPDGAIYELELPI 68

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHK----TVSWLLVTAFFGMIFIIMEIYEFAHL 129
             ++TI+LL+SS     A    A K L+      T  WLLVTA  G+ F+I +++E+ +L
Sbjct: 69  PTLNTILLLVSS-----ATFHKAGKALLKNKNSDTQKWLLVTALLGITFLICQLFEYFNL 123

Query: 130 ISMEAVP---QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQIL-KKGLISG-NQRRLI 184
                 P     + F S+F+AL G HGLHV  G + + ++  Q   K+G I+  N   L 
Sbjct: 124 ------PFGLTDNLFASTFYALTGFHGLHVTLGTLMILIISWQTRPKEGRITNQNMFPLE 177

Query: 185 CLSMFWHFLDLIWICVFSFVYLM 207
            + ++WHF+D IW+ +F  +YL+
Sbjct: 178 AVELYWHFVDGIWVILFIILYLL 200


>gi|332308542|ref|YP_004436393.1| cytochrome c oxidase subunit III [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332175871|gb|AEE25125.1| cytochrome c oxidase subunit III [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 293

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 79/134 (58%), Gaps = 4/134 (2%)

Query: 76  VSTIVLLLSSLSCSFAMLA-SATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI-SME 133
           ++T++LL+SS++C FA +A    KR   K +  L +T   G IF+++++ E+ H    M 
Sbjct: 162 INTVILLISSVTCHFAHVALEENKRGRLKLM--LGITVLLGAIFMVLQVEEYLHAYQEMG 219

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
              Q   + ++FF L G HGLHV  G I LF+++++I K      +       S +WHF+
Sbjct: 220 LTLQSGIYGNTFFLLTGFHGLHVTLGAIILFIMLLRIFKGHFTPDDHFAFQAGSWYWHFV 279

Query: 194 DLIWICVFSFVYLM 207
           D++W+ +F FVY++
Sbjct: 280 DVVWVMLFFFVYIL 293


>gi|302518592|ref|ZP_07270934.1| cytochrome aa3 quinol oxidase, subunit III [Streptomyces sp. SPB78]
 gi|318060651|ref|ZP_07979374.1| cytochrome c oxidase subunit III [Streptomyces sp. SA3_actG]
 gi|318076660|ref|ZP_07983992.1| cytochrome c oxidase subunit III [Streptomyces sp. SA3_actF]
 gi|333027726|ref|ZP_08455790.1| putative cytochrome aa3 quinol oxidase, subunit III [Streptomyces
           sp. Tu6071]
 gi|302427487|gb|EFK99302.1| cytochrome aa3 quinol oxidase, subunit III [Streptomyces sp. SPB78]
 gi|332747578|gb|EGJ78019.1| putative cytochrome aa3 quinol oxidase, subunit III [Streptomyces
           sp. Tu6071]
          Length = 206

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 91/184 (49%), Gaps = 9/184 (4%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAP----IDVFDISGIFVSTIVLLLSS 85
           T +G  I+L S+ + FA  F  Y  L      GP       D  ++     +T +L+ SS
Sbjct: 25  TSVGTIIWLSSELMFFAALFAMYFTL--RSVTGPEHWKEMADALNVPFSGTNTAILVASS 82

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS-AFLSS 144
           L+C   + A A +  + K  +W  +T   G IFI  +I+E+  L+  E +   S  + S 
Sbjct: 83  LTCQLGVFA-AERGDVKKLRTWFSITFVMGAIFIGGQIFEYTDLVKEEGLSLSSDPYGSV 141

Query: 145 FFALVGLHGLHVFFGLI-WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           F+   G HGLHV  GLI +L VL      K          I +S +WHF+D++WI +F+ 
Sbjct: 142 FYLTTGFHGLHVTGGLIAFLLVLGRTYAAKRFTHHQATAAIVVSYYWHFVDVVWIGLFAT 201

Query: 204 VYLM 207
           +YL+
Sbjct: 202 IYLI 205


>gi|15827405|ref|NP_301668.1| cytochrome C oxidase subunit III [Mycobacterium leprae TN]
 gi|221229882|ref|YP_002503298.1| cytochrome C oxidase subunit III [Mycobacterium leprae Br4923]
 gi|62899906|sp|O69582|COX3_MYCLE RecName: Full=Probable cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome aa3 subunit 3; AltName: Full=Cytochrome
           c oxidase polypeptide III
 gi|3080503|emb|CAA18701.1| cytochrome c oxidase subunit III [Mycobacterium leprae]
 gi|13092955|emb|CAC31263.1| cytochrome C oxidase subunit III [Mycobacterium leprae]
 gi|219932989|emb|CAR70977.1| cytochrome C oxidase subunit III [Mycobacterium leprae Br4923]
          Length = 202

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 87/191 (45%), Gaps = 1/191 (0%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
           +  +  S    +   +G  ++L S+ + FA  F  Y            P    ++     
Sbjct: 12  ITSRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMYFTARAQAGGKWPPSTELNLYQAVP 71

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T+VL+ SS +C   +  SA +  +     W ++T   G+ F++ + YE+ HLI+     
Sbjct: 72  VTLVLIASSFTCQMGVF-SAERGDVFGLRRWYVITLLMGLFFVLGQGYEYYHLITHGTTI 130

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
             SA+ S F+   G HGLHV  GLI    L+ +              I +S +WHF+D++
Sbjct: 131 PSSAYGSVFYLATGFHGLHVTGGLIAFIFLLARTTMSKFTPAQATASIVVSYYWHFVDIV 190

Query: 197 WICVFSFVYLM 207
           WI +F+ +Y +
Sbjct: 191 WIALFTVIYFI 201


>gi|169629056|ref|YP_001702705.1| cytochrome c oxidase subunit III [Mycobacterium abscessus ATCC
           19977]
 gi|169241023|emb|CAM62051.1| Probable cytochrome c oxidase subunit III [Mycobacterium abscessus]
          Length = 206

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 82/163 (50%), Gaps = 6/163 (3%)

Query: 44  MFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS-TIVLLLSSLSCSFAMLASATKRLIH 102
           +FA +F   A  G N+   P  +++    G+ +  T VL+ SS +C   + A A +  + 
Sbjct: 46  LFAFYFTARAQSGGNWPPEPTELNL----GLAIPVTAVLVASSFTCQMGVFA-AERGDVF 100

Query: 103 KTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIW 162
               W ++T   G  F++ + YE+ +L+        SA+ S+F+   G HGLHV  GL+ 
Sbjct: 101 GLRRWYVITLIMGTFFVLGQGYEYMNLVHEGTTIAGSAYGSTFYLATGFHGLHVIGGLVA 160

Query: 163 LFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
              L+I+              I +S +WHF+D++WI +F+ +Y
Sbjct: 161 FVYLLIRTRMSKFTPAQATSAIVVSYYWHFVDIVWIALFATIY 203


>gi|262202947|ref|YP_003274155.1| cytochrome-c oxidase [Gordonia bronchialis DSM 43247]
 gi|262086294|gb|ACY22262.1| Cytochrome-c oxidase [Gordonia bronchialis DSM 43247]
          Length = 205

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 85/177 (48%), Gaps = 4/177 (2%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAG---PAPIDVFDISGIFVSTIVLLLSSLSC 88
           +G  ++L S+ + FA  F  Y V   N  A    PA     +++     T VL+LSS++C
Sbjct: 27  VGTIVWLSSELMFFAGLFAMYFVARANSPADIGWPAKPTELNLALAIPVTTVLILSSVTC 86

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
              + A A +  +     W ++T   G  F+  + YE+ HL+        SA+ S F+  
Sbjct: 87  QMGVFA-AERGDVFGLRRWYVLTFLMGAFFVAGQGYEYYHLVHEGTTLSSSAYGSVFYMA 145

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
            G HGLHV  GL+    L+I+              I +S +WHF+D++WI +F  +Y
Sbjct: 146 TGFHGLHVIGGLVAFVFLLIRTKLSKFTPAQATAAIVVSYYWHFVDIVWIGLFVTIY 202


>gi|86157232|ref|YP_464017.1| cytochrome c oxidase, subunit III [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85773743|gb|ABC80580.1| cytochrome c oxidase, subunit III [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 209

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 95/201 (47%), Gaps = 18/201 (8%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPID-VFDISGIFVST 78
           +K+S  +     LG W++L S+ L+F   F  YAV    Y+   A      +     V+T
Sbjct: 14  EKQSHAER----LGMWLFLASEVLLFTALFAAYAVYRYLYSDAFAEASRAIETWFGLVNT 69

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           I+L+ SS + +   L  A K    KT  W  V+  F + F+ ++  E++H      +P R
Sbjct: 70  IILVTSSFTVALG-LNEAVKGNGKKTGLWFAVSVAFAIAFLALKAVEYSHHFQEGQLPGR 128

Query: 139 ------------SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
                       S F S +F + GLHG+HV  G+  L V+ ++  +    +     +   
Sbjct: 129 YYSFHELQAPGASLFFSLYFLITGLHGVHVIVGMTILAVVGVKAARGKYTAAYHTPVELA 188

Query: 187 SMFWHFLDLIWICVFSFVYLM 207
            ++WH +DLIWI VF  +YL+
Sbjct: 189 GLYWHLVDLIWIFVFPLIYLV 209


>gi|167842203|ref|ZP_02468887.1| ubiquinol oxidase, subunit III [Burkholderia thailandensis MSMB43]
          Length = 113

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 65/107 (60%), Gaps = 7/107 (6%)

Query: 20  KKESCVDHDGTY--LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
           + ++  DH  ++   GFW+YLM+DC++FA  F  +AV+   +A GP  +D+FDI G+ + 
Sbjct: 10  RHQAAHDHPPSHSVFGFWLYLMTDCVIFAALFAVFAVMAHQFAGGPTAVDLFDIPGVALE 69

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTV--SWLLVTAFFGMIFIIME 122
           T +LLLSS++  FAM+ +   R   + V   WL +T   G  F+ +E
Sbjct: 70  TALLLLSSITYGFAMIGAQRGR---RGVLFGWLAMTFALGAAFLGLE 113


>gi|259507700|ref|ZP_05750600.1| cytochrome c oxidase, subunit III [Corynebacterium efficiens
           YS-314]
 gi|259164747|gb|EEW49301.1| cytochrome c oxidase, subunit III [Corynebacterium efficiens
           YS-314]
          Length = 182

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 89/179 (49%), Gaps = 4/179 (2%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPA---PIDVFDISGIFVSTIVLLLSSLSC 88
           +G  ++L  + + FA  F  Y V   N  A  +     D  ++      T++L+ SS++C
Sbjct: 4   VGTIVFLSQELMFFAGLFAMYFVSRANGLANGSWAEQTDYLNVPYALAITVILVSSSVTC 63

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            F + A A +  ++    W L+T   G IF+I + YE+  L+      Q S + S+F+  
Sbjct: 64  QFGVFA-AERGDVYGLRKWFLITIILGSIFVIGQAYEYFTLVGHGLSIQSSVYGSAFYIT 122

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
            G H  HV  G+I   V++++I K           + +S +WHF+D++WI +F  +Y +
Sbjct: 123 TGFHAAHVIAGVIAFVVVLMRIQKAKFTPAQATAAMVVSYYWHFVDVVWIGLFITIYFI 181


>gi|222083087|ref|YP_002542452.1| cytochrome-c oxidase subunit III protein [Agrobacterium radiobacter
           K84]
 gi|221727766|gb|ACM30855.1| cytochrome-c oxidase subunit III protein [Agrobacterium radiobacter
           K84]
          Length = 240

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 96/196 (48%), Gaps = 24/196 (12%)

Query: 35  WIYLMSDCLMFAVFFVTYAVLG-KNYAAGPAPIDVF-------DISGIFVSTIVLLLSSL 86
           WI+L+SD  +F  F + Y         A P P +VF       +I  I ++ +  +L S 
Sbjct: 44  WIFLLSDTFIFGCFLLAYMTARMSTTVAWPNPSEVFALTIGGKEIPLILIAIMTFVLISS 103

Query: 87  SCSFAMLAS-ATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA----- 140
           S + AM  +   +    KT + +L TA  G  F+ M+ +E+  LI     P  +      
Sbjct: 104 SGTMAMAVNFGYRHDRSKTAALMLATAVLGATFVGMQAFEWTKLIREGVRPWENPWGAAQ 163

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQILK-------KGLIS---GNQRRLICLSMFW 190
           F SSFF + G HG HV  G+++L ++  ++ +       +G  +   G+   +    ++W
Sbjct: 164 FGSSFFMITGFHGTHVSIGVLFLLIMARKVWRGDFDQERRGFFTSRKGHYEIIEITGLYW 223

Query: 191 HFLDLIWICVFSFVYL 206
           HF+DL+W+ +F+F YL
Sbjct: 224 HFVDLVWVFIFAFFYL 239


>gi|307332166|ref|ZP_07611251.1| Cytochrome-c oxidase [Streptomyces violaceusniger Tu 4113]
 gi|306882195|gb|EFN13296.1| Cytochrome-c oxidase [Streptomyces violaceusniger Tu 4113]
          Length = 206

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 94/184 (51%), Gaps = 9/184 (4%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTY----AVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS 85
           T +G  I+L S+ + FA  F  Y    +V G  +    A    F  S    +T +L+LSS
Sbjct: 25  TSVGTIIWLSSELMFFAALFAMYFTLRSVTGAEHWKEMASSLNFPFSA--TNTTILVLSS 82

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS-AFLSS 144
           L+C   + A A +  + K  +W ++T   G IFI  +I+E+  L+  + +   S  + S 
Sbjct: 83  LTCQLGVFA-AERGDVKKLRTWFVITFIMGAIFIGGQIFEYTELVKKDGLSLSSDPYGSV 141

Query: 145 FFALVGLHGLHVFFGL-IWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           F+   G HG+HV  GL  +LFVL      K          I +S +WHF+D++WI +F+ 
Sbjct: 142 FYLTTGFHGMHVTGGLFAFLFVLGRTYAAKRFTHQQATAAIVVSYYWHFVDVVWIGLFAT 201

Query: 204 VYLM 207
           +Y++
Sbjct: 202 IYMI 205


>gi|16330564|ref|NP_441292.1| cytochrome C oxidase subunit III [Synechocystis sp. PCC 6803]
 gi|1653055|dbj|BAA17972.1| cytochrome c oxidase subunit III [Synechocystis sp. PCC 6803]
          Length = 198

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/194 (30%), Positives = 99/194 (51%), Gaps = 7/194 (3%)

Query: 14  LFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG-KNYAAGPAPIDVFDIS 72
           L +V+  +E   D+ G   GF ++LMS+ ++F  FFVTY +L   N    P  +D  D++
Sbjct: 7   LPHVEPTEEQEPDNLG--FGFPVFLMSESVVFISFFVTYTILRLTNKPWFPPGVDGLDVT 64

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
              ++T+VL+ SS +   A  A     +    + WL  T   G++F+  +  E+A    M
Sbjct: 65  RGAINTMVLVTSSGAIILAEKALHRGEMKLFRLLWL-ATISLGIVFLFGQAAEWA---GM 120

