BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780472|ref|YP_003064885.1| cytochrome o ubiquinol oxidase
subunit III [Candidatus Liberibacter asiaticus str. psy62]
         (210 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780472|ref|YP_003064885.1| cytochrome o ubiquinol oxidase subunit III [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040149|gb|ACT56945.1| cytochrome o ubiquinol oxidase subunit III [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 210

 Score =  165 bits (418), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 210/210 (100%), Positives = 210/210 (100%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA
Sbjct: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
           AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII
Sbjct: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ
Sbjct: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RRLICLSMFWHFLDLIWICVFSFVYLMGVV
Sbjct: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210


>gi|239817018|ref|YP_002945928.1| cytochrome o ubiquinol oxidase subunit III [Variovorax paradoxus
           S110]
 gi|239803595|gb|ACS20662.1| cytochrome o ubiquinol oxidase, subunit III [Variovorax paradoxus
           S110]
          Length = 221

 Score =  155 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 117/207 (56%), Positives = 150/207 (72%), Gaps = 4/207 (1%)

Query: 4   QKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGP 63
              GK P F LF+V +        +GT LGFW+YLMSDCL+FA  F  Y VLG++YAAGP
Sbjct: 18  DATGKPPVFELFHVGNDHHPE---NGTLLGFWLYLMSDCLVFACLFAVYGVLGRSYAAGP 74

Query: 64  APIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEI 123
           +  D+FD+  + V+T +LLLSS++  FA+L    KR+   T++WL +T   G  FI +E+
Sbjct: 75  SGADLFDLPLVAVNTSLLLLSSITYGFAVLEMQRKRM-GGTLAWLAITGLLGAGFIGLEL 133

Query: 124 YEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRL 183
           YEFAHLI   A PQRSAFLSSFFALVG HGLHV FG++WL VL+IQ+ K G  + N+RRL
Sbjct: 134 YEFAHLIHEGAGPQRSAFLSSFFALVGTHGLHVTFGIVWLIVLMIQLPKHGFTAANRRRL 193

Query: 184 ICLSMFWHFLDLIWICVFSFVYLMGVV 210
           +CLSMFWHFLD++WI VF+FVYLMG +
Sbjct: 194 MCLSMFWHFLDVVWIGVFTFVYLMGSM 220


>gi|319795347|ref|YP_004156987.1| cytochrome o ubiquinol oxidase, subunit iii [Variovorax paradoxus
           EPS]
 gi|315597810|gb|ADU38876.1| cytochrome o ubiquinol oxidase, subunit III [Variovorax paradoxus
           EPS]
          Length = 221

 Score =  154 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 116/207 (56%), Positives = 149/207 (71%), Gaps = 4/207 (1%)

Query: 4   QKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGP 63
            + GK P F LF+V +        +GT LGFW+YLMSDCL+FA  F  Y VLG++YAAGP
Sbjct: 18  DQTGKPPVFELFHVGNDHHPE---NGTLLGFWLYLMSDCLIFACLFAVYGVLGRSYAAGP 74

Query: 64  APIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEI 123
           +  D+FD+  + ++T +LLLSS++  FAML    KR+    + WL +T   G  FI +E+
Sbjct: 75  SGADLFDLPLVAINTSLLLLSSITYGFAMLEMQKKRM-GGVLVWLAITGLLGAGFIGLEL 133

Query: 124 YEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRL 183
           YEFAHL+   A PQRSAFLSSFFALVG HGLHV FG+IWL VL+IQ+ K G  + N+RRL
Sbjct: 134 YEFAHLLHEGAGPQRSAFLSSFFALVGTHGLHVSFGIIWLIVLMIQLPKHGFTAANRRRL 193

Query: 184 ICLSMFWHFLDLIWICVFSFVYLMGVV 210
           +CLSMFWHFLD++WI VF+FVYLMG +
Sbjct: 194 MCLSMFWHFLDVVWIGVFTFVYLMGSM 220


>gi|116694972|ref|YP_729183.1| bo3-type chinol oxidase, subunit III [Ralstonia eutropha H16]
 gi|113529471|emb|CAJ95818.1| bo3-type chinol oxidase, subunit III [Ralstonia eutropha H16]
          Length = 218

 Score =  152 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 108/207 (52%), Positives = 142/207 (68%), Gaps = 4/207 (1%)

Query: 4   QKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGP 63
                 P    FY+ +        +GT LGFW+YLMSDCL+FA  F  Y VLG+ YA GP
Sbjct: 15  TADAAPPGGYQFYLPEDHHP---QNGTLLGFWLYLMSDCLIFACLFAAYGVLGREYAGGP 71

Query: 64  APIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEI 123
           +  ++F++  + ++T  LLLSS++  FAML    +  I  T  WL +T  FG  F+ +E+
Sbjct: 72  SGAELFELPLVALNTSFLLLSSITYGFAMLQMQ-QNRIAGTQIWLAITGVFGAGFLAVEL 130

Query: 124 YEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRL 183
           YEFAHLI+  A PQRSAFL+SFFALVG HGLHV  G+IWL VL+ Q+ + GLI+ N+RRL
Sbjct: 131 YEFAHLINEGAGPQRSAFLTSFFALVGTHGLHVTCGIIWLVVLMTQVAQHGLITANKRRL 190

Query: 184 ICLSMFWHFLDLIWICVFSFVYLMGVV 210
           +CLSMFWHFLD++WI VF+FVYLMG +
Sbjct: 191 MCLSMFWHFLDVVWIGVFTFVYLMGAL 217


>gi|323257871|gb|EGA41550.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008283]
          Length = 276

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 94/194 (48%), Positives = 126/194 (64%), Gaps = 2/194 (1%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF 75
           +  +             GFW+YLMSDC++F++ F TYAVL    A GP   D+F++  + 
Sbjct: 12  HAHEHGHHDAGQ-NKIFGFWVYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVL 70

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           V T +LL SS++   A +A        + +SWL +T  FG  FI ME+YEF HLI     
Sbjct: 71  VETFLLLFSSITYGMAAIAMHKNN-KSQVISWLALTFLFGAGFIGMELYEFHHLIVNGMG 129

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           P RS FLS+FFALVG HGLHV  GLIW+ VL++Q+ ++GL S N+ R++CLS+FWHFLD+
Sbjct: 130 PDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQVARRGLTSTNRTRIMCLSLFWHFLDV 189

Query: 196 IWICVFSFVYLMGV 209
           IWICVF+ VYLMG 
Sbjct: 190 IWICVFTVVYLMGA 203


>gi|311108525|ref|YP_003981378.1| cytochrome O ubiquinol oxidase subunit III 2 [Achromobacter
           xylosoxidans A8]
 gi|310763214|gb|ADP18663.1| cytochrome O ubiquinol oxidase, subunit III 2 [Achromobacter
           xylosoxidans A8]
          Length = 213

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 116/204 (56%), Positives = 145/204 (71%), Gaps = 4/204 (1%)

Query: 7   GKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI 66
              P   +FYV  +       +GT LGFW+YLMSDCL+FA  F TY VLG+NYAAGP+  
Sbjct: 13  AAPPAEPVFYVAGEHHPK---NGTLLGFWVYLMSDCLIFACLFATYGVLGRNYAAGPSGA 69

Query: 67  DVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEF 126
           D+FD+  + V+T +LLLSS++  FAML     R +  T  WL VT   G+ F+ +E+YEF
Sbjct: 70  DLFDLPLVAVNTALLLLSSITYGFAMLEMRRNR-VGATQLWLAVTGILGLGFLSLELYEF 128

Query: 127 AHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
           AHLI   A PQRSAFLSSFF LVG HGLHV FG++WL  ++IQ+   GLI  N+RRL+CL
Sbjct: 129 AHLIHQGAGPQRSAFLSSFFTLVGTHGLHVTFGIVWLVTMMIQVQMHGLIPENRRRLMCL 188

