PSIBLAST alignment of GI: 254780472 and protein with PDB id: 1m56

gi|23200456|pdb|1M56|C Chain C, Structure Of Cytochrome C Oxidase From Rhodobactor Sphaeroides (Wild Type) Length = 266
>gi|23200460|pdb|1M56|I Chain I, Structure Of Cytochrome C Oxidase From Rhodobactor Sphaeroides (Wild Type) Length = 266
 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 45/201 (22%), Positives = 90/201 (44%), Gaps = 14/201 (6%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT---YAVLGKNYAAG-------PAPIDV 68
           +   + V   G   GF +++MS+ + F+ +F +   +A+      +        P  I  
Sbjct: 68  EGDHTPVVRLGLRWGFILFIMSEVMFFSAWFWSFFKHALYPMGPESPIIDGIFPPEGIIT 127

Query: 69  FDIS-GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
           FD      ++T++LL S  + ++A  A   +         L +    G +F + + YE++
Sbjct: 128 FDPWHLPLINTLILLCSGCAATWAHHALVHENNRRDVAWGLALAIALGALFTVFQAYEYS 187

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
           H          + + ++FF   G HG HV  G I+L V +I++ +               
Sbjct: 188 H---AAFGFAGNIYGANFFMATGFHGFHVIVGTIFLLVCLIRVQRGHFTPEKHVGFEAAI 244

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ +F+ +Y+ G
Sbjct: 245 WYWHFVDVVWLFLFASIYIWG 265