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                  +   +FF L G HGLHVF G+  L  +  + L+          +  +++FWHF
Sbjct: 121 PFGLDAGSAGGTFFLLTGFHGLHVFTGVCLLLYMYWRSLQPHNFDRGHEGVTAIALFWHF 180

Query: 193 LDLIWICVFSFVYL 206
           +D+IWI +F  +YL
Sbjct: 181 VDVIWIILFILLYL 194


>gi|159039067|ref|YP_001538320.1| cytochrome c oxidase subunit III [Salinispora arenicola CNS-205]
 gi|157917902|gb|ABV99329.1| cytochrome c oxidase subunit III [Salinispora arenicola CNS-205]
          Length = 199

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 91/192 (47%), Gaps = 8/192 (4%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY----AVLGKNYAAGPAPIDVFDISG 73
           K +  S    +   +G  ++L S+ + FA  F  Y    A   + +A     ++V   + 
Sbjct: 9   KSRIHSLTRPNMVSVGTIVWLSSELMFFAALFAMYFSIRAAAPEQWAEHTPHLNV-PYAT 67

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
            F  T++L+LSS++C   + A A K  +H    W  +T   G+IF++ ++ E+  L+   
Sbjct: 68  TF--TVILVLSSVTCQLGVFA-AEKGDVHALRRWFTITFVMGLIFVLGQLNEYRELVHEG 124

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
                  + S F+   G HGLHV  GL+   + +I+              I +S +WHF+
Sbjct: 125 VKINEDGYGSMFYLTTGFHGLHVTGGLVAFIIFMIRTTMGRFTPAQATSAIVVSYYWHFV 184

Query: 194 DLIWICVFSFVY 205
           D++WI ++  +Y
Sbjct: 185 DVVWIALYGMIY 196


>gi|145223543|ref|YP_001134221.1| cytochrome c oxidase, subunit III [Mycobacterium gilvum PYR-GCK]
 gi|145216029|gb|ABP45433.1| cytochrome c oxidase, subunit III [Mycobacterium gilvum PYR-GCK]
          Length = 220

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 83/162 (51%), Gaps = 4/162 (2%)

Query: 44  MFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHK 103
           +FA++F   A  G ++   P P ++ +++     T+VL+ SS +C   + A A +  +  
Sbjct: 60  LFAMYFTARAQAGGDWP--PEPTEL-NLALAVPVTLVLIASSFTCQMGVFA-AERGDVFG 115

Query: 104 TVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWL 163
              W  +T   G  F++ + YE+ HL+        SA+ + F+   G HGLHV  GLI  
Sbjct: 116 LRRWYTLTLAMGTFFVLGQAYEYLHLVQHGTTIPGSAYGTVFYLATGFHGLHVIGGLIAF 175

Query: 164 FVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
            +L+++              I +S +WHF+D++WI +F+ +Y
Sbjct: 176 VLLLLRTRMSKFTPAQATAAIVVSYYWHFVDIVWIALFAVIY 217


>gi|295839375|ref|ZP_06826308.1| cytoChrome c oxidase subunit III [Streptomyces sp. SPB74]
 gi|197699063|gb|EDY45996.1| cytoChrome c oxidase subunit III [Streptomyces sp. SPB74]
          Length = 206

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 94/184 (51%), Gaps = 9/184 (4%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTY----AVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS 85
           T +G  I+L S+ + FA  F  Y    +V G ++    A  D  ++     +T +L+ SS
Sbjct: 25  TSVGTIIWLSSELMFFAALFAMYFTLRSVTGPDHWKEMA--DALNVPFSGTNTAILVASS 82

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS-AFLSS 144
           L+C   + A A +  + K  +W  +T   G IFI  +I+E+  L+  + +   S  + S 
Sbjct: 83  LTCQLGVFA-AERGDVKKLRTWFSITFVMGAIFIGGQIFEYTELVKKDGLSLSSDPYGSV 141

Query: 145 FFALVGLHGLHVFFGLI-WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           F+   G HGLHV  GLI +L VL      K          I +S +WHF+D++WI +F+ 
Sbjct: 142 FYLTTGFHGLHVTGGLIAFLLVLGRTYAAKRFTHHQATAAIVVSYYWHFVDVVWIGLFAT 201

Query: 204 VYLM 207
           +YL+
Sbjct: 202 IYLI 205


>gi|145595810|ref|YP_001160107.1| cytochrome c oxidase, subunit III [Salinispora tropica CNB-440]
 gi|145305147|gb|ABP55729.1| cytochrome c oxidase, subunit III [Salinispora tropica CNB-440]
          Length = 199

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 92/192 (47%), Gaps = 8/192 (4%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY----AVLGKNYAAGPAPIDVFDISG 73
           K +  S    +   +G  ++L S+ + FA  F  Y    A   + +A     ++V   + 
Sbjct: 9   KSRIHSLTRPNMVSVGTIVWLSSELMFFAALFAMYFSIRAAAPEQWAEHTPHLNV-PYAT 67

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
            F  T++L+LSS++C   + A A K  +H    W  +T   G+IF++ ++ E+  LI   
Sbjct: 68  TF--TVILVLSSVTCQIGVFA-AEKGDVHALRRWFTITFVMGLIFVLGQLNEYRELIHEG 124

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
                  + S F+   G HGLHV  GL+   + +I+              I +S +WHF+
Sbjct: 125 IKINEDGYGSMFYLTTGFHGLHVAGGLVAFVIFMIRTTMGRFTPAQATSAIVVSYYWHFV 184

Query: 194 DLIWICVFSFVY 205
           D++WI +++ +Y
Sbjct: 185 DVVWIALYAMIY 196


>gi|315443889|ref|YP_004076768.1| heme/copper-type cytochrome/quinol oxidase subunit 3 [Mycobacterium
           sp. Spyr1]
 gi|315262192|gb|ADT98933.1| heme/copper-type cytochrome/quinol oxidase, subunit 3
           [Mycobacterium sp. Spyr1]
          Length = 203

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 83/162 (51%), Gaps = 4/162 (2%)

Query: 44  MFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHK 103
           +FA++F   A  G ++   P P ++ +++     T+VL+ SS +C   + A A +  +  
Sbjct: 43  LFAMYFTARAQAGGDWP--PEPTEL-NLALAVPVTLVLIASSFTCQMGVFA-AERGDVFG 98

Query: 104 TVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWL 163
              W  +T   G  F++ + YE+ HL+        SA+ + F+   G HGLHV  GLI  
Sbjct: 99  LRRWYTLTLAMGTFFVLGQAYEYLHLVQHGTTIPGSAYGTVFYLATGFHGLHVIGGLIAF 158

Query: 164 FVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
            +L+++              I +S +WHF+D++WI +F+ +Y
Sbjct: 159 VLLLLRTRMSKFTPAQATAAIVVSYYWHFVDIVWIALFAVIY 200


>gi|127511056|ref|YP_001092253.1| cytochrome c oxidase, subunit III [Shewanella loihica PV-4]
 gi|126636351|gb|ABO21994.1| cytochrome c oxidase, subunit III [Shewanella loihica PV-4]
          Length = 291

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 76/132 (57%), Gaps = 2/132 (1%)

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
           +TI+LL SS++  FA ++    +    T+ WL +T   G+ F+ ++  E+AH      + 
Sbjct: 161 NTIILLTSSVTLHFAHVSLEKSKRTALTL-WLGITILLGLAFLFLQAKEYAHAYQEMGLT 219

Query: 137 QRSA-FLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
             S  + ++FF L G HG+HV  G I+LFVL +++L+              S +WHF+D+
Sbjct: 220 LSSGVYGNTFFLLTGFHGMHVTLGTIFLFVLFLRVLRGHFTPDKHFAFQAGSWYWHFVDV 279

Query: 196 IWICVFSFVYLM 207
           +W+C+F FVY++
Sbjct: 280 VWLCLFVFVYVL 291


>gi|54023694|ref|YP_117936.1| putative cytochrome c oxidase subunit III [Nocardia farcinica IFM
           10152]
 gi|62899935|sp|Q5YZ19|COX3_NOCFA RecName: Full=Probable cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome aa3 subunit 3; AltName: Full=Cytochrome
           c oxidase polypeptide III
 gi|54015202|dbj|BAD56572.1| putative cytochrome c oxidase subunit III [Nocardia farcinica IFM
           10152]
          Length = 203

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 88/180 (48%), Gaps = 8/180 (4%)

Query: 32  LGFWIYLMSDCL----MFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
           +G  I+L S+ +    +FA++FV  A    N+   P P ++ ++      T VL+ SS +
Sbjct: 27  VGTIIWLSSELMFFAGLFAMYFVARAQANGNWP--PEPTEL-NLKLAVPVTAVLVASSFT 83

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
           C   + A A K  +     W  +T   G  F+  + YE+ HL+        SA+ S F+ 
Sbjct: 84  CQMGVFA-AEKGDVFGLRRWYFITLLMGAFFVAGQGYEYYHLVHEGTSISSSAYGSVFYI 142

Query: 148 LVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
             G HGLHV  GLI    L+I+              I +S +WHF+D++WI +F+ +Y +
Sbjct: 143 TTGFHGLHVIGGLIAFVFLLIRTKVSKFTPAQATAAIVVSYYWHFVDIVWIGLFATIYFV 202


>gi|54302069|ref|YP_132062.1| putative cytochrome c oxidase subunit III [Photobacterium profundum
           SS9]
 gi|46915490|emb|CAG22262.1| putative cytochrome c oxidase subunit III [Photobacterium profundum
           SS9]
          Length = 249

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 101/196 (51%), Gaps = 26/196 (13%)

Query: 35  WIYLMSDCLMFAVFFVTY-AVLGKNYAAGPAPIDVF-------DISGIFVSTIVLLLSSL 86
           W +L+SD  +F  F V Y +V        P   DVF       DI  + ++ +  +L + 
Sbjct: 55  WFFLLSDIFIFGSFLVAYMSVRMTTTEPWPLTSDVFALNLGGQDIPLVLIAIMTFILITS 114

Query: 87  SCSFAMLAS---ATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ------ 137
           S + AM  +     +R +  T+  + +TA FG+ F+ M+ +E+  LI  E +        
Sbjct: 115 SGTMAMAVNFGYQGRRQLTATL--IFITALFGLAFVGMQAFEWTKLIVEEGIRPWGNDLG 172

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILK------KGLISGNQRRLICLS-MFW 190
            + F +SFF + G HGLHV  G+I+L  +  ++ +      +   S N+  ++ ++ ++W
Sbjct: 173 AAQFGASFFMITGFHGLHVSIGVIYLLTIAWRVWRGRYEKTQSDDSTNRYEIVEIAGLYW 232

Query: 191 HFLDLIWICVFSFVYL 206
           HF+DL+W+ +F+F YL
Sbjct: 233 HFVDLVWVFIFAFFYL 248


>gi|302525353|ref|ZP_07277695.1| cytochrome aa3 quinol oxidase, subunit III [Streptomyces sp. AA4]
 gi|302434248|gb|EFL06064.1| cytochrome aa3 quinol oxidase, subunit III [Streptomyces sp. AA4]
          Length = 208

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 94/198 (47%), Gaps = 8/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAG---PAPIDV----F 69
           +  +  S    +   +G  ++L S+ + FA  F  +  +     AG   P P+       
Sbjct: 11  ISQRVHSLNRPNMVSVGTVVWLSSELMFFAGLFAMFFTVKAQNPAGASWPPPLHGEEFHL 70

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           +++     T++L+LSSL+C F + A A +  ++    W +VT   G IF+  +  E+ +L
Sbjct: 71  NVAYAIPFTVILVLSSLTCQFGVFA-AERGDVYGLRRWYIVTLIMGAIFVFGQANEYHNL 129

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
           +          F + F+   G HGLHV  GLI    L+++              I +S +
Sbjct: 130 VEEGLTIPSGPFGTVFYLATGFHGLHVIGGLIAFVFLLVRTKLSKFTPAQATSAIVVSYY 189

Query: 190 WHFLDLIWICVFSFVYLM 207
           WHF+D++W+ +F+ +Y++
Sbjct: 190 WHFVDIVWVGLFAVIYIL 207


>gi|296166061|ref|ZP_06848508.1| cytochrome c oxidase, subunit III [Mycobacterium parascrofulaceum
           ATCC BAA-614]
 gi|295898582|gb|EFG78141.1| cytochrome c oxidase, subunit III [Mycobacterium parascrofulaceum
           ATCC BAA-614]
          Length = 180

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 81/164 (49%), Gaps = 4/164 (2%)

Query: 44  MFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHK 103
           +FA++F   A  G  +   P  ++++    +   T+VL+ SS +C   + A A +  +  
Sbjct: 20  LFAMYFTARAQSGGKWPPPPTELNLYQAVPV---TLVLIASSFTCQMGVFA-AERGDVFG 75

Query: 104 TVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWL 163
              W ++T   G+ F+  + YE+ HL +       SA+ S F+   G HGLHV  GLI  
Sbjct: 76  LRRWYVITFLMGLFFVCGQGYEYYHLATHGTTIPGSAYGSVFYLATGFHGLHVTGGLIAF 135

Query: 164 FVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
             L+ +              I +S +WHF+D++WI +F+ +Y +
Sbjct: 136 IFLLARTGMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYFI 179


>gi|118467557|ref|YP_888537.1| cytochrome C oxidase subunit 3 [Mycobacterium smegmatis str. MC2
           155]
 gi|118168844|gb|ABK69740.1| cytochrome c oxidase subunit 3 [Mycobacterium smegmatis str. MC2
           155]
          Length = 203

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 93/192 (48%), Gaps = 6/192 (3%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAG---PAPIDVFDISG 73
           +  +  S    +   +G  ++L S+ + FA  F  Y    +  A G   P P ++ +++ 
Sbjct: 12  ITSRVHSLNRPNMVSVGTIVWLSSELMFFAGLFAMY-FTARAQAGGAWPPEPTEL-NLAL 69

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
               T+VL+ SS +C   + A A +  +     W ++T   G+ F++ + YE+ HL+   
Sbjct: 70  AVPVTLVLIASSFTCQMGVFA-AERGDVFGLRRWYVITFLMGLFFVLGQGYEYIHLVEHG 128

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
                SA+ S F+   G HGLHV  GL+   +L+ +              I +S +WHF+
Sbjct: 129 TTIPGSAYGSVFYLATGFHGLHVIGGLVAFVLLLARTKMSKFTPAQATAAIVVSYYWHFV 188

Query: 194 DLIWICVFSFVY 205
           D++WI +F+ +Y
Sbjct: 189 DIVWIALFATIY 200


>gi|331696571|ref|YP_004332810.1| cytochrome-c oxidase [Pseudonocardia dioxanivorans CB1190]
 gi|326951260|gb|AEA24957.1| Cytochrome-c oxidase [Pseudonocardia dioxanivorans CB1190]
          Length = 200

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 92/201 (45%), Gaps = 8/201 (3%)