Query: 187 SMFWHFLDLIWICVFSFVYLMGVV 210
           SMFWHFLDLIW+ VF+FVYLMGV+
Sbjct: 189 SMFWHFLDLIWVGVFTFVYLMGVL 212


>gi|194292956|ref|YP_002008863.1| cytochrome o ubiquinol oxidase, subunit iii [Cupriavidus
           taiwanensis LMG 19424]
 gi|193226860|emb|CAQ72811.1| cytochrome o ubiquinol oxidase, subunit III [Cupriavidus
           taiwanensis LMG 19424]
          Length = 224

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 112/207 (54%), Positives = 143/207 (69%), Gaps = 4/207 (1%)

Query: 4   QKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGP 63
           Q     P    FY+ ++       +GT LGFW+YLMSDCL+FA  F  Y VLG+NYA GP
Sbjct: 21  QHAPAQPAALRFYMTEEYH---VPNGTLLGFWLYLMSDCLVFACLFAAYGVLGRNYAGGP 77

Query: 64  APIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEI 123
           +  ++FD+  + ++T  LLLSS++  FAML +   RL   T  WL VT   G  F+ +EI
Sbjct: 78  SGAELFDLPLVALNTSFLLLSSITYGFAMLEAQRGRLGP-TQGWLAVTGLLGAAFLAVEI 136

Query: 124 YEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRL 183
           YEFAHL+   A PQRS FL+SFFALVG HGLHV FG++WL  LV Q+ + GLI  N+RRL
Sbjct: 137 YEFAHLVGEGAGPQRSGFLTSFFALVGTHGLHVTFGIVWLVTLVSQLRRHGLIPENRRRL 196

Query: 184 ICLSMFWHFLDLIWICVFSFVYLMGVV 210
           +CLSMFWHFLD++WI VF+FVYLMGV+
Sbjct: 197 MCLSMFWHFLDVVWIGVFTFVYLMGVL 223


>gi|319786909|ref|YP_004146384.1| cytochrome o ubiquinol oxidase subunit III [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317465421|gb|ADV27153.1| cytochrome o ubiquinol oxidase, subunit III [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 211

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 112/213 (52%), Positives = 148/213 (69%), Gaps = 6/213 (2%)

Query: 1   MSRQKIGKSP---NFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK 57
           MS   +  SP   + + FY           +GT LGFW+YLMSD L+FA  F  Y VLG+
Sbjct: 1   MSDAALASSPLAGDPNRFYDTGGHHHP--QNGTLLGFWLYLMSDLLIFACLFAVYGVLGR 58

Query: 58  NYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMI 117
           +YAAGP   D+FD+  + V+T +LLLSS++  FAML+   +      + WL VT  FG+ 
Sbjct: 59  SYAAGPTGADLFDLPLVAVNTAMLLLSSITYGFAMLSMQRRNT-AGVLGWLAVTGLFGLA 117

Query: 118 FIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLIS 177
           F+ +E+YEF+HLI   A PQRSAFLSSFFALVG HGLHV FG++WL VL++Q+ + GL  
Sbjct: 118 FLGLELYEFSHLIHEGAGPQRSAFLSSFFALVGTHGLHVAFGIVWLVVLMVQVQRHGLHE 177

Query: 178 GNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
            N+RRL+CLS+FWHFLD++WI VF+FVYLMGV+
Sbjct: 178 ANRRRLMCLSLFWHFLDVVWIGVFTFVYLMGVL 210


>gi|220924641|ref|YP_002499943.1| cytochrome o ubiquinol oxidase subunit III [Methylobacterium
           nodulans ORS 2060]
 gi|219949248|gb|ACL59640.1| cytochrome o ubiquinol oxidase, subunit III [Methylobacterium
           nodulans ORS 2060]
          Length = 222

 Score =  147 bits (371), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 119/212 (56%), Positives = 152/212 (71%), Gaps = 6/212 (2%)

Query: 1   MSRQKIGKSPNFS--LFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKN 58
           M+       P     LFY +++        GT LGFWIYLMSDCL+FAV F TY VLG++
Sbjct: 14  MTMHANTAPPGTEAPLFYAEEEH---AHESGTLLGFWIYLMSDCLVFAVLFATYGVLGRS 70

Query: 59  YAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIF 118
           YAAGP+P DVF++  + V+T +LLLSS++  FAML     ++      WL+VT  FG  F
Sbjct: 71  YAAGPSPNDVFNLPIVAVNTTMLLLSSITYGFAMLEMDKGQVR-GMQRWLVVTGLFGAAF 129

Query: 119 IIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISG 178
           I +E+YEFAH+I   A PQRS FLSSFFALVG HGLHV FGL+WL VL++Q+ ++GLI+ 
Sbjct: 130 IGIELYEFAHMIREGATPQRSGFLSSFFALVGTHGLHVTFGLVWLSVLMVQVAQRGLIAD 189

Query: 179 NQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           N RRL+CLSMFWHFLD++WI VF+FVYLMGV+
Sbjct: 190 NMRRLLCLSMFWHFLDVVWIGVFTFVYLMGVL 221


>gi|293607336|ref|ZP_06689675.1| quinol oxidase subunit III [Achromobacter piechaudii ATCC 43553]
 gi|292814180|gb|EFF73322.1| quinol oxidase subunit III [Achromobacter piechaudii ATCC 43553]
          Length = 213

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 116/204 (56%), Positives = 145/204 (71%), Gaps = 4/204 (1%)

Query: 7   GKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI 66
              P   +FYV  +       +GT LGFW+YLMSDCL+FA  F TY VLG++YAAGP+  
Sbjct: 13  ATPPTEPVFYVPGEHHPK---NGTLLGFWVYLMSDCLIFACLFATYGVLGRSYAAGPSGA 69

Query: 67  DVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEF 126
           D+FD+  + V+T +LLLSS++  FAML     R I  T  WL VT   G+ F+ +EIYEF
Sbjct: 70  DLFDLPLVAVNTSLLLLSSITYGFAMLEMRRNR-IGATQLWLAVTGLLGLGFLSLEIYEF 128

Query: 127 AHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
           AHLI   A PQRSAFLS+FF LVG HGLHV FG++WL  ++IQ+   GLI  N+RRL+CL
Sbjct: 129 AHLIHQGAGPQRSAFLSAFFTLVGTHGLHVTFGIVWLVTMMIQVQMHGLIPENRRRLMCL 188

Query: 187 SMFWHFLDLIWICVFSFVYLMGVV 210
           SMFWHFLDLIW+ VF+FVYLMGV+
Sbjct: 189 SMFWHFLDLIWVGVFTFVYLMGVL 212


>gi|187928956|ref|YP_001899443.1| cytochrome o ubiquinol oxidase subunit III [Ralstonia pickettii
           12J]
 gi|187725846|gb|ACD27011.1| cytochrome o ubiquinol oxidase, subunit III [Ralstonia pickettii
           12J]
          Length = 221

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 107/209 (51%), Positives = 142/209 (67%), Gaps = 4/209 (1%)

Query: 2   SRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAA 61
           +       P    F+V ++       +GT LGFW+YLMSDCL+FA  F  Y VLG+ YA 
Sbjct: 16  TTTADDVPPGGYQFHVTEEPH---VPNGTLLGFWLYLMSDCLIFACLFAAYGVLGREYAG 72

Query: 62  GPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIM 121
           GP   ++F++  + ++T  LLLSS++  FAML    +  +     WL +T  FG  F+ +
Sbjct: 73  GPTGAELFELPLVALNTSFLLLSSITYGFAMLQLQ-QNKVSAMQIWLAITWVFGAAFLAV 131

