PSIBLAST alignment of GI: 254780472 and protein with PDB id: 1fft

gi|11514519|pdb|1FFT|C Chain C, The Structure Of Ubiquinol Oxidase From Escherichia Coli Length = 204
>gi|11514523|pdb|1FFT|H Chain H, The Structure Of Ubiquinol Oxidase From Escherichia Coli Length = 204
 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 100/204 (49%), Positives = 132/204 (64%), Gaps = 2/204 (0%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTY-LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI 66
            +   +       +    D  GT   GFWIYLMSDC++F++ F TYAVL    A GP   
Sbjct: 2   ATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGK 61

Query: 67  DVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEF 126
           D+F++  + V T +LL SS++   A +A   K    + +SWL +T  FG  FI MEIYEF
Sbjct: 62  DIFELPFVLVETFLLLFSSITYGMAAIA-MYKNNKSQVISWLALTWLFGAGFIGMEIYEF 120

Query: 127 AHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
            HLI     P RS FLS+FFALVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CL
Sbjct: 121 HHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCL 180

Query: 187 SMFWHFLDLIWICVFSFVYLMGVV 210
           S+FWHFLD++WICVF+ VYLMG +
Sbjct: 181 SLFWHFLDVVWICVFTVVYLMGAM 204