Query: 9   SPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY-AVLGKNYAAGPAPID 67
           +PN S       + + V      +G  ++L S+ + FA  F  Y     +N    P P  
Sbjct: 5   APNISARIHSLNRPNLVS-----IGTIVWLSSELMFFAGLFSIYFTARAQNVGEWPPPPT 59

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
             D+    V TIVL+ SS +C F + A A +  +     W L+T   G +F++ +  E+ 
Sbjct: 60  ELDVPYALVVTIVLVASSFTCQFGVFA-AERGDVFGLRRWYLLTLIMGALFVLGQANEYR 118

Query: 128 HLI-SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
            LI         SA+ + F+   G H LHV  GL+    L+I+              I +
Sbjct: 119 TLIFEHHTTIASSAYGTVFYLATGFHALHVTGGLVAFVYLLIRTKLSKFTPAQATAAIVV 178

Query: 187 SMFWHFLDLIWICVFSFVYLM 207
           S +WHF+D++W+ +F+ +Y +
Sbjct: 179 SYYWHFVDVVWVGLFAVIYFI 199


>gi|254482080|ref|ZP_05095322.1| Cytochrome c oxidase subunit III subfamily protein [marine gamma
           proteobacterium HTCC2148]
 gi|214037770|gb|EEB78435.1| Cytochrome c oxidase subunit III subfamily protein [marine gamma
           proteobacterium HTCC2148]
          Length = 227

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 101/190 (53%), Gaps = 21/190 (11%)

Query: 35  WIYLMSDCLMFAVFFVTYAVLGKNYAAGPAP--IDVFDIS--G-------IFVSTIVLLL 83
           WI+L+SD  +F+VF   Y +  +  A  P P   +VF ++  G       I + T VL+ 
Sbjct: 40  WIFLLSDTFIFSVFLTGY-MHARLAATEPWPNSSEVFALTLFGSHLPLVLIAIMTFVLIT 98

Query: 84  SSLSCSFAM-LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV-----PQ 137
           SS + + A+  A +  R   KTV  +  TA  G  F+ M+ +E++ LI  E V     P 
Sbjct: 99  SSGTMAMAVNFAYSGNR--SKTVMLMAATALLGASFVGMQAFEWSKLIFEEGVRPWGNPM 156

Query: 138 RSA-FLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
            +A F S+FF + G HGLHV  G+I+L V+  ++ +          +    ++WHF+DL+
Sbjct: 157 GAAQFGSTFFMITGFHGLHVTAGVIYLSVVAFKVRRGDYEKKGYEIVEITGLYWHFVDLV 216

Query: 197 WICVFSFVYL 206
           W+ +F+F YL
Sbjct: 217 WVFIFAFFYL 226


>gi|291004312|ref|ZP_06562285.1| cytochrome c oxidase subunit III [Saccharopolyspora erythraea NRRL
           2338]
          Length = 189

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 87/174 (50%), Gaps = 3/174 (1%)

Query: 36  IYLMSDCLMFAVFFVTY-AVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLA 94
           ++L S+ + FA  F  +  V  +N    P P    ++      TI+L+ SS +C + + A
Sbjct: 16  VWLASELMFFAGLFAMFFTVKAQNEGEWPPPPTHLNLPYALPFTIILVASSFTCQWGVFA 75

Query: 95  SATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP-QRSAFLSSFFALVGLHG 153
            A +  ++    W ++T   G +F++ +  E+  LI+        SA+ + F+   G HG
Sbjct: 76  -AERGDVYGLRRWYVITLIMGTVFVLGQAGEYYQLITEHHTTIASSAYGTVFYMTTGFHG 134

Query: 154 LHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           LHV  GLI    L+++              I +S +WHF+D++WI +F+ +YL+
Sbjct: 135 LHVIGGLIAFVFLIVRTRLSKFTPAQAIAAIVVSYYWHFVDIVWIGLFAVIYLV 188


>gi|229490418|ref|ZP_04384259.1| cytochrome c oxidase subunit 3 [Rhodococcus erythropolis SK121]
 gi|229322708|gb|EEN88488.1| cytochrome c oxidase subunit 3 [Rhodococcus erythropolis SK121]
          Length = 298

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 86/178 (48%), Gaps = 8/178 (4%)

Query: 32  LGFWIYLMSDCL----MFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
           +G  ++L S+ +    +FA++FV  A    N+   P  ++++    +   T+VL+ SS +
Sbjct: 122 VGTIVWLSSELMFFAGLFAMYFVARAQANGNWPPEPTELNLYLAVPV---TLVLIASSFT 178

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
           C   + A A +  +     W  +T   G  F+  + YE+ HL+        S + S F+ 
Sbjct: 179 CQMGVFA-AERGDVFGLRRWYTITLVMGAFFVAGQGYEYYHLVHEGTTISSSVYGSVFYM 237

Query: 148 LVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
             G HGLHV  GLI    L+ +              I +S +WHF+D++WI +F+ +Y
Sbjct: 238 TTGFHGLHVIGGLIAFVFLIARTRVSKFTPAQATAAIVVSYYWHFVDIVWIALFATIY 295


>gi|254822835|ref|ZP_05227836.1| cytochrome c oxidase, subunit 3 [Mycobacterium intracellulare ATCC
           13950]
          Length = 180

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 81/164 (49%), Gaps = 4/164 (2%)

Query: 44  MFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHK 103
           +FA++F   A  G  +   P  ++++    +   T+VL+ SS +C   + A A +  +  
Sbjct: 20  LFAMYFTARAQSGGKWPPPPTELNLYQAVPV---TLVLIASSFTCQMGVFA-AERGDVFG 75

Query: 104 TVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWL 163
              W ++T   G+ F+  + YE+ HL +       SA+ S F+   G HGLHV  GL+  
Sbjct: 76  LRRWYVITFLMGLFFVCGQGYEYFHLATHGTTIPGSAYGSVFYLATGFHGLHVTGGLVAF 135

Query: 164 FVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
             L+ +              I +S +WHF+D++WI +F+ +Y +
Sbjct: 136 IFLLARTAMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYFI 179


>gi|284043361|ref|YP_003393701.1| cytochrome-c oxidase [Conexibacter woesei DSM 14684]
 gi|283947582|gb|ADB50326.1| Cytochrome-c oxidase [Conexibacter woesei DSM 14684]
          Length = 208

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 96/183 (52%), Gaps = 9/183 (4%)

Query: 28  DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF--VSTIVLLLSS 85
           D   LG  ++++S+ ++F  FF  Y  + +     P P +  ++  +   V+T +LL SS
Sbjct: 32  DPQMLGMLLFIISEIMVFGAFFTAYFFI-RVVDGNPWPAEGTELPKLIAGVNTAILLSSS 90

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFF-GMIFIIMEIYEFAHLISMEAVPQRSAFLSS 144
           ++  +A+   A KR         + T F  G  F+ ++I E+   +++   P  SA  S 
Sbjct: 91  ITLHWAL--EAVKRGNRGAFKAGMATTFLLGATFLFVQINEY---VNIGFAPYDSAQASV 145

Query: 145 FFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFV 204
           F+ L GLHG HV  GL+ L ++ ++  +    +   R +    ++WHF+D++W+ V+S V
Sbjct: 146 FYGLTGLHGAHVALGLMILLMVTVRAFRGHFSAEEHRGVEIPGIYWHFVDVMWVVVYSTV 205

Query: 205 YLM 207
           YL+
Sbjct: 206 YLL 208


>gi|182439150|ref|YP_001826869.1| putative cytochrome c oxidase subunit III [Streptomyces griseus
           subsp. griseus NBRC 13350]
 gi|291444071|ref|ZP_06583461.1| cytochrome c oxidase subunit III [Streptomyces roseosporus NRRL
           15998]
 gi|326779802|ref|ZP_08239067.1| Cytochrome-c oxidase [Streptomyces cf. griseus XylebKG-1]
 gi|178467666|dbj|BAG22186.1| putative cytochrome c oxidase subunit III [Streptomyces griseus
           subsp. griseus NBRC 13350]
 gi|291347018|gb|EFE73922.1| cytochrome c oxidase subunit III [Streptomyces roseosporus NRRL
           15998]
 gi|326660135|gb|EGE44981.1| Cytochrome-c oxidase [Streptomyces cf. griseus XylebKG-1]
          Length = 206

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 94/184 (51%), Gaps = 9/184 (4%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTY----AVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS 85
           T +G  I+L S+ + FA  F  Y    +V+G +Y    +    F  S    +T +L+LSS
Sbjct: 25  TSVGTIIWLSSELMFFAALFAMYFTLRSVMGPDYWKEMSDHLNFPFSA--TNTTILVLSS 82

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS-AFLSS 144
           L+C   + A A +  + K  +W ++T   G IFI  ++ E+  L+    +   S  + S 
Sbjct: 83  LTCQLGVFA-AERGDVKKLRTWFIITFVMGAIFIGGQVLEYTELVKDAGLSLSSDPYGSV 141

Query: 145 FFALVGLHGLHVFFGLI-WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           F+   G HGLHV  GLI +L VL      K          I +S +WHF+D++WI +F+ 
Sbjct: 142 FYLTTGFHGLHVTGGLIAFLLVLGRTYAAKRFTHDQATAAIVVSYYWHFVDVVWIGLFAT 201

Query: 204 VYLM 207
           +Y++
Sbjct: 202 IYMI 205


>gi|226307082|ref|YP_002767042.1| cytochrome c oxidase subunit III [Rhodococcus erythropolis PR4]
 gi|226186199|dbj|BAH34303.1| cytochrome c oxidase subunit III [Rhodococcus erythropolis PR4]
          Length = 203

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 79/164 (48%), Gaps = 4/164 (2%)

Query: 44  MFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHK 103
           +FA++FV  A    N+   P  ++++    +   T+VL+ SS +C   + A A +  +  
Sbjct: 43  LFAMYFVARAQANGNWPPEPTELNLYLAVPV---TLVLIASSFTCQMGVFA-AERGDVFG 98

Query: 104 TVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWL 163
              W  +T   G  F+  + YE+ HL+        S + S F+   G HGLHV  GLI  
Sbjct: 99  LRRWYTITLIMGAFFVSGQGYEYYHLVHEGTTISSSVYGSVFYMTTGFHGLHVIGGLIAF 158

Query: 164 FVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
             L+ +              I +S +WHF+D++WI +F+ +Y +
Sbjct: 159 VFLIARTRVSKFTPAQATAAIVVSYYWHFVDIVWIALFATIYFI 202


>gi|294138778|ref|YP_003554756.1| cytochrome c oxidase subunit III [Shewanella violacea DSS12]
 gi|293325247|dbj|BAI99977.1| cytochrome c oxidase subunit III [Shewanella violacea DSS12]
          Length = 230

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 104/188 (55%), Gaps = 17/188 (9%)

Query: 35  WIYLMSDCLMFAVFFVTY-AVLGKNYAAGPAPIDVF--DISG-----IFVSTIVLLLSSL 86
           W++L+SD  +F+VF + Y  V   +  + P   +VF   I+G     + ++ +  +L + 
Sbjct: 43  WLFLLSDTFVFSVFLIGYMNVRMSSMDSWPLTSEVFALTIAGHHIPLVLIAIMTFILITS 102

Query: 87  SCSFAMLAS-ATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV-----PQRSA 140
           S + AM  + A +    KTV ++  TA  G  F+ M+ +E+  LI  E V     P  SA
Sbjct: 103 SGTMAMAVNFAYRGDRRKTVLFMTATALLGASFVGMQAFEWTKLIVEEGVRPWGNPMGSA 162

Query: 141 -FLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS-MFWHFLDLIWI 198
            F ++FF + G HGLHV  G+I+L V+  ++  +G   G    ++ ++ ++WHF+DL+W+
Sbjct: 163 QFGATFFMITGFHGLHVTAGVIFLLVIARRV-ARGHYEGKGYHIVEITGLYWHFVDLVWV 221

Query: 199 CVFSFVYL 206
            +F+  YL
Sbjct: 222 FIFALFYL 229


>gi|296129919|ref|YP_003637169.1| Cytochrome-c oxidase [Cellulomonas flavigena DSM 20109]
 gi|296021734|gb|ADG74970.1| Cytochrome-c oxidase [Cellulomonas flavigena DSM 20109]
          Length = 215

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 93/187 (49%), Gaps = 18/187 (9%)

Query: 36  IYLMSDCL----MFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           ++L S+ +    +FA++F   A + + +A      D  ++   F +T +L+LSS++C   
Sbjct: 31  VWLASELMFFAGLFAMYFTVRAAVPEEWAI---QTDKLNLQFAFANTAILVLSSVTCQMG 87

Query: 92  MLASATKRLIHKTV----------SWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAF 141
           + A+   + +               W+ +T   G +FI  +I+E+A L+        S +
Sbjct: 88  VWAAERLQPVRSGSLVQFWRWGMNEWMTLTYVMGAVFIGGQIFEYAELVEHGLTISSSPY 147

Query: 142 LSSFFALVGLHGLHVFFGLI-WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICV 200
            S F+   G HGLHV  GLI +LF+L      K      +   I  S +WHF+D++WI +
Sbjct: 148 GSVFYLTTGFHGLHVVGGLIAFLFLLGRSFAAKRFTHHEETTAIVTSYYWHFVDVVWIAL 207

Query: 201 FSFVYLM 207
           F+ +YL+
Sbjct: 208 FAVIYLV 214


>gi|317121252|ref|YP_004101255.1| cytochrome C oxidase subunit III [Thermaerobacter marianensis DSM
           12885]
 gi|315591232|gb|ADU50528.1| cytochrome c oxidase subunit III [Thermaerobacter marianensis DSM
           12885]
          Length = 214

 Score = 79.0 bits (193), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 97/186 (52%), Gaps = 18/186 (9%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIV--LLLSSLSCS 89
           LG WI+L SD L+FA     Y V      AG  P       G+++ T++  +L+SS S  
Sbjct: 37  LGMWIFLASDVLVFATLLTAYGV--ARLKAGTWPDRTHIFEGLWLVTLMTFILISSSSTM 94

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA--------VPQRSAF 141
            A + +A +      V +LL+T   G+ F+  + +E+  LI   A        VPQ SA 
Sbjct: 95  AAAVGAARRGDQKAAVRFLLLTILGGLFFLGSQAFEWTSLIREGARLMSNPWGVPQFSA- 153

Query: 142 LSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVF 201
             SFF + G HG HV  GLI+L V+ +  + +G  SG    +  L  +WHF+DL+W+ +F
Sbjct: 154 --SFFVITGFHGFHVLTGLIYLAVITLNAM-RGRYSGLGVEVAGL--YWHFVDLVWVFIF 208

Query: 202 SFVYLM 207
           +  YL+
Sbjct: 209 TLFYLI 214


>gi|262279558|ref|ZP_06057343.1| LOW QUALITY PROTEIN: cytochrome o ubiquinol oxidase subunit III
           [Acinetobacter calcoaceticus RUH2202]
 gi|262259909|gb|EEY78642.1| LOW QUALITY PROTEIN: cytochrome o ubiquinol oxidase subunit III
           [Acinetobacter calcoaceticus RUH2202]
          Length = 128