Query: 122 EIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQR 181
           E+YEFAHLI   A P RSAFL+SFF+LVG HGLHV FGLIWL VL++Q+ K GLI+ N+R
Sbjct: 132 ELYEFAHLIHEGAGPTRSAFLTSFFSLVGTHGLHVTFGLIWLIVLMVQVSKHGLITANKR 191

Query: 182 RLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RL+CLSMFWHFLD++WI VF+FVYLMG +
Sbjct: 192 RLMCLSMFWHFLDVVWIGVFTFVYLMGTL 220


>gi|315122072|ref|YP_004062561.1| cytochrome o ubiquinol oxidase subunit III [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495474|gb|ADR52073.1| cytochrome o ubiquinol oxidase subunit III [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 209

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 171/211 (81%), Positives = 188/211 (89%), Gaps = 3/211 (1%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCV-DHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY 59
           MS++KIGKSPN  +FY+K++K SC+  HDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY
Sbjct: 1   MSKRKIGKSPNTPVFYLKEEKGSCIDHHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY 60

Query: 60  AAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFI 119
           AAGPAPID+F I  I VSTIVLLLSSLS SFAMLAS      +KTV WLLVTAFFG+IFI
Sbjct: 61  AAGPAPIDIFGIRDILVSTIVLLLSSLSYSFAMLASEDV--KNKTVFWLLVTAFFGIIFI 118

Query: 120 IMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGN 179
           +MEI+EFAHLIS  A PQRSAFLSSFF+LV LHGLHVFFGLIW+F+LVIQILKKGLI  N
Sbjct: 119 MMEIHEFAHLISKGATPQRSAFLSSFFSLVALHGLHVFFGLIWIFILVIQILKKGLIPDN 178

Query: 180 QRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           +RRL+CLSMFWHFLDLIWICVFSFVYLMGVV
Sbjct: 179 RRRLMCLSMFWHFLDLIWICVFSFVYLMGVV 209


>gi|241663144|ref|YP_002981504.1| cytochrome o ubiquinol oxidase subunit III [Ralstonia pickettii
           12D]
 gi|309781938|ref|ZP_07676669.1| cytochrome o ubiquinol oxidase, subunit III [Ralstonia sp.
           5_7_47FAA]
 gi|240865171|gb|ACS62832.1| cytochrome o ubiquinol oxidase, subunit III [Ralstonia pickettii
           12D]
 gi|308919282|gb|EFP64948.1| cytochrome o ubiquinol oxidase, subunit III [Ralstonia sp.
           5_7_47FAA]
          Length = 221

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 107/204 (52%), Positives = 141/204 (69%), Gaps = 4/204 (1%)

Query: 7   GKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI 66
              P    F+V ++       +GT LGFW+YLMSDCL+FA  F  Y VLG+ YA GP   
Sbjct: 21  DIPPGGYQFHVTEEPH---VPNGTLLGFWLYLMSDCLIFACLFAAYGVLGREYAGGPTGA 77

Query: 67  DVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEF 126
           ++F++  + ++T  LLLSS++  FAML     ++      WL +T  FG  F+ +E+YEF
Sbjct: 78  ELFELPLVALNTSFLLLSSITYGFAMLQLQQNKIS-AMQIWLAITWVFGAAFLAVELYEF 136

Query: 127 AHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
           AHLI   A P RSAFL+SFF+LVG HGLHV FGLIWL VL++Q+ K GLI+ N+RRL+CL
Sbjct: 137 AHLIHEGAGPTRSAFLTSFFSLVGTHGLHVTFGLIWLIVLMVQVSKHGLITANKRRLMCL 196

Query: 187 SMFWHFLDLIWICVFSFVYLMGVV 210
           SMFWHFLD++WI VF+FVYLMG +
Sbjct: 197 SMFWHFLDVVWIGVFTFVYLMGTL 220


>gi|94314529|ref|YP_587738.1| cytochrome o ubiquinol oxidase subunit III [Cupriavidus
           metallidurans CH34]
 gi|93358381|gb|ABF12469.1| cytochrome o ubiquinol oxidase subunit III [Cupriavidus
           metallidurans CH34]
          Length = 218

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 106/207 (51%), Positives = 143/207 (69%), Gaps = 4/207 (1%)

Query: 4   QKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGP 63
                 P    FY+ ++       +GT LGFW+YLMSDCL+FA  F  Y VLG+ YA GP
Sbjct: 15  DADQAPPGGYQFYLTEEVHP---QNGTLLGFWLYLMSDCLIFACLFAAYGVLGREYAGGP 71

Query: 64  APIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEI 123
           +  ++F++  + ++T  LL+SS++  FAML    +  +  T  WL +T  FG  F+ +E+
Sbjct: 72  SGAELFELPLVALNTSFLLISSITYGFAMLQMQ-QNRVASTQIWLAITGVFGAAFLTVEL 130

Query: 124 YEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRL 183
           YEFAHLI   A PQRSAFL+SFF+LVG HGLHV FG+IWL VL+ Q+ + GLI+ N+RRL
Sbjct: 131 YEFAHLIHEGAGPQRSAFLTSFFSLVGTHGLHVTFGIIWLIVLMTQVARHGLITANKRRL 190

Query: 184 ICLSMFWHFLDLIWICVFSFVYLMGVV 210
           +CLSMFWHFLD++WI VF+FVYLMG +
Sbjct: 191 MCLSMFWHFLDVVWIGVFTFVYLMGSL 217


>gi|330824828|ref|YP_004388131.1| cytochrome o ubiquinol oxidase subunit III [Alicycliphilus
           denitrificans K601]
 gi|329310200|gb|AEB84615.1| cytochrome o ubiquinol oxidase, subunit III [Alicycliphilus
           denitrificans K601]
          Length = 210

 Score =  145 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 111/193 (57%), Positives = 137/193 (70%), Gaps = 1/193 (0%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
                     +GT LGFW+YLMSDCL+FAV F TY VLG+NYA GP   ++FD+  + ++
Sbjct: 19  YHLAHEPHPENGTSLGFWLYLMSDCLIFAVLFATYGVLGRNYAGGPTGAELFDLKLVAIN 78

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T  LLLSS++  FAML    + +   T++WL VT   G+ F+ +E+YEFAHL+   A PQ
Sbjct: 79  TAFLLLSSITFGFAMLQKQQRDVR-GTLAWLAVTGLLGLAFLAVELYEFAHLLHEGAGPQ 137

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
           RSAFLSSFF LVG HGLHV FG IWL  L+IQI K GLI  N RRL CLSMFWHFLD++W
Sbjct: 138 RSAFLSSFFTLVGTHGLHVTFGTIWLVTLMIQIGKHGLIPENARRLNCLSMFWHFLDVVW 197

Query: 198 ICVFSFVYLMGVV 210
           I VF+FVYLMGV+
Sbjct: 198 IGVFTFVYLMGVL 210


>gi|332184930|ref|ZP_08386679.1| cytochrome o ubiquinol oxidase, subunit III [Sphingomonas sp. S17]
 gi|332014654|gb|EGI56710.1| cytochrome o ubiquinol oxidase, subunit III [Sphingomonas sp. S17]
          Length = 212

 Score =  145 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 109/212 (51%), Positives = 150/212 (70%), Gaps = 3/212 (1%)

Query: 1   MSRQKIGKSP--NFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKN 58
           MS   +   P  N + + V+D+         T +GFW+YLMSDCL+FA+ F TY VLG +
Sbjct: 1   MSTDVLSADPAKNPTYYLVEDEDHHHESGGSTAIGFWMYLMSDCLIFAILFATYGVLGTS 60

Query: 59  YAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIF 118
           YA GP P ++F++  + ++T +LLLSS++  FAM+A    +  + T+ WL +T  FG+ F
Sbjct: 61  YAGGPTPREIFELPLVALNTSMLLLSSITYGFAMIAMEKNQKSN-TLIWLGITGLFGLAF 119