 Score = 79.0 bits (193), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 64/104 (61%), Gaps = 4/104 (3%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVF--DISGIFVSTIVLLLSSL 86
           T  GFW YLMSD ++F   F+ +AVL  +   G P+  D+F   +  +   T  LL+SS+
Sbjct: 24  TVFGFWTYLMSDLILFGSLFIAFAVLSSHIPPGTPSAYDLFHDSLGYVLTETFALLISSV 83

Query: 87  SCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
           +  FA+LAS  K  +++ ++WL +T  FG  FI MEIYEF HL+
Sbjct: 84  TFGFAVLASYKKN-VNQVITWLFITFLFGATFIGMEIYEFHHLV 126


>gi|72383611|ref|YP_292966.1| cytochrome c oxidase subunit III [Prochlorococcus marinus str.
           NATL2A]
 gi|72003461|gb|AAZ59263.1| cytochrome c oxidase subunit III [Prochlorococcus marinus str.
           NATL2A]
          Length = 201

 Score = 79.0 bits (193), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 95/194 (48%), Gaps = 10/194 (5%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
           K++  +    D    G   +L++D + FA FF  Y         GP  I   ++    ++
Sbjct: 14  KNELSTEEHEDFRLFGLIAFLIADGMTFAGFFAAYLTFKAVNPIGPDAIYELELPLPTLN 73

Query: 78  TIVLLLSSLSCSFA--MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           TI+LL+SS +   A   L     +L  K   WLL+T   G+ F+I +++E+    ++   
Sbjct: 74  TILLLVSSFTFHRAGKFLEKNESKLCQK---WLLITGVLGVAFLISQMFEY---FTLPFG 127

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLI--CLSMFWHFL 193
              + F S+F+AL G HGLHV  G I + ++  Q         NQ +     + ++WHF+
Sbjct: 128 LTDNLFASTFYALTGFHGLHVTLGSIMIMIIWWQTRVPSGRVNNQNKFPFEAVELYWHFV 187

Query: 194 DLIWICVFSFVYLM 207
           D IW+ +F  +YL+
Sbjct: 188 DGIWVVLFIILYLL 201


>gi|311895599|dbj|BAJ28007.1| putative cytochrome c oxidase subunit III [Kitasatospora setae
           KM-6054]
          Length = 206

 Score = 79.0 bits (193), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 93/182 (51%), Gaps = 9/182 (4%)

Query: 32  LGFWIYLMSDCLMFAVFFVTY----AVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
           +G  ++L S+ + FA  F  Y    +V G  +    A     ++    V+T +L+LSSL+
Sbjct: 27  VGTIVWLSSELMFFAALFAMYFTLRSVKGTEFWHEKA--HALNVPFSSVNTTILVLSSLT 84

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS-AFLSSFF 146
           C   + A A +  + K  SW  +T   G IFI  +IYE+  L+  + +   S  + + F+
Sbjct: 85  CQLGVFA-AERGDVKKLRSWFSITFVMGAIFIGGQIYEYTELVKKDGLSLSSDPYGTVFY 143

Query: 147 ALVGLHGLHVFFGLI-WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
              G HGLHV  GLI +L VL      +          I +S +WHF+D++WI +F+ +Y
Sbjct: 144 LTTGFHGLHVTGGLIAFLLVLGRTYAARRFTHEQATAAIVVSYYWHFVDVVWIGLFATIY 203

Query: 206 LM 207
           L+
Sbjct: 204 LI 205


>gi|134098267|ref|YP_001103928.1| cytochrome c oxidase subunit III [Saccharopolyspora erythraea NRRL
           2338]
 gi|133910890|emb|CAM01003.1| cytochrome c oxidase subunit III [Saccharopolyspora erythraea NRRL
           2338]
          Length = 181

 Score = 79.0 bits (193), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 87/174 (50%), Gaps = 3/174 (1%)

Query: 36  IYLMSDCLMFAVFFVTY-AVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLA 94
           ++L S+ + FA  F  +  V  +N    P P    ++      TI+L+ SS +C + + A
Sbjct: 8   VWLASELMFFAGLFAMFFTVKAQNEGEWPPPPTHLNLPYALPFTIILVASSFTCQWGVFA 67

Query: 95  SATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP-QRSAFLSSFFALVGLHG 153
            A +  ++    W ++T   G +F++ +  E+  LI+        SA+ + F+   G HG
Sbjct: 68  -AERGDVYGLRRWYVITLIMGTVFVLGQAGEYYQLITEHHTTIASSAYGTVFYMTTGFHG 126

Query: 154 LHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           LHV  GLI    L+++              I +S +WHF+D++WI +F+ +YL+
Sbjct: 127 LHVIGGLIAFVFLIVRTRLSKFTPAQAIAAIVVSYYWHFVDIVWIGLFAVIYLV 180


>gi|90411372|ref|ZP_01219383.1| putative cytochrome c oxidase subunit III [Photobacterium profundum
           3TCK]
 gi|90327585|gb|EAS43928.1| putative cytochrome c oxidase subunit III [Photobacterium profundum
           3TCK]
          Length = 249

 Score = 79.0 bits (193), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 100/194 (51%), Gaps = 22/194 (11%)

Query: 35  WIYLMSDCLMFAVFFVTY-AVLGKNYAAGPAPIDVF-------DISGIFVSTIVLLLSSL 86
           W++L+SD  +F  F V Y +V      + P   DVF       DI  + ++ +  +L + 
Sbjct: 55  WLFLLSDIFIFGSFLVAYMSVRMTTTESWPLTSDVFALNLGGQDIPLVLIAIMTFILITS 114

Query: 87  SCSFAMLAS-ATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ------RS 139
           S + AM  +   +     T + + +TA FG+ F+ M+ +E+  LI  E +         +
Sbjct: 115 SGTMAMAVNFGYQGRRQLTAALIFITALFGLAFVGMQAFEWTKLIVEEGIRPWGNDLGAA 174

Query: 140 AFLSSFFALVGLHGLHVFFGLIWLFVLVIQIL------KKGLISGNQRRLICLS-MFWHF 192
            F +SFF + G HGLHV  G+I+L  +  ++        +   S N+  ++ ++ ++WHF
Sbjct: 175 QFGASFFMITGFHGLHVSIGVIYLLTIAWRVWCGRYEKTQSDNSTNRYEIVEIAGLYWHF 234

Query: 193 LDLIWICVFSFVYL 206
           +DL+W+ +F+F YL
Sbjct: 235 VDLVWVFIFAFFYL 248


>gi|254525574|ref|ZP_05137626.1| cytochrome c oxidase subunit 3 [Prochlorococcus marinus str. MIT
           9202]
 gi|221536998|gb|EEE39451.1| cytochrome c oxidase subunit 3 [Prochlorococcus marinus str. MIT
           9202]
          Length = 200

 Score = 79.0 bits (193), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 66/203 (32%), Positives = 100/203 (49%), Gaps = 27/203 (13%)

Query: 18  KDKKESCVDH-DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAP---IDVFDISG 73
           K+  E    H D    G   +L++D + FA FF  Y       A  P P   I   ++  
Sbjct: 12  KNNSEVNETHEDFRMFGLITFLIADGMTFAGFFAAYLTYK---AVNPLPDGAIYELELPI 68

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVS----WLLVTAFFGMIFIIMEIYEFAHL 129
             ++TI+LL+SS     A    A K L+    S    WL  TAF G+IF+I +++E+ +L
Sbjct: 69  PTLNTILLLVSS-----ATFHKAGKSLLKDKNSDSQKWLFFTAFLGIIFLICQLFEYFNL 123

Query: 130 ISMEAVP---QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLI 184
                 P     + F S+F+AL G HGLHV  G + + ++  Q    G  L S N   L 
Sbjct: 124 ------PFGLTDNLFASTFYALTGFHGLHVTLGTLMILIIAWQSRINGGRLNSQNIFPLE 177

Query: 185 CLSMFWHFLDLIWICVFSFVYLM 207
            + ++WHF+D IW+ +F  +YL+
Sbjct: 178 AVELYWHFVDGIWVILFIILYLL 200


>gi|319440225|ref|ZP_07989381.1| cytochrome c oxidase subunit III [Corynebacterium variabile DSM
           44702]
          Length = 203

 Score = 79.0 bits (193), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 85/164 (51%), Gaps = 4/164 (2%)

Query: 44  MFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHK 103
           +FA++FV+ A  G ++ + P  ++V    GI   T++L+ SS +  + + A A +  +  
Sbjct: 43  LFAMYFVSKANSGGDWPSHPTELNVPFALGI---TVILVSSSFTAQWGVFA-AERGDVFG 98

Query: 104 TVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWL 163
              W  +T   G IF+I + YE+ HL+        S + S FF   G HG HV  G++  
Sbjct: 99  LRKWYALTIVLGAIFLIGQAYEYIHLVEHGTTISSSVYGSVFFITTGFHGAHVLAGVLAF 158

Query: 164 FVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
            V++++  K           + +S +WHF+D++WI ++  +Y +
Sbjct: 159 VVVLLRTAKSKFTPAQATAAVVVSYYWHFVDVVWIGLWITIYFI 202


>gi|197121267|ref|YP_002133218.1| cytochrome C oxidase subunit III [Anaeromyxobacter sp. K]
 gi|220915971|ref|YP_002491275.1| cytochrome c oxidase subunit III [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|196171116|gb|ACG72089.1| cytochrome c oxidase subunit III [Anaeromyxobacter sp. K]
 gi|219953825|gb|ACL64209.1| cytochrome c oxidase subunit III [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 209

 Score = 79.0 bits (193), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 97/202 (48%), Gaps = 20/202 (9%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY--AAGPAPIDVFDISGIFVS 77
           +K+S  +     LG W++L S+ L+F   F  YAV    Y  A   A   +    G+ V+
Sbjct: 14  EKQSHAER----LGMWLFLASEVLLFTALFAAYAVYRYLYSDAFAEASRAIETWLGL-VN 68

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           TI+L+ SS + +   L  A K    KT  W  V+  F + F+ ++  E++H      +P 
Sbjct: 69  TIILVTSSFTVALG-LNEAVKGNGKKTGLWFAVSVAFAVAFLALKAVEYSHHFHEGQLPG 127

Query: 138 R------------SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLIC 185
           R            S F + +F + GLHG+HV  G+  L V+ ++  +    +     +  
Sbjct: 128 RYYSFQELQAPGASLFFALYFLITGLHGVHVIVGMTILAVVGVKAARGKYTAAYHTPVEL 187

Query: 186 LSMFWHFLDLIWICVFSFVYLM 207
             ++WH +DLIWI VF  +YL+
Sbjct: 188 AGLYWHLVDLIWIFVFPLIYLV 209


>gi|328951468|ref|YP_004368803.1| cytochrome c oxidase subunit III [Marinithermus hydrothermalis DSM
           14884]
 gi|328451792|gb|AEB12693.1| cytochrome c oxidase subunit III [Marinithermus hydrothermalis DSM
           14884]
          Length = 222

 Score = 78.6 bits (192), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 56/189 (29%), Positives = 97/189 (51%), Gaps = 20/189 (10%)

Query: 35  WIYLMSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVF-------DISGIFVSTIVLLLSSL 86
           W++L+SD  +F  F   YA          P P +VF       ++  + ++ +  +L S 
Sbjct: 36  WLFLLSDTFIFGAFLSGYAAARVAATQAWPDPSEVFALRVGQTEVPLLLIAIMTFVLISS 95

Query: 87  SCSFAM-LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI--------SMEAVPQ 137
           S + A+ +A   ++   +T  +L++TA  G+ F+ M+ +E+  LI        +    PQ
Sbjct: 96  SGTMAIGVAYGYRQDRTRTALFLVLTALLGLTFVSMQAFEWTKLILEGFRPWGNPVGAPQ 155

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
              F SSFF L G HGLHV  G+I+L  + +++LK          +    ++WHF+DL+W
Sbjct: 156 ---FGSSFFMLTGFHGLHVTAGVIYLSAVAVRVLKGVYDRHGYAGVEIAGLYWHFVDLVW 212

Query: 198 ICVFSFVYL 206
           + +F+F YL
Sbjct: 213 VFIFAFFYL 221


>gi|326382517|ref|ZP_08204208.1| cytochrome-c oxidase [Gordonia neofelifaecis NRRL B-59395]
 gi|326198636|gb|EGD55819.1| cytochrome-c oxidase [Gordonia neofelifaecis NRRL B-59395]
          Length = 203

 Score = 78.6 bits (192), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 89/192 (46%), Gaps = 2/192 (1%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVFDISGIF 75
           +  +  S    +   +G  ++L S+ + FA  F  Y V   N + G P P    ++    
Sbjct: 12  ITSRVHSLNRPNMVSVGTIVWLSSELMFFAGLFAMYFVARANSSDGWPQPPTHLNLWLAV 71

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
             T +L+LSS +C   + A A +  ++    W  +T   G IF+I +  E+  L+     
Sbjct: 72  PVTTILILSSFTCQAGVFA-AERGDVYGLRRWYTLTLVMGTIFVIGQATEYYSLVQEGTT 130

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
              SA+ S F+   G HG+HV  GL+    L+++              I +S +WHF+D+
Sbjct: 131 LSSSAYGSVFYMATGFHGMHVIGGLLAFVFLLVRTRLSKFTPAQATAAIVVSYYWHFVDV 190

Query: 196 IWICVFSFVYLM 207
           +WI +F  +Y +
Sbjct: 191 VWIALFVVIYFI 202


>gi|308205480|gb|ADO18975.1| cytochrome c oxidase subunit III [Nostoc flagelliforme str.
           Sunitezuoqi]
          Length = 188

 Score = 78.6 bits (192), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 88/176 (50%), Gaps = 5/176 (2%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           G   +L S+ LMF  FF TY       A  P      ++    ++TI+L+ SS    F  
Sbjct: 14  GLLTFLASESLMFGGFFATYLFFRGTTAVWPPEGSEVELLVPTINTIILVSSSFVIHFGD 73

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
            A   K  +     W  +TA  G IF+  ++YE++   ++      + F + F+ + G H
Sbjct: 74  TA-IKKNNVKGMQLWYAITAIMGAIFLGGQVYEYS---TLGYGLTTNVFANCFYIMTGFH 129

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS-MFWHFLDLIWICVFSFVYLM 207
           GLHVF GL+ +   + +    G  S N    I ++ ++WHF+D+IWI +F+ VY++
Sbjct: 130 GLHVFVGLLLILRALWRSRLPGEYSANNHTFIEMTEIYWHFVDIIWIVLFTLVYVL 185


>gi|41408030|ref|NP_960866.1| CtaE [Mycobacterium avium subsp. paratuberculosis K-10]
 gi|62899981|sp|Q73YM3|COX3_MYCPA RecName: Full=Probable cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome aa3 subunit 3; AltName: Full=Cytochrome
           c oxidase polypeptide III
 gi|41396385|gb|AAS04249.1| CtaE [Mycobacterium avium subsp. paratuberculosis K-10]
          Length = 203

 Score = 78.6 bits (192), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 81/164 (49%), Gaps = 4/164 (2%)

Query: 44  MFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHK 103
           +FA++F   A  G  +   P  ++++    +   T+VL+ SS +C   + A A +  +  
Sbjct: 43  LFAMYFTARAQSGGKWPPPPTELNLYQAVPV---TLVLIASSFTCQMGVFA-AERGDVFG 98

Query: 104 TVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWL 163
              W ++T   G+ F++ + YE+ HL+        SA+ S F+   G H LHV  GL+  
Sbjct: 99  LRRWYVITFLMGLFFVLGQGYEYYHLMGHGTTIPGSAYGSVFYLATGFHDLHVTGGLVAF 158

Query: 164 FVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
             L+ +              I +S +WHF+D++WI +F+ +Y +
Sbjct: 159 IFLLARTAMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYFI 202


>gi|157412859|ref|YP_001483725.1| cytochrome c oxidase, subunit III [Prochlorococcus marinus str. MIT
           9215]
 gi|157387434|gb|ABV50139.1| Cytochrome c oxidase, subunit III [Prochlorococcus marinus str. MIT
           9215]
          Length = 200

 Score = 78.6 bits (192), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 66/203 (32%), Positives = 100/203 (49%), Gaps = 27/203 (13%)

Query: 18  KDKKESCVDH-DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAP---IDVFDISG 73
           K+  E    H D    G   +L++D + FA FF  Y       A  P P   I   ++  
Sbjct: 12  KNNSEINETHEDFRMFGLITFLIADGMTFAGFFAAYLTYK---AVNPLPDGAIYELELPI 68

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVS----WLLVTAFFGMIFIIMEIYEFAHL 129
             ++TI+LL+SS     A    A K L+    S    WL  TAF G+IF+I +++E+ +L
Sbjct: 69  PTLNTILLLVSS-----ATFHKAGKALLKDKNSDSQKWLFFTAFLGIIFLICQLFEYFNL 123

Query: 130 ISMEAVP---QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLI 184
                 P     + F S+F+AL G HGLHV  G + + ++  Q    G  L S N   L 
Sbjct: 124 ------PFGLTDNLFASTFYALTGFHGLHVTLGTLMILIIAWQSRINGGRLNSQNIFPLE 177

Query: 185 CLSMFWHFLDLIWICVFSFVYLM 207
            + ++WHF+D IW+ +F  +YL+
Sbjct: 178 AVELYWHFVDGIWVILFIILYLL 200


>gi|27378893|ref|NP_770422.1| cytochrome C oxidase [Bradyrhizobium japonicum USDA 110]
 gi|39513|emb|CAA48550.1| cytochrome-c oxidase [Bradyrhizobium japonicum]
 gi|27352042|dbj|BAC49047.1| cytochrome C oxidase [Bradyrhizobium japonicum USDA 110]
          Length = 240

 Score = 78.6 bits (192), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 101/197 (51%), Gaps = 26/197 (13%)

Query: 35  WIYLMSDCLMFAVFFVTYAVLG-KNYAAGPAPIDVF--DISG-----IFVSTIVLLLSSL 86
           WI+L+SD  +F+ F ++Y           P P +VF  +I G     I ++ +  +L S 
Sbjct: 44  WIFLLSDTFIFSCFLLSYMTARMSTTVPWPNPSEVFALNIGGKHIPLILIAIMTFILISS 103

Query: 87  SCSFAMLAS-ATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV-----PQRSA 140
           S + AM  +   +R   +T   +L TA FG  F+ M+ +E+  LI ME V     P  +A
Sbjct: 104 SGTMAMAVNFGYRRDRVRTAILMLATAAFGATFVSMQAFEWTKLI-MEGVRPWGNPWGAA 162

Query: 141 -FLSSFFALVGLHGLHVFFGLIWLFVLVIQILK-------KGLIS---GNQRRLICLSMF 189
            F SSFF + G HG HV  G+I+L  +  ++ +       +G  +   G    +    ++
Sbjct: 163 QFGSSFFMITGFHGTHVTIGVIFLIAIARKVWRGDFDVERRGFFTSRKGYYEIVEITGLY 222

Query: 190 WHFLDLIWICVFSFVYL 206
           WHF+DL+W+ +F+F YL
Sbjct: 223 WHFVDLVWVFIFAFFYL 239


>gi|163751404|ref|ZP_02158629.1| probable cytochrome-C oxidase subunit III oxidoreductase protein
           [Shewanella benthica KT99]
 gi|161328707|gb|EDP99855.1| probable cytochrome-C oxidase subunit III oxidoreductase protein
           [Shewanella benthica KT99]
          Length = 230

 Score = 78.6 bits (192), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 60/188 (31%), Positives = 104/188 (55%), Gaps = 17/188 (9%)

Query: 35  WIYLMSDCLMFAVFFVTY-AVLGKNYAAGPAPIDVF--DISG-----IFVSTIVLLLSSL 86
           W++L+SD  +F+VF + Y  V   +  + P   +VF   I+G     + ++ +  +L + 
Sbjct: 43  WLFLLSDTFVFSVFLIGYMNVRMSSMDSWPLTSEVFALTIAGYHIPLVLIAIMTFILITS 102

Query: 87  SCSFAMLAS-ATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV-----PQRSA 140
           S + AM  + A +    KTV ++  TA  G  F+ M+ +E+A LI  E V     P  SA
Sbjct: 103 SGTMAMAVNFAYRGDSRKTVLFMTATALLGASFLGMQAFEWAKLIIEEGVRPWGNPMGSA 162

Query: 141 -FLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS-MFWHFLDLIWI 198
            F ++FF + G HGLHV  G+I+L V+  ++   G   G    ++ ++ ++WHF+DL+W+
Sbjct: 163 QFGATFFMITGFHGLHVTAGVIFLLVIARRV-ASGHYEGKGYHIVEITGLYWHFVDLVWV 221

Query: 199 CVFSFVYL 206
            +F+  YL
Sbjct: 222 FIFALFYL 229


>gi|50954674|ref|YP_061962.1| cytochrome C oxidase subunit III [Leifsonia xyli subsp. xyli str.
           CTCB07]
 gi|50951156|gb|AAT88857.1| cytochrome C oxidase subunit III [Leifsonia xyli subsp. xyli str.
           CTCB07]
          Length = 211

 Score = 78.6 bits (192), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 95/188 (50%), Gaps = 20/188 (10%)

Query: 36  IYLMSDCLMFAVFFVTYAVLGKNYAAGP---APIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           ++L S+ + FA  F  Y  L     +GP   A     +I     +T +L+LSS++C F +
Sbjct: 27  VWLGSEVMFFAGLFAIYFTLKST--SGPLWAAETAHLNIPYAAANTTILVLSSVTCQFGV 84

Query: 93  LASATKRLIHKT-----------VSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAF 141
            A A +   H+T           V W +++   G +F+  +I E+A L+S       +A+
Sbjct: 85  FA-AERLQAHRTGGVLQFWKWGMVEWFVLSYILGAVFVSGQILEYATLVSEGTSLSSNAY 143

Query: 142 LSSFFALVGLHGLHVFFGLIWLFVLVI--QILKKGLISGNQRRLICLSMFWHFLDLIWIC 199
            S+F+   G HGLHV  GLI  F+LV+      K          I +S +WHF+D++W+ 
Sbjct: 144 GSAFYLTTGFHGLHVTGGLI-AFLLVVGRAYAVKSFGHKEATSAIVVSYYWHFVDVVWLG 202

Query: 200 VFSFVYLM 207
           +F+ +Y++
Sbjct: 203 LFAVIYII 210


>gi|120404528|ref|YP_954357.1| cytochrome c oxidase subunit III [Mycobacterium vanbaalenii PYR-1]
 gi|119957346|gb|ABM14351.1| cytochrome c oxidase, subunit III [Mycobacterium vanbaalenii PYR-1]
          Length = 220

 Score = 78.6 bits (192), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 88/177 (49%), Gaps = 6/177 (3%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAG---PAPIDVFDISGIFVSTIVLLLSSLSC 88
           +G  ++L S+ + FA  F  Y    +  A G   P P ++ +++     T+VL+ SS +C
Sbjct: 44  VGTIVWLSSELMFFAGLFAMY-FTARAQAHGDWPPEPTEL-NLALAVPVTLVLIASSFTC 101

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
              + A A +  +     W  +T   G  F++ + YE+ HL+        SA+ + F+  
Sbjct: 102 QMGVFA-AERGDVFGLRRWYTLTLAMGTFFVLGQGYEYIHLVEEGTTIPGSAYGTVFYLA 160

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
            G HGLHV  GLI   +L+I+              I +S +WHF+D++WI +F+ +Y
Sbjct: 161 TGFHGLHVIGGLIAFVLLLIRTKMSKFTPAQATAAIVVSYYWHFVDIVWIALFAVIY 217


>gi|313902141|ref|ZP_07835551.1| cytochrome c oxidase subunit III [Thermaerobacter subterraneus DSM
           13965]
 gi|313467604|gb|EFR63108.1| cytochrome c oxidase subunit III [Thermaerobacter subterraneus DSM
           13965]
          Length = 214

 Score = 78.2 bits (191), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 63/186 (33%), Positives = 97/186 (52%), Gaps = 18/186 (9%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIV--LLLSSLSCS 89
           LG W++L SD L+FA     Y V      AG  P       G+++ T++  +L+SS S  
Sbjct: 37  LGMWVFLASDVLVFATLLTAYGV--ARLKAGTWPDRTHIFEGLWLVTLMTFILISSSSTM 94

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA--------VPQRSAF 141
            A + +A +      V +LL+T   G+ F+  + +E+  LI   A        VPQ SA 
Sbjct: 95  AAAVGAARRGDQKAAVRFLLLTILGGLFFLGSQAFEWTSLIREGARLFTNPWGVPQFSA- 153

Query: 142 LSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVF 201
             SFF + G HG HV  GLI+L V+ +  + +G  SG    +  L  +WHF+DL+W+ +F
Sbjct: 154 --SFFVITGFHGFHVLTGLIYLAVVTLNAM-RGRYSGLGVEVAGL--YWHFVDLVWVFIF 208

Query: 202 SFVYLM 207
           +  YL+
Sbjct: 209 TLFYLI 214


>gi|296393481|ref|YP_003658365.1| cytochrome-c oxidase [Segniliparus rotundus DSM 44985]
 gi|296180628|gb|ADG97534.1| Cytochrome-c oxidase [Segniliparus rotundus DSM 44985]
          Length = 209

 Score = 78.2 bits (191), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 85/168 (50%), Gaps = 10/168 (5%)

Query: 44  MFAVFFVTYAVLG------KNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASAT 97
           +FA++FVT A         KN+   P  +++F    +   T VL+LSS +C + + A A 
Sbjct: 43  LFAMYFVTRAGQAPALDGHKNWPPEPTHLNLFLAIPV---TTVLVLSSFTCQWGVFA-AE 98

Query: 98  KRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVF 157
           +  +     W  +T   G  F++ + +E+ +L +       SA+ S FF   G HGLHV 
Sbjct: 99  RGDVFGLRRWYTITLLMGTFFVMGQGFEYTNLYAEGTRLDSSAYGSVFFITTGFHGLHVI 158

Query: 158 FGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
            GL+   +L+++              I +S +WHF+D++WI +F+ +Y
Sbjct: 159 GGLVAFVLLLVRTKMSKFTPAQATSAIVVSYYWHFVDVVWIALFATIY 206


>gi|170742043|ref|YP_001770698.1| cytochrome c oxidase subunit III [Methylobacterium sp. 4-46]
 gi|168196317|gb|ACA18264.1| cytochrome c oxidase subunit III [Methylobacterium sp. 4-46]
          Length = 240

 Score = 78.2 bits (191), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 94/196 (47%), Gaps = 24/196 (12%)

Query: 35  WIYLMSDCLMFAVFFVTY-AVLGKNYAAGPAPIDVFDIS-G------IFVSTIVLLLSSL 86
           WI+L+SD  +F  F V Y  V        P P +VF +  G      + ++ +  +L S 
Sbjct: 44  WIFLLSDTFVFGCFLVGYMTVRMSTMVPWPNPSEVFSLEIGHAKLPLLLIAIMTFVLISS 103

Query: 87  SCSFAMLASATKRLIHKTVSWLL-VTAFFGMIFIIMEIYEFAHLISMEAVPQRSA----- 140
           S + AM  +   R   +T + L+ VTA  G  F+ M+ +E+  LI     P  +      
Sbjct: 104 SGTMAMAVAYGYRRDRRTTALLMGVTALLGATFVGMQAFEWTKLIREGVRPWSNPWGAHQ 163

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ----------RRLICLSMFW 190
           F S+FF + G HG HV  G+I L ++  ++ +    +G +            +  + ++W
Sbjct: 164 FGSTFFMITGFHGTHVTIGVIVLLIIARKVWRGDFDTGRRGFFTSQRGRYENVEIVGLYW 223

Query: 191 HFLDLIWICVFSFVYL 206
           HF+DL+W+ +F+  YL
Sbjct: 224 HFVDLVWVFIFALFYL 239


>gi|152967194|ref|YP_001362978.1| cytochrome C oxidase subunit III [Kineococcus radiotolerans
           SRS30216]
 gi|151361711|gb|ABS04714.1| cytochrome c oxidase subunit III [Kineococcus radiotolerans
           SRS30216]
          Length = 219

 Score = 78.2 bits (191), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 57/192 (29%), Positives = 104/192 (54%), Gaps = 20/192 (10%)

Query: 32  LGFWIYLMSDCL----MFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
           +G  ++L S+ +    +FA++F   +V    + +GPA ++V   S   ++T +L++SS  
Sbjct: 31  VGVIVWLSSELMFFAGLFAMYFTIRSVAPALWESGPALLNVPFSS---INTTILVISSFW 87

Query: 88  CSFAMLASA---TKRL--IHKT-----VSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           C F + A+     +RL  +H+        W ++T  FG +F+  +++E+A L        
Sbjct: 88  CQFGVFAAERFQPRRLGKLHEVGKWGMEEWFILTYIFGALFVAGQVFEYAELAHEGLTIA 147

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQR--RLICLSMFWHFLDL 195
            +A+ S F    G HG+HVF GL+  F+LVI         G+Q     I +S +WHF+D+
Sbjct: 148 TNAYGSVFILATGFHGIHVFGGLV-AFLLVIGRSYASKRFGHQEATSAIVVSYYWHFVDV 206

Query: 196 IWICVFSFVYLM 207
           +WI +F+ +Y++
Sbjct: 207 VWIGLFTVIYIL 218


>gi|86358221|ref|YP_470113.1| cytochrome-c oxidase subunit III protein [Rhizobium etli CFN 42]
 gi|86282323|gb|ABC91386.1| cytochrome-c oxidase subunit III protein [Rhizobium etli CFN 42]
          Length = 239

 Score = 78.2 bits (191), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 58/196 (29%), Positives = 102/196 (52%), Gaps = 24/196 (12%)