Query: 119 IIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISG 178
           + +E+YEFA+LI   A PQRSAFLSSFF LVG HGLHV FG IWL  L++Q+ + GLI  
Sbjct: 120 LSIELYEFANLIHEGAGPQRSAFLSSFFTLVGTHGLHVTFGSIWLVTLMVQVGRFGLIEA 179

Query: 179 NQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           N+RRL+CLSMFWHFLD++WI VF+FVYL+GV+
Sbjct: 180 NKRRLMCLSMFWHFLDVVWIGVFTFVYLLGVL 211


>gi|152980608|ref|YP_001354328.1| cytochrome o ubiquinol oxidase subunit III [Janthinobacterium sp.
           Marseille]
 gi|151280685|gb|ABR89095.1| cytochrome o ubiquinol oxidase subunit III [Janthinobacterium sp.
           Marseille]
          Length = 210

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 112/203 (55%), Positives = 144/203 (70%), Gaps = 5/203 (2%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPID 67
            +   + +YV++        +GT LGFW+YLMSDCL+FA  F TYAVLG+NYA GP   +
Sbjct: 12  SADPSARYYVQEHHP----ENGTLLGFWLYLMSDCLIFACLFATYAVLGRNYAGGPTGAE 67

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
           +FD+  +  +T  LLLSS++  FAML +  KRL   T+ WL +T   G  F+ +E+YEF+
Sbjct: 68  LFDLPLVAANTAFLLLSSITYGFAMLEAQRKRLK-ATMIWLAITGLLGAAFLALELYEFS 126

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
           HLI   A PQRSAFL+SFFALV  HGLHV FG+IWL  L+ Q+ + GLI  N RRL+CLS
Sbjct: 127 HLIHEGAGPQRSAFLTSFFALVATHGLHVTFGIIWLITLMFQLKRHGLIPENGRRLMCLS 186

Query: 188 MFWHFLDLIWICVFSFVYLMGVV 210
           MFWHFLD+IWI VF+FVYLMGV+
Sbjct: 187 MFWHFLDVIWIGVFTFVYLMGVL 209


>gi|33593693|ref|NP_881337.1| cytochrome ubiquinol oxidase subunit III [Bordetella pertussis
           Tohama I]
 gi|33563766|emb|CAE43006.1| cytochrome ubiquinol oxidase subunit III [Bordetella pertussis
           Tohama I]
 gi|332383097|gb|AEE67944.1| cytochrome ubiquinol oxidase subunit III [Bordetella pertussis CS]
          Length = 213

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 112/204 (54%), Positives = 143/204 (70%), Gaps = 4/204 (1%)

Query: 7   GKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI 66
                  LFYV  +       +GT LGFW+YLMSDCL+FA  F TY V+G+NY  GP   
Sbjct: 13  AAPDPERLFYVPGEHHPK---NGTLLGFWVYLMSDCLVFACLFATYGVVGRNYDGGPTGA 69

Query: 67  DVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEF 126
           ++FD+  + V+T +LLLSS++  FAML    +R I  T +WL VT   G  F+ +E+YEF
Sbjct: 70  ELFDLPLVAVNTSLLLLSSITYGFAMLEMRRQR-IGATQAWLAVTGLLGAGFLGLELYEF 128

Query: 127 AHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
           AHLI   A PQRSAFLS+FF LVG HGLHV FG++WL  L++Q+ + GLI  N+RRL+CL
Sbjct: 129 AHLIHQGAGPQRSAFLSAFFTLVGTHGLHVTFGIVWLVTLMVQVARHGLIPENRRRLMCL 188

Query: 187 SMFWHFLDLIWICVFSFVYLMGVV 210
           SMFWHFLDLIW+ VF+FVYLMGV+
Sbjct: 189 SMFWHFLDLIWVGVFTFVYLMGVL 212


>gi|319762687|ref|YP_004126624.1| cytochrome o ubiquinol oxidase, subunit iii [Alicycliphilus
           denitrificans BC]
 gi|317117248|gb|ADU99736.1| cytochrome o ubiquinol oxidase, subunit III [Alicycliphilus
           denitrificans BC]
          Length = 210

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 111/193 (57%), Positives = 137/193 (70%), Gaps = 1/193 (0%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
                     +GT LGFW+YLMSDCL+FAV F TY VLG+NYA GP   ++FD+  + ++
Sbjct: 19  YHLAHEPHPENGTSLGFWLYLMSDCLIFAVLFATYGVLGRNYAGGPTGAELFDLKLVAIN 78

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T  LLLSS++  FAML    + +   T++WL VT   G+ F+ +E+YEFAHL+   A PQ
Sbjct: 79  TAFLLLSSITFGFAMLQKQQRDVR-GTLAWLAVTGLLGLAFLAVELYEFAHLLHEGAGPQ 137

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
           RSAFLSSFF LVG HGLHV FG IWL  L+IQI K GLI  N RRL CLSMFWHFLD++W
Sbjct: 138 RSAFLSSFFTLVGTHGLHVTFGTIWLVTLMIQIGKHGLIPENARRLNCLSMFWHFLDVVW 197

Query: 198 ICVFSFVYLMGVV 210
           I VF+FVYLMGV+
Sbjct: 198 IGVFTFVYLMGVL 210


>gi|317403927|gb|EFV84396.1| cytochrome ubiquinol oxidase subunit III [Achromobacter
           xylosoxidans C54]
          Length = 213

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 114/203 (56%), Positives = 145/203 (71%), Gaps = 4/203 (1%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPID 67
             P   +F+V  +       +GT LGFW+YLMSDCL+FA  F TY VLG+NYAAGP+  D
Sbjct: 14  APPAEPVFHVAGEHHPK---NGTLLGFWVYLMSDCLIFACLFATYGVLGRNYAAGPSGAD 70

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
           +FD+  + V+T +LLLSS++  FAML     R +  T  WL VT   G+ F+ +E+YEFA
Sbjct: 71  LFDLPLVAVNTSLLLLSSITYGFAMLEMRRNR-VGATQGWLAVTGLLGLGFLSLELYEFA 129

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
           HLI   A PQRSAFLSSFF LVG HGLHV FG++WL  +++Q+   GLI  N+RRL+CLS
Sbjct: 130 HLIHQGAGPQRSAFLSSFFTLVGTHGLHVTFGIVWLVTMMVQVRMHGLIPENRRRLMCLS 189

Query: 188 MFWHFLDLIWICVFSFVYLMGVV 210
           MFWHFLDLIW+ VF+FVYLMGV+
Sbjct: 190 MFWHFLDLIWVGVFTFVYLMGVL 212


>gi|222111441|ref|YP_002553705.1| cytochrome o ubiquinol oxidase subunit III [Acidovorax ebreus TPSY]
 gi|221730885|gb|ACM33705.1| cytochrome o ubiquinol oxidase, subunit III [Acidovorax ebreus
           TPSY]
          Length = 211

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 113/212 (53%), Positives = 143/212 (67%), Gaps = 3/212 (1%)

Query: 1   MSRQKIGKSPNFSLFYVKDKK--ESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKN 58
           MS     ++   +    ++          +GT LGFW+YLMSDCL+FA  F TY VLG++
Sbjct: 1   MSNTHTLQAGGTAALAPREYHLAHEPHPENGTSLGFWLYLMSDCLIFAALFATYGVLGRS 60

Query: 59  YAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIF 118
           YAAGP    +FD+S + ++T  LL SS++  FAML          T++WL VT   G+ F
Sbjct: 61  YAAGPTGAQLFDLSLVAINTAFLLTSSITFGFAMLQKQAGNAR-GTLAWLAVTGLLGLAF 119