Query: 35  WIYLMSDCLMFAVFFVTYAVLGKNYA-AGPAPIDVF-------DISGIFVSTIVLLLSSL 86
           WI+L+SD  +F  F + Y     +   A P P +VF       DI  I ++ +  +L S 
Sbjct: 43  WIFLLSDTFVFGCFLIAYMTARMSTPVAWPNPSEVFALHIGGQDIPLILIAIMTFVLISS 102

Query: 87  SCSFAMLAS-ATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA----- 140
           S + AM  +   +R  H+T + +L+TA  G  F+ M+ +E+  LI+    P  +      
Sbjct: 103 SGTMAMAVNFGYRRERHRTAALMLLTALLGATFVSMQAFEWTKLITEGVRPWENPWGAAQ 162

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQILK-------KGLISGNQRR---LICLSMFW 190
           F S+FF + G HG HV  G+I+L ++  ++ +       +G  +  + R   +  + ++W
Sbjct: 163 FGSTFFMITGFHGTHVTIGVIFLLIVARKVWRGDFDVERRGFFTSRKGRYEVVEIMGLYW 222

Query: 191 HFLDLIWICVFSFVYL 206
           HF+DL+W+ +F+F YL
Sbjct: 223 HFVDLVWVFIFAFFYL 238


>gi|296140388|ref|YP_003647631.1| cytochrome-c oxidase [Tsukamurella paurometabola DSM 20162]
 gi|296028522|gb|ADG79292.1| Cytochrome-c oxidase [Tsukamurella paurometabola DSM 20162]
          Length = 181

 Score = 78.2 bits (191), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 51/165 (30%), Positives = 83/165 (50%), Gaps = 5/165 (3%)

Query: 44  MFAVFFVTYAVLGKNYAAGPAPIDV-FDISGIFVSTIVLLLSSLSCSFAMLASATKRLIH 102
           +FA++FV  A  G+N   G  P D    +      TIVL+LSS++C   + A A +  + 
Sbjct: 20  LFAMYFVARAGAGEN---GWPPADTNVSLWAALPPTIVLILSSVTCQLGVFA-AERGDVF 75

Query: 103 KTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIW 162
           K   W  V+   G  FI+ ++ E+  LIS       S + S F+   G HGLHV  GL+ 
Sbjct: 76  KFRIWYFVSFLMGFAFILGQLNEYKTLISEGLTLSSSVYGSVFYMATGFHGLHVMGGLVA 135

Query: 163 LFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
              ++ +              I +S +WHF+D++WI +F+ +Y++
Sbjct: 136 FIFILARSRASKFTPAQATSAIVVSYYWHFVDVVWIGLFAVIYII 180


>gi|29832594|ref|NP_827228.1| cytochrome c oxidase subunit III [Streptomyces avermitilis MA-4680]
 gi|62900004|sp|Q82AK5|COX3_STRAW RecName: Full=Probable cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome aa3 subunit 3; AltName: Full=Cytochrome
           c oxidase polypeptide III
 gi|29609714|dbj|BAC73763.1| putative cytochrome c oxidase subunit III (complex IV)
           [Streptomyces avermitilis MA-4680]
          Length = 206

 Score = 78.2 bits (191), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 93/184 (50%), Gaps = 9/184 (4%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTY----AVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS 85
           T +G  I+L S+ + FA  F  Y    +V G  +    A    F  S    +T +L+LSS
Sbjct: 25  TSVGTIIWLSSELMFFAALFAMYFTLRSVTGPEHWKEMASHLNFPFSA--TNTTILVLSS 82

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS-AFLSS 144
           L+C   + A A +  + K   W +VT   G IFI  +++E+  L+  + +   S  + S 
Sbjct: 83  LTCQLGVFA-AERGDVKKLRMWFIVTFIMGAIFIGGQVFEYTELVKKDGLSLSSDPYGSV 141

Query: 145 FFALVGLHGLHVFFGLI-WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           F+   G HGLHV  GLI +L VL      +          I +S +WHF+D++WI +F+ 
Sbjct: 142 FYLTTGFHGLHVTGGLIAFLLVLGRTYAARRFTHEQATAAIVVSYYWHFVDVVWIGLFAT 201

Query: 204 VYLM 207
           +Y++
Sbjct: 202 IYMI 205


>gi|238060321|ref|ZP_04605030.1| cytochrome c oxidase subunit III [Micromonospora sp. ATCC 39149]
 gi|237882132|gb|EEP70960.1| cytochrome c oxidase subunit III [Micromonospora sp. ATCC 39149]
          Length = 199

 Score = 78.2 bits (191), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 90/192 (46%), Gaps = 8/192 (4%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAP----IDVFDISG 73
           K +  S    +   +G  ++L S+ + FA  F  Y  +    AA P       +  ++  
Sbjct: 9   KSRIHSLTRPNMVSVGTIVWLSSELMFFAALFAMYFSI---RAAAPEQWAKHTEHLNVPY 65

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
               T++L+LSS++C   + A A K  +H    W  +T   G+IF++ ++ E+  L+   
Sbjct: 66  ATTFTVILVLSSVTCQLGVFA-AEKGDVHALRRWFTITFVMGLIFVLGQVNEYVTLVHEG 124

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
                  + S F+   G HGLHV  GL+   + +++              I +S +WHF+
Sbjct: 125 VKINADGYGSMFYLTTGFHGLHVTGGLVAFIIFMVRTTMGRFTPAQATSAIVVSYYWHFV 184

Query: 194 DLIWICVFSFVY 205
           D++WI +++ +Y
Sbjct: 185 DVVWIGLYAMIY 196


>gi|319950678|ref|ZP_08024579.1| cytochrome c oxidase [Dietzia cinnamea P4]
 gi|319435661|gb|EFV90880.1| cytochrome c oxidase [Dietzia cinnamea P4]
          Length = 203

 Score = 78.2 bits (191), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 86/165 (52%), Gaps = 6/165 (3%)

Query: 44  MFAVFFVTYAVLGKNYAAGPAPIDV-FDISGIFVSTIVLLLSSLSCSFAMLASATKRLIH 102
           +FA++FV+ A  G ++ + P  ++V F ++     T++L+ SS +C   + A A +  + 
Sbjct: 43  LFAMYFVSKANSGGDWPSYPTHLNVPFALT----ITVILVASSFTCQLGVFA-AEQGDVF 97

Query: 103 KTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIW 162
               W +++A  G +F+I + YE+  L         S + S FF   G HGLHV  G+I 
Sbjct: 98  GLRRWYVISAVMGTVFLIGQAYEYVMLYLEGTTISSSVYGSVFFITTGFHGLHVAAGVIA 157

Query: 163 LFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
             VLV++              I +S +WHF+D++WI +F  +Y +
Sbjct: 158 FVVLVMRTTMSRFTPAQATAAIVVSYYWHFVDVVWIGLFVTIYFI 202


>gi|169629853|ref|YP_001703502.1| cytochrome c oxidase subunit III [Mycobacterium abscessus ATCC
           19977]
 gi|169241820|emb|CAM62848.1| Cytochrome c oxidase subunit III [Mycobacterium abscessus]
          Length = 180

 Score = 77.8 bits (190), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 86/176 (48%), Gaps = 6/176 (3%)

Query: 35  WIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS---GIFVSTIVLLLSSLSCSFA 91
           WI++M D  +F VFF   AV G +YA  PA  ++   S    I ++  + L+SS +    
Sbjct: 8   WIFIMGDLTVFGVFF---AVWGWSYARNPAMFELGRASMSQSIGLTETLTLISSSAAVVT 64

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
            L  A  +   +  +W L    FG +F++++ +E+   ++    P    F   +F   G+
Sbjct: 65  ALTRARWKQWSRACAWYLTAIGFGAVFVVLKAFEYGRHLTTGLDPLAGEFFMYYFVFTGI 124

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           H LHV  GL+ L      +  +         L  + ++WH +D++W+ +FS +YL+
Sbjct: 125 HLLHVLIGLLGLGAAARSMRPRATRRYGVALLEGIGVYWHMVDVLWVVLFSLIYLI 180


>gi|116073482|ref|ZP_01470744.1| possible cytochrome c oxidase subunit III [Synechococcus sp.
           RS9916]
 gi|116068787|gb|EAU74539.1| possible cytochrome c oxidase subunit III [Synechococcus sp.
           RS9916]
          Length = 199

 Score = 77.8 bits (190), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 97/194 (50%), Gaps = 15/194 (7%)

Query: 21  KESCVDH-DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTI 79
            ++  DH D    G   +L++D + FA FF  Y          P  +   ++    ++T+
Sbjct: 14  TDTAHDHEDHRMFGVATFLVADAMTFAGFFAAYLTFHAVNPLEPGAVYELELPLPILNTV 73

Query: 80  VLLLSSLSCSFAMLASATKRLIHKTVS----WLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           +LL+SS     A    A ++L  +  S    WLL+TA  G+ F+  ++ E+    ++   
Sbjct: 74  LLLVSS-----ATFHKAGQKLRQRDNSGCRQWLLITAALGLAFLASQMVEY---FTLPFG 125

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQ--ILKKGLISGNQRRLICLSMFWHFL 193
              + F S+F+AL G HGLHV  G + + ++  Q  I    + + NQ  L  + ++WHF+
Sbjct: 126 LTDNLFASTFYALTGFHGLHVTLGALMILIVWWQCRIPSGRITADNQFPLEAVELYWHFV 185

Query: 194 DLIWICVFSFVYLM 207
           D IW+ +F  +YL+
Sbjct: 186 DGIWVVLFLILYLL 199


>gi|119476744|ref|ZP_01617054.1| probable cytochrome-C oxidase subunit III oxidoreductase protein
           [marine gamma proteobacterium HTCC2143]
 gi|119450000|gb|EAW31236.1| probable cytochrome-C oxidase subunit III oxidoreductase protein
           [marine gamma proteobacterium HTCC2143]
          Length = 224

 Score = 77.8 bits (190), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 103/189 (54%), Gaps = 20/189 (10%)

Query: 35  WIYLMSDCLMFAVFFVTYAVLGKNYAAGPAP--IDVF--DISG-------IFVSTIVLLL 83
           WI+L+SD  +F++F   Y  + +  A  P P   +VF   I+G       I + T VL+ 
Sbjct: 38  WIFLLSDTFIFSIFLTGYMNV-RMSATEPWPNTSEVFALTIAGQHIPLILIAIMTFVLIT 96

Query: 84  SSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP-----QR 138
           SS + + A +  A +    KT   ++ TA  G  F+ M+ +E++ LI     P       
Sbjct: 97  SSGTMALA-VNYAYQGDRKKTFLLMIATALLGASFVGMQAFEWSKLIHEGVRPWGNPMGA 155

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS-MFWHFLDLIW 197
           + F S+FF + G HG+HV  G+I+L ++  ++ +KG   G    ++ ++ ++WHF+DL+W
Sbjct: 156 TQFGSAFFMITGFHGIHVSAGVIYLSIIANRV-RKGHYEGKGYHIVEITGLYWHFVDLVW 214

Query: 198 ICVFSFVYL 206
           + +F+F YL
Sbjct: 215 VFIFAFFYL 223


>gi|296117509|ref|ZP_06836093.1| cytochrome c oxidase, subunit III [Corynebacterium ammoniagenes DSM
           20306]
 gi|295969240|gb|EFG82481.1| cytochrome c oxidase, subunit III [Corynebacterium ammoniagenes DSM
           20306]
          Length = 194

 Score = 77.8 bits (190), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 89/165 (53%), Gaps = 5/165 (3%)

Query: 44  MFAVFFVTYAV-LGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIH 102
           +FA++F + A   G ++A   A ++V    G  ++TI L+LSS++    +  SA +  ++
Sbjct: 33  LFAMWFTSRANGQGGDWAEQTAQLNV--PMGFLITTI-LILSSVTSQLGVF-SAERGDVY 88

Query: 103 KTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIW 162
           K   W  VT   G+IFI +  YE+  +I      Q S F S F+ L G H +HV  G++ 
Sbjct: 89  KLRVWYAVTIMLGLIFICIVGYEWYEMIHHGVTIQSSVFGSVFYILTGFHAIHVSAGIVA 148

Query: 163 LFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
             V++++  K           + +S +WHF+D+IWI VF  +YL+
Sbjct: 149 FIVIMMRTAKSKFTPAQATAAMAVSYYWHFVDVIWIGVFVVIYLV 193


>gi|224826584|ref|ZP_03699685.1| cytochrome c oxidase subunit III [Lutiella nitroferrum 2002]
 gi|224601185|gb|EEG07367.1| cytochrome c oxidase subunit III [Lutiella nitroferrum 2002]
          Length = 231

 Score = 77.8 bits (190), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 69/228 (30%), Positives = 108/228 (47%), Gaps = 25/228 (10%)

Query: 4   QKIGKSPNFSLFYVKDKKESCVDHDGTYLGF---------WIYLMSDCLMFAVFFVTY-A 53
           Q+    P   L      +   VD  G    F         W++L+SD  +F  F   Y  
Sbjct: 3   QRKSSPPEPPLTSAAGWQGVVVDWSGDREAFKVPWGKAMMWVFLLSDTFIFGGFLTGYMT 62

Query: 54  VLGKNYAAGPAPIDVF--DISG-----IFVSTIVLLLSSLSCSFAMLAS-ATKRLIHKTV 105
           V        P P +VF   I G     I ++ +  +L S S + AM  + A +R   K  
Sbjct: 63  VRISTTVPWPNPSEVFALTIGGTAVPLILIAIMTFILISSSGTMAMAVNFAYRRERVKCA 122

Query: 106 SWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS------AFLSSFFALVGLHGLHVFFG 159
           + +L TA  G  F+ ++ +E+ HLI  E V   S       F S+FF + G HGLHV  G
Sbjct: 123 ALMLATAALGACFVGLQAFEWTHLIVEEGVRPWSNPLGAPQFGSTFFMITGFHGLHVSAG 182

Query: 160 LIWLFVLVIQILK-KGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
           +I+L  + +++L  +   SGN + +    ++WHF+DL+W+ +F+F YL
Sbjct: 183 VIYLATVALKVLGGRYEKSGNYQIVEIAGLYWHFVDLVWVFIFAFFYL 230


>gi|317506584|ref|ZP_07964376.1| cytochrome c oxidase subunit 3 protein [Segniliparus rugosus ATCC
           BAA-974]
 gi|316255093|gb|EFV14371.1| cytochrome c oxidase subunit 3 protein [Segniliparus rugosus ATCC
           BAA-974]
          Length = 209

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 85/178 (47%), Gaps = 10/178 (5%)

Query: 36  IYLMSDCLMFAVFFVTYAVLGKNYAAG--------PAPIDVFDISGIFVSTIVLLLSSLS 87
           ++L S+ + FA  F  Y V     A          P P ++     I V+T VL+LSS +
Sbjct: 31  VWLSSELMFFAGLFAMYFVTRAGQAPALDGHKNWPPEPTELNLALAIPVTT-VLILSSFT 89

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
           C + + A A +  +     W  +T F G+ F+  + YE+ +L         SA+ S FF 
Sbjct: 90  CQWGVFA-AERGDVFGLRRWYTLTLFMGLFFVCGQGYEYFNLYREGTRLDSSAYGSVFFI 148

Query: 148 LVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
             G HGLHV  GL+   +L+ +              I +S +WHF+D++WI +F+ +Y
Sbjct: 149 TTGFHGLHVIGGLVAFVLLLARTKMSKFTPAQATSAIVVSYYWHFVDVVWIALFATIY 206


>gi|149909241|ref|ZP_01897898.1| putative cytochrome c oxidase subunit III [Moritella sp. PE36]
 gi|149807765|gb|EDM67711.1| putative cytochrome c oxidase subunit III [Moritella sp. PE36]
          Length = 225

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 96/187 (51%), Gaps = 15/187 (8%)

Query: 35  WIYLMSDCLMFAVFFVTY-AVLGKNYAAGPAPIDVF--DISG-----IFVSTIVLLLSSL 86
           W +L+SD  +F +F   Y +V      A P   DVF   I+G     + ++ +  +L + 
Sbjct: 38  WAFLLSDTFIFGIFLTAYMSVRMSAVDAWPNSSDVFALTIAGEHVPLVLIAIMTFILITS 97

Query: 87  SCSFAMLASATKRLIHKTVSWLL-VTAFFGMIFIIMEIYEFAHLISMEAVPQRS------ 139
           S + A+  +   +   +  S L+ +TA FG+ F+ M+ +E++ LI  E V   S      
Sbjct: 98  SGTMALAVNFAYQGEKRKASLLIFITALFGISFVGMQAFEWSKLIFEEGVRPWSNPLGAA 157

Query: 140 AFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWIC 199
            F ++FF + G HGLHV  G+I+L V+  ++            +    ++WHF+DL+W+ 
Sbjct: 158 QFGATFFMITGFHGLHVSVGVIYLLVVAKRVHAGDYDKKGYHMVEIAGLYWHFVDLVWVF 217

Query: 200 VFSFVYL 206
           +F+F YL
Sbjct: 218 IFAFFYL 224


>gi|75910498|ref|YP_324794.1| cytochrome c oxidase subunit III [Anabaena variabilis ATCC 29413]
 gi|75704223|gb|ABA23899.1| cytochrome c oxidase subunit III [Anabaena variabilis ATCC 29413]
          Length = 204

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/187 (29%), Positives = 95/187 (50%), Gaps = 6/187 (3%)

Query: 22  ESCVDHDGTYL-GFWIYLMSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVFDISGIFVSTI 79
           E   D +G  + GF ++L+S+ ++F  FF  Y V         P  ++  ++    ++T+
Sbjct: 20  EHSHDEEGNKMFGFIVFLLSESVIFLSFFAGYIVYKTTTPNWLPVGVEGLEVKDPAINTV 79

Query: 80  VLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS 139
           VL+ SS    FA LA   K L    + +L  T   G  F++ +  E++HL   E      
Sbjct: 80  VLVASSFVIYFAELALKRKNLRLFRI-FLSATMAMGSYFLVGQAIEWSHL---EFGFTSG 135

Query: 140 AFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWIC 199
            +   F+ L G HGLHVF G++  F+++++ L  G        +   S+FWHF+D+IWI 
Sbjct: 136 VYGGMFYLLTGFHGLHVFTGILLQFIILVRSLIPGNYDTGHFGVNATSLFWHFVDVIWII 195

Query: 200 VFSFVYL 206
           +F  +Y+
Sbjct: 196 LFILIYI 202


>gi|167622196|ref|YP_001672490.1| cytochrome c oxidase subunit III [Shewanella halifaxensis HAW-EB4]
 gi|167352218|gb|ABZ74831.1| cytochrome c oxidase subunit III [Shewanella halifaxensis HAW-EB4]
          Length = 293

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 73/132 (55%), Gaps = 2/132 (1%)

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
           +T++LL SS++  FA L     +    TV WL +T   G+ F+ +++ E+ H      + 
Sbjct: 163 NTLILLTSSITLHFAHLGLEKNKRSALTV-WLAITILLGVAFLYLQVEEYLHAYQEMGLT 221

Query: 137 QRSA-FLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
             S  + ++FF L G HG+HV  G ++L VL  ++LK              S +WHF+D+
Sbjct: 222 LNSGIYGNTFFLLTGFHGMHVTLGTVFLIVLFFRVLKGHFTPDKHFAFQAGSWYWHFVDV 281

Query: 196 IWICVFSFVYLM 207
           +W+C+F FVY++
Sbjct: 282 VWLCLFIFVYVL 293


>gi|148273015|ref|YP_001222576.1| putative cytochrome c oxidase subunit III [Clavibacter
           michiganensis subsp. michiganensis NCPPB 382]
 gi|147830945|emb|CAN01889.1| putative cytochrome c oxidase subunit III [Clavibacter
           michiganensis subsp. michiganensis NCPPB 382]
          Length = 209

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 94/184 (51%), Gaps = 14/184 (7%)

Query: 36  IYLMSDCLMFAVFFVTYAVLGKNYAA-GPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLA 94
           ++L S+ + FA  F  Y  L     A         ++    V+T++L+ SS +C F + A
Sbjct: 27  VWLGSEVMFFAGLFAIYFTLRSTSGALWEFEAGRLNVPFSLVNTLILVSSSFTCQFGVFA 86

Query: 95  SATKRLIHK----------TVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSS 144
           +  +RL  +          TV W  +T   G IF++ +I+E+A L++       +A+ S+
Sbjct: 87  A--ERLQARATGWKPSQWGTVEWFFLTYALGAIFVVGQIFEYATLVTEGITLSSNAYGSA 144

Query: 145 FFALVGLHGLHVFFGLIWLFVLVIQILK-KGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           F+   G HGLHV  GLI   +++ +I   + +        I +S +WHF+D++WI +F  
Sbjct: 145 FYMTTGFHGLHVTGGLIAFLLVIGRIFAVRSMGHREATSAIVVSYYWHFVDVVWIGLFLV 204

Query: 204 VYLM 207
           +Y++
Sbjct: 205 IYVL 208


>gi|300934171|ref|ZP_07149427.1| cytochrome c oxidase subunit III [Corynebacterium resistens DSM
           45100]
          Length = 194

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 86/164 (52%), Gaps = 4/164 (2%)

Query: 44  MFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHK 103
           +FA++FV+ A  G ++ + P  ++V   + I   TI+L+ SS +  + + A A +  +  
Sbjct: 34  LFAMYFVSKANSGGDWPSHPTELNVPFAATI---TIILVSSSFTAQWGVFA-AERGDVFA 89

Query: 104 TVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWL 163
              W  ++A  G +F+I + YE+ HL+        S + S FF   G HG HV  G++  
Sbjct: 90  LRRWYALSALLGTVFLIGQGYEYFHLVQHGTTIPGSVYGSVFFITTGFHGAHVLAGVLAF 149

Query: 164 FVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
            V++++  K           + +S +WHF+D++WI ++  +Y +
Sbjct: 150 VVVLLRTFKSKFTPAQATAAVVVSYYWHFVDVVWIGLWITIYFI 193


>gi|159901868|gb|ABX10602.1| cytochrome c oxidase subunit I [uncultured planctomycete 6N14]
          Length = 754

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 93/198 (46%), Gaps = 15/198 (7%)

Query: 18  KDKKESCVDH----DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISG 73
             K+++  D     D      W ++ S+ + F +  V Y V   N         V D++ 
Sbjct: 559 SQKEQTPADSGWRPDKAITSVWAFVASEAVFFLLLLVAYVVFNTNLVGEITSASVLDVTR 618

Query: 74  IFVSTIVLLLSSLSC--SFAMLAS---ATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAH 128
               ++ LL SS +   + A L S   A  RL      WL +T   G IFI  +  E+  
Sbjct: 619 TAFFSVALLGSSFTLWKAEAFLKSGKFAQFRL------WLALTITLGAIFIGGQAIEYYG 672

Query: 129 LISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSM 188
           LIS +     + F ++FF + G HGLHV  GLI L ++ +  +K+     +   L  + +
Sbjct: 673 LISSDVTISDNLFTATFFTVTGFHGLHVIVGLIALSIVFVLAVKQDRNVLHGSALKAIGI 732

Query: 189 FWHFLDLIWICVFSFVYL 206
           +WHF+D++WI VF  +YL
Sbjct: 733 YWHFVDVVWIAVFCIIYL 750


>gi|22299552|ref|NP_682799.1| cytochrome c oxidase subunit III [Thermosynechococcus elongatus
           BP-1]
 gi|22295735|dbj|BAC09561.1| cytochrome c oxidase subunit III [Thermosynechococcus elongatus
           BP-1]
          Length = 201

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 99/190 (52%), Gaps = 10/190 (5%)

Query: 24  CVDH-----DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
            VDH     D   LG  ++L+S+ LMF   F  Y +L   +   P      ++    ++T
Sbjct: 13  AVDHAHEHPDFRVLGLLVFLISESLMFGGLFAAYLLLRGMHEQWPPEGTEVELLVPTINT 72

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           ++L+ SS    +  +A   K  +     W  +TA  G +F+  ++YE+   +++    + 
Sbjct: 73  LILISSSFVIHYGDVA-IKKDDVRGMRKWYWITAAMGAVFLGGQVYEY---LTLGYGLRT 128

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS-MFWHFLDLIW 197
           + F + F+ + G HGLHVF G++ +  ++ +  + G  +  +   + ++ ++WHF+D+IW
Sbjct: 129 NVFANCFYVMTGFHGLHVFIGILLILGVIWRSRRPGHYNAQKHTGVAMAEIYWHFVDVIW 188

Query: 198 ICVFSFVYLM 207
           I +F+ +Y++
Sbjct: 189 IILFTLLYIL 198


>gi|146294867|ref|YP_001185291.1| cytochrome c oxidase subunit III [Shewanella putrefaciens CN-32]
 gi|145566557|gb|ABP77492.1| cytochrome c oxidase, subunit III [Shewanella putrefaciens CN-32]
          Length = 291

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 77/133 (57%), Gaps = 2/133 (1%)

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           ++T++LL+SS++  FA + S  K      V WL +T   G+ F+ +++ E+ H      +
Sbjct: 160 INTLILLISSVTLHFAHI-SLEKAKRSAVVLWLGITILLGIGFVGLQVEEYRHAYQEMGL 218

Query: 136 PQRSA-FLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
              S  + ++FF L G HG+HV  G ++L VL I++LK    +         S +WHF+D
Sbjct: 219 TLTSGIYGNTFFLLTGFHGMHVTLGTVFLVVLFIRVLKGHFTADKHFAFQAGSWYWHFVD 278

Query: 195 LIWICVFSFVYLM 207
           ++W+C+F FVY++
Sbjct: 279 VVWLCLFIFVYVL 291


>gi|124025209|ref|YP_001014325.1| cytochrome c oxidase, subunit III [Prochlorococcus marinus str.
           NATL1A]
 gi|123960277|gb|ABM75060.1| Cytochrome c oxidase, subunit III [Prochlorococcus marinus str.
           NATL1A]
          Length = 201

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 94/194 (48%), Gaps = 10/194 (5%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
           K++  +    D    G   +L++D + FA FF  Y         GP  I   ++    ++
Sbjct: 14  KNELSAEEHEDFRLFGLIAFLIADGMTFAGFFAAYLTFKAVNPIGPDAIYELELPLPTLN 73

Query: 78  TIVLLLSSLSCSFA--MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           TI+LL+SS +   A   L     +   K   WLL+T   G+ F+I +++E+    ++   
Sbjct: 74  TILLLISSFTFHRAGKFLEKNESKQCQK---WLLITGVLGVAFLISQMFEY---FTLPFG 127

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLI--CLSMFWHFL 193
              + F S+F+AL G HGLHV  G I + ++  Q         NQ +     + ++WHF+
Sbjct: 128 LTDNLFASTFYALTGFHGLHVTLGSIMIMIIWWQTRVPSGRVNNQNKFPFEAVELYWHFV 187

Query: 194 DLIWICVFSFVYLM 207
           D IW+ +F  +YL+
Sbjct: 188 DGIWVVLFIILYLL 201


>gi|1706077|sp|P50677|COX3_THEVL RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome aa3 subunit 3; AltName: Full=Cytochrome
           c oxidase polypeptide III; AltName: Full=Oxidase aa(3)
           subunit 3
 gi|457676|dbj|BAA41042.1| cytochrome c oxidase subunit III [Thermosynechococcus vulcanus]
          Length = 201

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 99/190 (52%), Gaps = 10/190 (5%)

Query: 24  CVDH-----DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
            VDH     D   LG  ++L+S+ LMF   F  Y +L   +   P      ++    ++T
Sbjct: 13  AVDHAHEHPDFRVLGLLVFLISESLMFGGLFAAYLLLRGMHEQWPPEGTEVELFVPTINT 72

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           ++L+ SS    +  +A   K  +     W  +TA  G +F+  ++YE+   +++    + 
Sbjct: 73  LILISSSFVIHYGDVA-IKKDDVRGMRKWYWITAAMGAVFLGGQVYEY---LTLGYGLRT 128

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS-MFWHFLDLIW 197
           + F + F+ + G HGLHVF G++ +  ++ +  + G  +  +   + ++ ++WHF+D+IW
Sbjct: 129 NVFANCFYVMTGFHGLHVFIGILLILGVIWRSRRPGHYNAQKHTGVAMAEIYWHFVDVIW 188

Query: 198 ICVFSFVYLM 207
           I +F+ +Y++
Sbjct: 189 IILFTLLYIL 198


>gi|269956796|ref|YP_003326585.1| cytochrome c oxidase subunit III [Xylanimonas cellulosilytica DSM
           15894]
 gi|269305477|gb|ACZ31027.1| cytochrome c oxidase subunit III [Xylanimonas cellulosilytica DSM
           15894]
          Length = 218

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 94/189 (49%), Gaps = 13/189 (6%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGK--NYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           +G  ++L S+ + FA  F  Y  +    + A   +  ++ ++    ++T +L+LSS +C 
Sbjct: 29  VGTIVWLASELMFFAGLFAMYFTVRSVMDPAEWASQTEMLNVRFALLNTTILVLSSATCQ 88

Query: 90  FAMLASA------TKRLIHKTV----SWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS 139
             +LA+       T RL+  +      W  +T   G  FI  +++E+A L+        S
Sbjct: 89  MGVLAAERFKPVRTGRLLQVSQWGMHEWTTLTYLMGAFFIGGQVFEYAALVEEGLTISSS 148

Query: 140 AFLSSFFALVGLHGLHVFFGLI-WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           A+ S F+   G HGLHV  GLI +LF+L      K          I  S +WHF+D++WI
Sbjct: 149 AYGSVFYLTTGFHGLHVVGGLIAFLFLLGRSFAAKRFGHHEATTAIVTSYYWHFVDVVWI 208