Query: 119 IIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISG 178
           + +E+YEFAHLI   A PQRSAFLS+FF LVG HGLHV FGLIWL  L+IQI K GLI  
Sbjct: 120 LGVELYEFAHLIHQGATPQRSAFLSAFFTLVGTHGLHVTFGLIWLVTLMIQISKHGLIHE 179

Query: 179 NQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           N+RRL CLSMFWHFLD++WI VF+FVYLMGV+
Sbjct: 180 NKRRLNCLSMFWHFLDVVWIGVFTFVYLMGVL 211


>gi|221067297|ref|ZP_03543402.1| cytochrome o ubiquinol oxidase, subunit III [Comamonas testosteroni
           KF-1]
 gi|264678284|ref|YP_003278191.1| cytochrome C oxidase subunit III [Comamonas testosteroni CNB-2]
 gi|299532080|ref|ZP_07045474.1| cytochrome o ubiquinol oxidase, subunit III [Comamonas testosteroni
           S44]
 gi|220712320|gb|EED67688.1| cytochrome o ubiquinol oxidase, subunit III [Comamonas testosteroni
           KF-1]
 gi|262208797|gb|ACY32895.1| cytochrome c oxidase, subunit III [Comamonas testosteroni CNB-2]
 gi|298719742|gb|EFI60705.1| cytochrome o ubiquinol oxidase, subunit III [Comamonas testosteroni
           S44]
          Length = 210

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 109/193 (56%), Positives = 138/193 (71%), Gaps = 1/193 (0%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
                     +GT LGFW+YLMSDCL+FA  F TY VLG++YA GP+  D+FD+S + V+
Sbjct: 19  YHLAHEPHPENGTSLGFWLYLMSDCLIFAALFATYGVLGRSYAGGPSGKDLFDLSLVAVN 78

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T  LL+SS++  FAML    K+ ++ T+ WL VT   G  F+ +E+YEF HLI   A PQ
Sbjct: 79  TAFLLMSSITFGFAMLQ-KQKKNVNGTLLWLAVTGLLGAAFLAVELYEFHHLIHQGATPQ 137

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
            SAFLSSFF LVG HG+HV FGL+WL  L+IQI K GLI+ N RR+ CLSMFWHFLD++W
Sbjct: 138 SSAFLSSFFTLVGTHGIHVTFGLVWLITLMIQIKKHGLINENVRRINCLSMFWHFLDVVW 197

Query: 198 ICVFSFVYLMGVV 210
           I VF+FVYLMGV+
Sbjct: 198 IGVFTFVYLMGVL 210


>gi|33600294|ref|NP_887854.1| cytochrome ubiquinol oxidase subunit III [Bordetella bronchiseptica
           RB50]
 gi|33567893|emb|CAE31806.1| cytochrome ubiquinol oxidase subunit III [Bordetella bronchiseptica
           RB50]
          Length = 212

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 112/197 (56%), Positives = 143/197 (72%), Gaps = 4/197 (2%)

Query: 14  LFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISG 73
           LFYV  +       +GT LGFW+YLMSDCL+FA  F TY V+G+NY  GP   ++FD+  
Sbjct: 19  LFYVPGEHHPK---NGTLLGFWVYLMSDCLVFACLFATYGVVGRNYDGGPTGAELFDLPL 75

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           + V+T +LLLSS++  FAML    +R I  T +WL VT   G  F+ +E+YEFAHLI   
Sbjct: 76  VAVNTSLLLLSSITYGFAMLEMRRQR-IGATQAWLAVTGLLGAGFLGLELYEFAHLIHQG 134

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
           A PQRSAFLS+FF LVG HGLHV FG++WL  L++Q+ + GLI  N+RRL+CLSMFWHFL
Sbjct: 135 AGPQRSAFLSAFFTLVGTHGLHVTFGIVWLVTLMVQVSRHGLIPENRRRLMCLSMFWHFL 194

Query: 194 DLIWICVFSFVYLMGVV 210
           DLIW+ VF+FVYLMGV+
Sbjct: 195 DLIWVGVFTFVYLMGVL 211


>gi|329296775|ref|ZP_08254111.1| CyoC [Plautia stali symbiont]
          Length = 204

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 98/198 (49%), Positives = 126/198 (63%), Gaps = 1/198 (0%)

Query: 13  SLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
                  +            GFWIYLMSDC++FA  F TYAV+  N A GPA  D+F++ 
Sbjct: 8   HHHDAHAEHGHHDAGANKVFGFWIYLMSDCIIFATLFATYAVMVNNTAGGPAGKDIFELP 67

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + V T +LLLSS++   A++A    +     +SWL +T  FG  FI MEIYEF HLI  
Sbjct: 68  FVLVETALLLLSSITYGMAVIA-MNNQNKGSVISWLALTFLFGAGFIGMEIYEFHHLIKE 126

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
              P RS FLS FF LVG HGLHV  GLIW+ VL+ QI K+GL + N+ R++CLS+FWHF
Sbjct: 127 GFGPDRSGFLSGFFTLVGTHGLHVSSGLIWMAVLMFQIAKRGLSATNRTRIMCLSLFWHF 186

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD++WICVF+ VYLMG +
Sbjct: 187 LDVVWICVFTVVYLMGAM 204


>gi|160899493|ref|YP_001565075.1| cytochrome o ubiquinol oxidase subunit III [Delftia acidovorans
           SPH-1]
 gi|160365077|gb|ABX36690.1| cytochrome o ubiquinol oxidase, subunit III [Delftia acidovorans
           SPH-1]
          Length = 210

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 110/196 (56%), Positives = 141/196 (71%), Gaps = 4/196 (2%)

Query: 15  FYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
           +++ ++       +GT LGFW+YLMSDCL+FA  F TY VLG+NYAAGP    +FD+  +
Sbjct: 19  YHLAEEPHPE---NGTALGFWLYLMSDCLIFAALFATYGVLGRNYAAGPTGAQLFDLPLV 75

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            ++T  LLLSS++  FAML    +  +  T  WL +T  FG+ F+ +E+YEF+HL+   A
Sbjct: 76  AMNTAFLLLSSITFGFAMLQ-KQQGKLGGTQLWLAITGLFGLCFLGLELYEFSHLLHEGA 134

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            PQRSAFLSSFF LVG HGLHV FGLIWL  L+IQI K GL   N RRL+CLSMFWHFLD
Sbjct: 135 GPQRSAFLSSFFTLVGTHGLHVSFGLIWLVTLMIQINKHGLTHENNRRLMCLSMFWHFLD 194

Query: 195 LIWICVFSFVYLMGVV 210
           ++WI VF+FVYLMGV+
Sbjct: 195 VVWIGVFTFVYLMGVL 210


>gi|307309511|ref|ZP_07589167.1| cytochrome o ubiquinol oxidase, subunit III [Sinorhizobium meliloti
           BL225C]
 gi|306900096|gb|EFN30716.1| cytochrome o ubiquinol oxidase, subunit III [Sinorhizobium meliloti
           BL225C]
          Length = 210

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 115/196 (58%), Positives = 149/196 (76%), Gaps = 4/196 (2%)

Query: 15  FYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
           FY+ ++         T LGFW+YLMSDCL+FAV F T+AVLG+NYAAGP+P D+FD+  +
Sbjct: 18  FYLTEEHHPEG---STMLGFWLYLMSDCLIFAVLFATHAVLGRNYAAGPSPADLFDLPLV 74

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            V+T +LL SS++  FAMLA         T++W+ VTA FG+ F+ +E+YEFAHL+   A
Sbjct: 75  AVNTSMLLFSSITYGFAMLAMERYDKKT-TLAWMAVTALFGIAFVGLELYEFAHLLHEGA 133

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            PQRSAFLSSFF LVG HGLHV  G++W+FVL+ Q+ K+GLI  N+RRL+CLSMFWHFLD
Sbjct: 134 GPQRSAFLSSFFTLVGTHGLHVTAGIVWMFVLMAQVAKRGLIPENKRRLMCLSMFWHFLD 193

Query: 195 LIWICVFSFVYLMGVV 210
           ++WI VFSFVYLMGV+
Sbjct: 194 VVWIGVFSFVYLMGVL 209


>gi|16265065|ref|NP_437857.1| putative cytochrome o ubiquinol oxidase chain III protein
           [Sinorhizobium meliloti 1021]
 gi|307320581|ref|ZP_07599995.1| cytochrome o ubiquinol oxidase, subunit III [Sinorhizobium meliloti
           AK83]
 gi|13398498|gb|AAK21905.1| ubiquinol oxidase subunit-like protein [Sinorhizobium meliloti]
 gi|15141204|emb|CAC49717.1| putative cytochrome o ubiquinol oxidase chain III protein
           [Sinorhizobium meliloti 1021]
 gi|306893731|gb|EFN24503.1| cytochrome o ubiquinol oxidase, subunit III [Sinorhizobium meliloti
           AK83]
          Length = 210

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 115/196 (58%), Positives = 148/196 (75%), Gaps = 4/196 (2%)

Query: 15  FYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
           FY+ ++         T LGFW+YLMSDCL+FAV F T+AVLG+NYAAGP+P D+FD+  +
Sbjct: 18  FYLTEEHHPEG---STMLGFWLYLMSDCLIFAVLFATHAVLGRNYAAGPSPADLFDLPLV 74

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            V+T +LL SS++  FAMLA         T++W+ VTA FG+ F+ +E YEFAHL+   A
Sbjct: 75  AVNTSMLLFSSITYGFAMLAMERYEKK-ATLTWMAVTALFGIAFVGLEFYEFAHLLHEGA 133

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            PQRSAFLSSFF LVG HGLHV  G++W+FVL+ Q+ K+GLI  N+RRL+CLSMFWHFLD
Sbjct: 134 GPQRSAFLSSFFTLVGTHGLHVTAGIVWMFVLMAQVAKRGLIPENKRRLMCLSMFWHFLD 193

Query: 195 LIWICVFSFVYLMGVV 210
           ++WI VFSFVYLMGV+
Sbjct: 194 VVWIGVFSFVYLMGVL 209


>gi|304395492|ref|ZP_07377375.1| cytochrome o ubiquinol oxidase, subunit III [Pantoea sp. aB]
 gi|304356786|gb|EFM21150.1| cytochrome o ubiquinol oxidase, subunit III [Pantoea sp. aB]
          Length = 204

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 96/198 (48%), Positives = 127/198 (64%), Gaps = 1/198 (0%)

Query: 13  SLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
                  +            GFWIYLMSDC++FA  F TYAV+  N A GPA  D+F++ 
Sbjct: 8   HHHDAHAEHGHHDAGANKVFGFWIYLMSDCIIFATLFATYAVMVNNTAGGPAGKDIFELP 67

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + V T +LLLSS++   A+++   K      + WL +T  FG+ FI MEIYEF HLI+ 
Sbjct: 68  FVLVETALLLLSSITYGMAVIS-MNKEQKGAVIGWLALTFLFGLGFIGMEIYEFHHLIAE 126

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
              P RS FLS FF LVG HGLHV  GLIW+ VL+ Q+ K+GL + N+ R++CLS+FWHF
Sbjct: 127 GFGPDRSGFLSGFFTLVGTHGLHVTSGLIWMLVLMFQVSKRGLNATNRTRIMCLSLFWHF 186

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD++WICVF+ VYLMG +
Sbjct: 187 LDVVWICVFTVVYLMGAM 204


>gi|163853732|ref|YP_001641775.1| cytochrome o ubiquinol oxidase, subunit III [Methylobacterium
           extorquens PA1]
 gi|240141157|ref|YP_002965637.1| cytochrome o ubiquinol oxidase, subunit III [Methylobacterium
           extorquens AM1]
 gi|163665337|gb|ABY32704.1| cytochrome o ubiquinol oxidase, subunit III [Methylobacterium
           extorquens PA1]
 gi|240011134|gb|ACS42360.1| cytochrome o ubiquinol oxidase, subunit III [Methylobacterium
           extorquens AM1]
          Length = 215

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 116/191 (60%), Positives = 141/191 (73%), Gaps = 4/191 (2%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTI 79
           +        GT LGFWIYLMSDCL+FAV F TYAVLG++YAAGP+P D+FD+  + V+T 
Sbjct: 28  EHHPEG---GTMLGFWIYLMSDCLIFAVLFATYAVLGRSYAAGPSPKDLFDLPIVAVNTS 84

Query: 80  VLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS 139
           +LL SS++  FAMLA      + KT  WL +T  FG  F+ +E+YEFAHLI   A PQRS
Sbjct: 85  MLLFSSITYGFAMLAMEKDD-LAKTQLWLAITGLFGAAFVGLELYEFAHLIHEGATPQRS 143

Query: 140 AFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWIC 199
            FLS+FF LVG HGLHV FGLIWL  L+IQ   KGL + N+RRL+CLSMFWHFLD+IWI 
Sbjct: 144 GFLSAFFTLVGTHGLHVTFGLIWLVTLMIQTRLKGLGAENKRRLMCLSMFWHFLDVIWIG 203

Query: 200 VFSFVYLMGVV 210
           VF+FVYLMGV+
Sbjct: 204 VFTFVYLMGVL 214


>gi|301631835|ref|XP_002945000.1| PREDICTED: cytochrome o ubiquinol oxidase subunit 3-like [Xenopus
           (Silurana) tropicalis]
          Length = 214

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 108/194 (55%), Positives = 139/194 (71%), Gaps = 1/194 (0%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
                      +GT LGFW+YLMSDCL+FA  F TY VLG++YA GP   ++FD+  + +
Sbjct: 22  TYHLAHEPHPENGTALGFWLYLMSDCLIFAALFATYGVLGRSYAGGPTGAELFDLPLVAL 81

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
           +T  LLLSS++  FAML    +  +  T+ WL VT  FG+ F+ +E+YEF HLI   A P
Sbjct: 82  NTAFLLLSSITFGFAMLQ-KQQNKVGGTLVWLAVTGLFGLCFLGLELYEFHHLIHQGAGP 140

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
           QRSAFLS+FF LV  HGLHV FGL+WL VL++QI ++GLI  NQRRL+CLSMFWHFLD++
Sbjct: 141 QRSAFLSAFFTLVATHGLHVSFGLVWLVVLMVQIAQRGLIHENQRRLMCLSMFWHFLDVV 200

Query: 197 WICVFSFVYLMGVV 210
           WI VF+FVYLMGV+
Sbjct: 201 WIGVFTFVYLMGVL 214


>gi|308185900|ref|YP_003930031.1| cytochrome o ubiquinol oxidase subunit III [Pantoea vagans C9-1]
 gi|308056410|gb|ADO08582.1| cytochrome o ubiquinol oxidase subunit III [Pantoea vagans C9-1]
          Length = 205

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 96/198 (48%), Positives = 127/198 (64%), Gaps = 1/198 (0%)

Query: 13  SLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
                  +            GFWIYLMSDC++FA  F TYAV+  N A GPA  D+F++ 
Sbjct: 9   HHHDAHAEHGHHDAGANKVFGFWIYLMSDCIIFATLFATYAVMVNNTAGGPAGKDIFELP 68

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + V T +LLLSS++   A+++   K      + WL +T  FG+ FI MEIYEF HLI+ 
Sbjct: 69  FVLVETALLLLSSITYGMAVIS-MNKEQKGAVIGWLALTFLFGLGFIGMEIYEFHHLIAE 127

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
              P RS FLS FF LVG HGLHV  GLIW+ VL+ Q+ K+GL + N+ R++CLS+FWHF
Sbjct: 128 GFGPDRSGFLSGFFTLVGTHGLHVTSGLIWMLVLMFQVSKRGLNATNRTRIMCLSLFWHF 187