Query: 199 CVFSFVYLM 207
            +F+ +YL+
Sbjct: 209 ALFAVIYLL 217


>gi|170781130|ref|YP_001709462.1| cytochrome c oxidase polypeptide III [Clavibacter michiganensis
           subsp. sepedonicus]
 gi|169155698|emb|CAQ00818.1| probable cytochrome c oxidase polypeptide III [Clavibacter
           michiganensis subsp. sepedonicus]
          Length = 212

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 94/184 (51%), Gaps = 14/184 (7%)

Query: 36  IYLMSDCLMFAVFFVTYAVLGKNYAA-GPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLA 94
           ++L S+ + FA  F  Y  L     A         ++    V+T++L+ SS +C F + A
Sbjct: 30  VWLGSEVMFFAGLFAIYFTLRSTSGALWEFEAGRLNVPFSLVNTLILVSSSFTCQFGVFA 89

Query: 95  SATKRLIHK----------TVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSS 144
           +  +RL  +          TV W  +T   G IF++ +I+E+A L++       +A+ S+
Sbjct: 90  A--ERLQARATGWKPSQWGTVEWFFLTYALGAIFVVGQIFEYATLVTEGITLSSNAYGSA 147

Query: 145 FFALVGLHGLHVFFGLIWLFVLVIQILK-KGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           F+   G HGLHV  GLI   +++ +I   + +        I +S +WHF+D++WI +F  
Sbjct: 148 FYMTTGFHGLHVTGGLIAFLLVIGRIFAVRSMGHREATSAIVVSYYWHFVDVVWIGLFLV 207

Query: 204 VYLM 207
           +Y++
Sbjct: 208 IYVL 211


>gi|73538265|ref|YP_298632.1| cytochrome c oxidase, subunit III [Ralstonia eutropha JMP134]
 gi|72121602|gb|AAZ63788.1| cytochrome c oxidase, subunit III [Ralstonia eutropha JMP134]
          Length = 209

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 101/189 (53%), Gaps = 11/189 (5%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYA-VLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSC 88
           + LG W++L ++ + F   F+ Y  V   +  A P      D+    ++T+VL+ SSL  
Sbjct: 18  SRLGMWVFLGTELMFFGPLFMGYYFVRATDPVALPLAARQTDLLLGSLNTLVLMTSSLGM 77

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA-------- 140
           + A+ A+   R     V  L  T+  G++F++++ +E+A  I+   VP  ++        
Sbjct: 78  AMAVSAANEDRR-RAAVRCLWATSALGLVFLLIKGWEYAKDIASGFVPGNASGAGGPTGQ 136

Query: 141 -FLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWIC 199
            F   +FA+ GLH +H+  G+  + V  + + ++  ++ +  RL  + ++WHF+D+IW+ 
Sbjct: 137 MFRLLYFAMTGLHAIHLCIGIGLVVVFALAMRQRRPLAVDPGRLEIVGLYWHFVDIIWLF 196

Query: 200 VFSFVYLMG 208
           +F+ +YL G
Sbjct: 197 LFALLYLPG 205


>gi|332670689|ref|YP_004453697.1| cytochrome-c oxidase [Cellulomonas fimi ATCC 484]
 gi|332339727|gb|AEE46310.1| Cytochrome-c oxidase [Cellulomonas fimi ATCC 484]
          Length = 208

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 93/187 (49%), Gaps = 18/187 (9%)

Query: 36  IYLMSDCL----MFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           ++L S+ +    +FA++F   A + + +A         +++  F++T VL+LSS++C   
Sbjct: 24  VWLASELMFFAGLFAMYFTLRAAVPEEWAE---QTQKLNLTFAFINTTVLVLSSVTCQMG 80

Query: 92  MLASATKRLIHKTV----------SWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAF 141
           + A+   + +               W+++T   G  FI  ++YE+A L+        S +
Sbjct: 81  VWAAERFQPVRTGSLLQVNRWGMNEWMVLTYLMGAFFIGGQVYEYAELVEHGLTISSSPY 140

Query: 142 LSSFFALVGLHGLHVFFGLI-WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICV 200
            S F+   G HGLHV  GLI +LF+L      K          I  S +WHF+D++WI +
Sbjct: 141 GSVFYLTTGFHGLHVVGGLIAFLFLLGRSFSAKRFGHHEATTAIVTSYYWHFVDVVWIAL 200

Query: 201 FSFVYLM 207
           F+ +YL+
Sbjct: 201 FAVIYLL 207


>gi|311696665|gb|ADP99538.1| cytochrome c oxidase subunit III [marine bacterium HP15]
          Length = 295

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 81/148 (54%), Gaps = 5/148 (3%)

Query: 63  PAPIDVFDISGI-FVSTIVLLLSSLSCSFAMLA-SATKRLIHKTVSWLLVTAFFGMIFII 120
           P P +V    G+  ++TI+L+ SS + + A  A  A  R   KT  WL +T    ++F+ 
Sbjct: 150 PGPKEVISAWGLPLMNTILLVTSSFTVTVAHHALKAGNRA--KTKLWLALTIALAIVFVF 207

Query: 121 MEIYEFAHLIS-MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGN 179
           ++ YE+ H    ++   Q   + S+FF L G HG HV  G + L +++I+I K    + N
Sbjct: 208 VQGYEYMHAYQDLDLTLQSGIYGSTFFMLTGFHGAHVILGSLMLIIMLIRINKGHFTADN 267

Query: 180 QRRLICLSMFWHFLDLIWICVFSFVYLM 207
                  + +WHF+D++W+ +F FVY++
Sbjct: 268 HFGFEAAAWYWHFVDVVWLGLFVFVYIL 295


>gi|330469375|ref|YP_004407118.1| cytochrome-c oxidase [Verrucosispora maris AB-18-032]
 gi|328812346|gb|AEB46518.1| cytochrome-c oxidase [Verrucosispora maris AB-18-032]
          Length = 180

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 84/174 (48%), Gaps = 8/174 (4%)

Query: 36  IYLMSDCLMFAVFFVTYAVLGKNYAAGPAPID----VFDISGIFVSTIVLLLSSLSCSFA 91
           ++L S+ + FA  F  Y  +    AA P   +    V ++      T++L+LSS++C   
Sbjct: 8   VWLSSELMFFAALFAMYFSI---RAAAPEQWEKHTAVLNVPYATTFTLILVLSSITCQIG 64

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           + A A +  +H    W  +T   G+IF++ +  E+  L+          + S F+   G 
Sbjct: 65  VFA-AERGDVHALRRWFTITFVMGLIFVMGQANEYRELVHHGIKINEDGYGSMFYLTTGF 123

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
           HGLHV  GLI   + +I+              I +S +WHF+D++WI +++ +Y
Sbjct: 124 HGLHVIGGLIAFVIFMIRTTMGRFTPAQATSAIVVSYYWHFVDVVWIGLYAMIY 177


>gi|308049752|ref|YP_003913318.1| cytochrome C oxidase subunit III [Ferrimonas balearica DSM 9799]
 gi|307631942|gb|ADN76244.1| cytochrome c oxidase subunit III [Ferrimonas balearica DSM 9799]
          Length = 219

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/191 (30%), Positives = 100/191 (52%), Gaps = 23/191 (12%)

Query: 35  WIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI--DVF--DISG-------IFVSTIVLLL 83
           WI+L+SD  +F  F V Y  + +  A  P P+  +VF   I+G       I + T +L+ 
Sbjct: 32  WIFLLSDTFIFGTFLVGYMTV-RMSAVEPWPVADEVFALTIAGHTIPLVLIAIMTFILIT 90

Query: 84  SSLSCSFAM-LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP-----Q 137
           SS + + A+       R +  T+ W  VTA  G  F+ M+ +E++ LI     P      
Sbjct: 91  SSGTMALAVNYGYRRNRKVAATLMW--VTAILGASFVGMQAFEWSKLIEEGVRPWGNPLG 148

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLICLSMFWHFLDL 195
            + F ++F+ + G HGLHV  G++ L V+    + +G    SG+   +  + ++WHF+DL
Sbjct: 149 AAQFGAAFYMITGFHGLHVSIGVL-LLVIYAHKVGRGDYEASGDYGIVETVGLYWHFVDL 207

Query: 196 IWICVFSFVYL 206
           +W+ +F+F YL
Sbjct: 208 VWVFIFAFFYL 218


>gi|239940634|ref|ZP_04692571.1| putative cytochrome c oxidase subunit III [Streptomyces roseosporus
           NRRL 15998]
 gi|239987116|ref|ZP_04707780.1| putative cytochrome c oxidase subunit III [Streptomyces roseosporus
           NRRL 11379]
          Length = 169

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 87/166 (52%), Gaps = 5/166 (3%)

Query: 44  MFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHK 103
           +FA++F   +V+G +Y    +    F  S    +T +L+LSSL+C   + A A +  + K
Sbjct: 6   LFAMYFTLRSVMGPDYWKEMSDHLNFPFSA--TNTTILVLSSLTCQLGVFA-AERGDVKK 62

Query: 104 TVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS-AFLSSFFALVGLHGLHVFFGLI- 161
             +W ++T   G IFI  ++ E+  L+    +   S  + S F+   G HGLHV  GLI 
Sbjct: 63  LRTWFIITFVMGAIFIGGQVLEYTELVKDAGLSLSSDPYGSVFYLTTGFHGLHVTGGLIA 122

Query: 162 WLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           +L VL      K          I +S +WHF+D++WI +F+ +Y++
Sbjct: 123 FLLVLGRTYAAKRFTHDQATAAIVVSYYWHFVDVVWIGLFATIYMI 168


>gi|213646953|ref|ZP_03377006.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhi str. J185]
          Length = 116

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 56/90 (62%), Gaps = 1/90 (1%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW+YLMSDC++F++ F TYAVL    A GP   D+F++  + V T +LL SS++   A 
Sbjct: 28  GFWVYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAA 87

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIME 122
           +A   K    + +SWL +T  FG  FI ME
Sbjct: 88  IA-MHKNNKSQVISWLALTFLFGAGFIGME 116


>gi|260906796|ref|ZP_05915118.1| cytochrome c oxidase subunit III [Brevibacterium linens BL2]
          Length = 189

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 88/189 (46%), Gaps = 14/189 (7%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAA-GPAPIDVFDISGIFVSTIVLLLSSLSCSF 90
           +GF ++L SD + FA  F  Y  +            +V DI     +T++L+ SS +C  
Sbjct: 1   MGFIVFLASDLMFFAALFAMYFTIRSVVPELWETQTEVLDIPYALGNTLILVSSSFTCQL 60

Query: 91  AMLASATKRLIHKT----------VSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA 140
            + A+   R               V W  +T   G +F+  ++ E+A L+S         
Sbjct: 61  GVFAAEKFRPRRTGSLFNVAKWGMVEWFYLTFLLGAVFVSGQVMEYATLVSEGIAINSDG 120

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRL--ICLSMFWHFLDLIWI 198
           + S F+   G HG+HV  GLI  F+LVI         G+      IC+S +WHF+D++W+
Sbjct: 121 YGSVFYLTTGFHGIHVTIGLI-CFLLVIGRAYGAKKFGHHDATFAICVSYYWHFVDVVWV 179

Query: 199 CVFSFVYLM 207
            +F  +YL+
Sbjct: 180 GLFGVIYLL 188


>gi|121608358|ref|YP_996165.1| cytochrome c oxidase subunit III [Verminephrobacter eiseniae
           EF01-2]
 gi|121552998|gb|ABM57147.1| cytochrome c oxidase, subunit III [Verminephrobacter eiseniae
           EF01-2]
          Length = 293

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 92/176 (52%), Gaps = 9/176 (5%)

Query: 39  MSDCLMFAVFFVTYAVLGKNYAAGPAPI-DVFDISGIF----VSTIVLLLSSLSCSFAML 93
           + + +++  F   +  +     A PA I + F   G F    ++T +LL S ++ + A  
Sbjct: 120 LDNAMLWPDFKAVWPSMAAGATASPAGIVEPFQTVGPFWLPTINTALLLSSGVTLTIAHH 179

Query: 94  A-SATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA-FLSSFFALVGL 151
           A  A +R   KT+ ++ VT   G+ F++++ YE+ HL +   +   S  F S+FF L G 
Sbjct: 180 ALRANQRA--KTIGFMWVTVLLGLTFLLVQGYEYTHLYTDLNLKLSSGVFGSTFFMLTGF 237

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           HG HVF G++ L V+ +++ K    +         + +WHF+D++W+ ++  VY M
Sbjct: 238 HGFHVFMGMLMLLVITLRLQKGHFTADKHFGFEGAAWYWHFVDVVWLGLYVLVYWM 293


>gi|108763194|ref|YP_634223.1| cytochrome c oxidase subunit III [Myxococcus xanthus DK 1622]
 gi|108467074|gb|ABF92259.1| cytochrome c oxidase, subunit III [Myxococcus xanthus DK 1622]
          Length = 222

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 102/202 (50%), Gaps = 25/202 (12%)

Query: 25  VDHDGTYLGFWIYLMSDCLMFAVFFVTYAV----LGKNYAAGPAPIDVFDISGIFVSTIV 80
           V +    LG W++L ++ L+FA  F+ Y V      + +AA    +D+   +   V+T+V
Sbjct: 27  VQNHAARLGMWLFLATEILLFAGLFICYGVYRFLFPEAWAAASRSLDLTLGT---VNTVV 83

Query: 81  LLLSSLSCSFAM--LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           L+ SSL+ + A+        +++   +   LV A   + F++++ +E+ H   +  +P R
Sbjct: 84  LITSSLTAALAVHYAKEGKNKMVAVQIGLTLVMA---VGFLVIKYFEYHHKFEIGTLPGR 140

Query: 139 ------------SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
                         + + +F    LHG+HV  G+I L   +++ LKK     N   ++ L
Sbjct: 141 FYSYEGIQLPGVPLYFTVYFCATALHGIHVVIGMIVLAFSMVRALKKADFGPNNYTMVEL 200

Query: 187 -SMFWHFLDLIWICVFSFVYLM 207
            SM+WH +DL+WI +F  +YL+
Sbjct: 201 GSMYWHLVDLVWIFLFPMLYLV 222


>gi|331005434|ref|ZP_08328813.1| Cytochrome c oxidase polypeptide III [gamma proteobacterium
           IMCC1989]
 gi|330420710|gb|EGG94997.1| Cytochrome c oxidase polypeptide III [gamma proteobacterium
           IMCC1989]
          Length = 302

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 76/136 (55%), Gaps = 4/136 (2%)

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVS-WLLVTAFFGMIFIIMEIYEFAHLISME 133
           F +T VLL SS++    M  +A K   HK  + WL VT   GM F+ ++I E++H   + 
Sbjct: 169 FWNTAVLLTSSVTVH--MAHTALKNANHKLFNIWLGVTVLLGMFFVALQIAEYSHAYEVG 226

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ-RRLICLSMFWHF 192
              +  A+ ++FF L G HG HV  G   L V+ ++ + KG  + +        S +WHF
Sbjct: 227 LTLETGAYGTTFFMLTGFHGAHVTIGTFMLLVMWLRSVMKGHFTHDDCFGFESASWYWHF 286

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ +F FVY++G
Sbjct: 287 VDV