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD++WICVF+ VYLMG +
Sbjct: 188 LDVVWICVFTVVYLMGAM 205


>gi|291616542|ref|YP_003519284.1| CyoC [Pantoea ananatis LMG 20103]
 gi|291151572|gb|ADD76156.1| CyoC [Pantoea ananatis LMG 20103]
 gi|327392973|dbj|BAK10395.1| cytochrome o ubiquinol oxidase subunit III CyoC [Pantoea ananatis
           AJ13355]
          Length = 204

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 97/198 (48%), Positives = 125/198 (63%), Gaps = 1/198 (0%)

Query: 13  SLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
                  +            GFWIYLMSDC++FA  F TYAV+  + A GPA  D+F++ 
Sbjct: 8   HHHDAHAEHGHHDAGANKVFGFWIYLMSDCIIFATLFATYAVMVNSTAGGPAGKDIFELP 67

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + V T +LLLSS++   A++A   K      + WL +T  FG  FI MEIYEF HLI  
Sbjct: 68  FVLVETALLLLSSITYGMAVIA-MNKENKGAVIGWLALTFLFGAGFIGMEIYEFHHLIVE 126

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
              P RS FLS FF LVG HGLHV  GLIW+ VL+ QI K+GL + N+ R++CLS+FWHF
Sbjct: 127 GFGPDRSGFLSGFFTLVGTHGLHVTSGLIWMAVLMFQIAKRGLNATNRTRIMCLSLFWHF 186

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD++WICVF+ VYLMG +
Sbjct: 187 LDVVWICVFTVVYLMGAM 204


>gi|259909262|ref|YP_002649618.1| Cytochrome o ubiquinol oxidase subunit III [Erwinia pyrifoliae
           Ep1/96]
 gi|224964884|emb|CAX56406.1| Cytochrome o ubiquinol oxidase subunit III [Erwinia pyrifoliae
           Ep1/96]
 gi|283479314|emb|CAY75230.1| cytochrome o ubiquinol oxidase subunit III [Erwinia pyrifoliae DSM
           12163]
 gi|310766835|gb|ADP11785.1| Cytochrome o ubiquinol oxidase subunit III [Erwinia sp. Ejp617]
          Length = 204

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 97/197 (49%), Positives = 127/197 (64%), Gaps = 1/197 (0%)

Query: 14  LFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISG 73
                 +            GFWIYLMSDC++FA  F TY V+  N A GPA  D+F++  
Sbjct: 9   HHDAHAEHGHHDAGANKVFGFWIYLMSDCIIFATLFATYGVMVNNTAGGPAGKDIFELPF 68

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           + V T +LLLSS++  FA++ +  K      + WL +T  FG+ FI MEIYEF HLI+  
Sbjct: 69  VLVETALLLLSSITYGFAVI-NMNKGQKGAVIGWLALTFLFGLGFIGMEIYEFHHLIAEG 127

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
             P RS FLS FF LVG HGLHV  GLIW+ VL+ Q+ K+GL   N+ R++CLS+FWHFL
Sbjct: 128 FGPDRSGFLSGFFTLVGTHGLHVTSGLIWMLVLMYQVAKRGLNDTNRTRIMCLSLFWHFL 187

Query: 194 DLIWICVFSFVYLMGVV 210
           D++WICVF+ VYLMGV+
Sbjct: 188 DVVWICVFTIVYLMGVM 204


>gi|317047168|ref|YP_004114816.1| cytochrome o ubiquinol oxidase subunit III [Pantoea sp. At-9b]
 gi|316948785|gb|ADU68260.1| cytochrome o ubiquinol oxidase, subunit III [Pantoea sp. At-9b]
          Length = 205

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 98/198 (49%), Positives = 126/198 (63%), Gaps = 1/198 (0%)

Query: 13  SLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
                  +            GFWIYLMSDC++FA  F TYAV+  N A GPA  D+F++ 
Sbjct: 9   HHHDAHAEHGHHDAGANKIFGFWIYLMSDCIIFATLFATYAVMVNNTAGGPAGKDIFELP 68

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + V T +LLLSS++   A++A    +     +SWL +T  FG  FI MEIYEF HLI  
Sbjct: 69  FVLVETALLLLSSITYGMAVIA-MNNQNKGAVISWLALTFLFGAGFIGMEIYEFHHLIME 127

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
              P RS FLS FF LVG HGLHV  GLIW+ VL+ QI K+GL + N+ R++CLS+FWHF
Sbjct: 128 GFGPNRSGFLSGFFTLVGTHGLHVTSGLIWMAVLMFQISKRGLSATNRTRIMCLSLFWHF 187

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD++WICVF+ VYLMG +
Sbjct: 188 LDVVWICVFTIVYLMGAM 205


>gi|300311777|ref|YP_003775869.1| cytochrome o ubiquinol oxidase subunit III protein [Herbaspirillum
           seropedicae SmR1]
 gi|300074562|gb|ADJ63961.1| cytochrome o ubiquinol oxidase subunit III protein [Herbaspirillum
           seropedicae SmR1]
          Length = 208

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 111/195 (56%), Positives = 137/195 (70%), Gaps = 4/195 (2%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF 75
           Y           +GT LGFWIYLMSDCL+FA  F  YAVLG+NYA GP   ++FD+  + 
Sbjct: 17  YFVRHHHPE---NGTLLGFWIYLMSDCLIFACLFACYAVLGRNYAGGPTGAELFDLPLVA 73

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           ++T +LLLSS++  FAMLA   K+  + T+ WL++T   G  FI  E+YEF HLI   A 
Sbjct: 74  LNTALLLLSSITYGFAMLAMQAKKQQN-TIFWLIITGLLGAGFIYFELYEFLHLIHEGAG 132

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           P RS FL+SFFALVG HGLHV FG+IWL VL+ QI K GL   N RRL+CLSMFWHFLD+
Sbjct: 133 PTRSGFLTSFFALVGTHGLHVTFGIIWLVVLLFQINKHGLTEANGRRLMCLSMFWHFLDV 192

Query: 196 IWICVFSFVYLMGVV 210
           +WI VF+FVYLMGV+
Sbjct: 193 VWIGVFTFVYLMGVL 207


>gi|209546367|ref|YP_002278257.1| cytochrome o ubiquinol oxidase, subunit III [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209539224|gb|ACI59157.1| cytochrome o ubiquinol oxidase, subunit III [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 208

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 116/210 (55%), Positives = 146/210 (69%), Gaps = 5/210 (2%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           MS Q I  S     FY+ +        + T LGFW+YLMSDCL+FAV F T+ VLG+NYA
Sbjct: 3   MSDQTIDTSEKPE-FYLTEDHHPE---NSTNLGFWLYLMSDCLIFAVLFATHGVLGRNYA 58

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
           AGP+P D+FD+  + ++T +LLLSS++  FAML         +T+ WL VT  FG  FI 
Sbjct: 59  AGPSPADLFDLPIVALNTSMLLLSSITYGFAMLQMERNA-KAETLFWLAVTGLFGAAFIG 117

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           +E+YEF HLI   A P RSAFLSSFF LVG HGLHV FG+IWL  L++Q+   GL   N+
Sbjct: 118 LELYEFIHLIHEGAGPTRSAFLSSFFTLVGTHGLHVTFGIIWLITLMVQVSMHGLAEANR 177

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RRL+CLSMFWHFLD++WI VFSFVYL+GV+
Sbjct: 178 RRLMCLSMFWHFLDVVWIGVFSFVYLLGVL 207


>gi|292487460|ref|YP_003530332.1| cytochrome o ubiquinol oxidase subunit III [Erwinia amylovora
           CFBP1430]
 gi|292898702|ref|YP_003538071.1| cytochrome O ubiquinol oxidase subunit III [Erwinia amylovora ATCC
           49946]
 gi|291198550|emb|CBJ45658.1| cytochrome O ubiquinol oxidase subunit III [Erwinia amylovora ATCC
           49946]
 gi|291552879|emb|CBA19924.1| cytochrome o ubiquinol oxidase subunit III [Erwinia amylovora
           CFBP1430]
 gi|312171564|emb|CBX79822.1| cytochrome o ubiquinol oxidase subunit III [Erwinia amylovora ATCC
           BAA-2158]
          Length = 204

 Score =  142 bits (358), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 97/197 (49%), Positives = 127/197 (64%), Gaps = 1/197 (0%)

Query: 14  LFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISG 73
                 +            GFWIYLMSDC++FA  F TY V+  N A GPA  D+F++  
Sbjct: 9   HHDAHAEHGHHDAGANKVFGFWIYLMSDCIIFATLFATYGVMVNNTAGGPAGKDIFELPF 68

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           + V T +LLLSS++  FA++ +  K      + WL +T  FG+ FI MEIYEF HLI+  
Sbjct: 69  VLVETALLLLSSITYGFAVI-NMNKGHKGAVIGWLALTFLFGLGFIGMEIYEFHHLIAEG 127

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
             P RS FLS FF LVG HGLHV  GLIW+ VL+ Q+ K+GL   N+ R++CLS+FWHFL
Sbjct: 128 FGPDRSGFLSGFFTLVGTHGLHVTSGLIWMLVLMYQVAKRGLNDTNRTRIMCLSLFWHFL 187

Query: 194 DLIWICVFSFVYLMGVV 210
           D++WICVF+ VYLMGV+
Sbjct: 188 DVVWICVFTIVYLMGVM 204


>gi|326317720|ref|YP_004235392.1| cytochrome o ubiquinol oxidase subunit III [Acidovorax avenae
           subsp. avenae ATCC 19860]
 gi|323374556|gb|ADX46825.1| cytochrome o ubiquinol oxidase, subunit III [Acidovorax avenae
           subsp. avenae ATCC 19860]
          Length = 210

 Score =  142 bits (357), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 114/196 (58%), Positives = 145/196 (73%), Gaps = 4/196 (2%)

Query: 15  FYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
           +++ ++       +GT LGFW+YLMSDCL+FA  F TY VLG++YAAGP    +FD+S +
Sbjct: 19  YHLAEEPHPE---NGTALGFWLYLMSDCLIFAALFATYGVLGRSYAAGPTGAQLFDLSLV 75

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            ++T  LLLSS++  FAML    K  +  T+ WL VT  FG+ F+ +E+YEF HLI   A
Sbjct: 76  AINTAFLLLSSITFGFAMLQ-KQKGNVGGTLGWLAVTGLFGLCFLGLELYEFHHLIHEGA 134

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            PQRSAFLS+FF LVG HGLHV FGLIWL VL+IQI K GLI  N+RRL+CLSMFWHFLD
Sbjct: 135 GPQRSAFLSAFFTLVGTHGLHVTFGLIWLVVLMIQISKHGLIHENKRRLMCLSMFWHFLD 194

Query: 195 LIWICVFSFVYLMGVV 210
           ++WI VF+FVYLMGV+
Sbjct: 195 VVWIGVFTFVYLMGVL 210


>gi|120610895|ref|YP_970573.1| cytochrome c oxidase subunit III [Acidovorax citrulli AAC00-1]
 gi|120589359|gb|ABM32799.1| cytochrome bo3 quinol oxidase subunit 3 [Acidovorax citrulli
           AAC00-1]
          Length = 210

 Score =  142 bits (357), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 111/196 (56%), Positives = 144/196 (73%), Gaps = 4/196 (2%)

Query: 15  FYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
           +++ ++       +GT LGFW+YLMSDCL+FA  F TY VLG++YAAGP    +FD++ +
Sbjct: 19  YHLAEEPHPE---NGTALGFWLYLMSDCLIFAALFATYGVLGRSYAAGPTGAQLFDLTLV 75

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            ++T  LLLSS++  FAML      +   T+ WL +T  FG+ F+ +E+YEF HLI   A
Sbjct: 76  AINTAFLLLSSITFGFAMLQKQKGNVR-GTLGWLAITGLFGLCFLGLELYEFHHLIHQGA 134

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            PQRSAFLS+FF LVG HGLHV FGLIWL VL+IQI K GLI  N+RRL+CLSMFWHFLD
Sbjct: 135 GPQRSAFLSAFFTLVGTHGLHVTFGLIWLVVLMIQIGKHGLIHENKRRLMCLSMFWHFLD 194

Query: 195 LIWICVFSFVYLMGVV 210
           ++WI VF+FVYLMGV+
Sbjct: 195 VVWIGVFTFVYLMGVL 210


>gi|15887495|ref|NP_353176.1| cytochrome o ubiquinol oxidase subunit III [Agrobacterium
           tumefaciens str. C58]
 gi|15155018|gb|AAK85961.1| cytochrome o ubiquinol oxidase subunit III [Agrobacterium
           tumefaciens str. C58]
          Length = 208

 Score =  142 bits (357), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 115/198 (58%), Positives = 150/198 (75%), Gaps = 4/198 (2%)

Query: 13  SLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
            +FY+K+        +GT +GFW+YLMSDCL+FAV F TYAVLG++YAAGP+  D+FD+ 
Sbjct: 15  PVFYLKEDHHPE---NGTSIGFWLYLMSDCLIFAVLFATYAVLGRSYAAGPSGADLFDLK 71

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + ++T  LLLSS++  FAML    +++   T+ WL +T  FG+ F+ +E+YEF HLI  
Sbjct: 72  LVAINTGFLLLSSITYGFAMLEMEKQKVKS-TLIWLGITGLFGLAFLAVELYEFHHLIEE 130

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
            A PQRSAFLS+FFALVG HGLHV FG IWL  L++Q+ K GLI+ N+RRL+CLSMFWHF
Sbjct: 131 GAGPQRSAFLSAFFALVGTHGLHVTFGTIWLVTLMVQVAKHGLIAANKRRLMCLSMFWHF 190

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD+IWI VFSFVYLMGV+
Sbjct: 191 LDVIWIGVFSFVYLMGVL 208


>gi|188534642|ref|YP_001908439.1| Cytochrome o ubiquinol oxidase subunit III [Erwinia tasmaniensis
           Et1/99]
 gi|188029684|emb|CAO97563.1| Cytochrome o ubiquinol oxidase subunit III [Erwinia tasmaniensis
           Et1/99]
          Length = 204

 Score =  142 bits (357), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 97/197 (49%), Positives = 128/197 (64%), Gaps = 1/197 (0%)

Query: 14  LFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISG 73
                 +            GFWIYLMSDC++FA  F TY V+  N A GPA  D+F++  
Sbjct: 9   HHDAHAEHGHHDAGANKVFGFWIYLMSDCIIFATLFATYGVMVNNTAGGPAGKDIFELPF 68

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           + V T +LLLSS++  FA++ +  K      + WL +T  FG+ FI MEIYEF HLI+  
Sbjct: 69  VLVETALLLLSSITYGFAVI-NMNKGQKGAVIGWLAMTFLFGLGFIGMEIYEFHHLIAEG 127

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
             P RS FLS+FF LVG HGLHV  GLIW+ VL+ Q+ K+GL   N+ R++CLS+FWHFL
Sbjct: 128 FGPDRSGFLSAFFTLVGTHGLHVTSGLIWMLVLMYQVAKRGLSDSNRTRIMCLSLFWHFL 187

Query: 194 DLIWICVFSFVYLMGVV 210
           D++WICVF+ VYLMGV+
Sbjct: 188 DVVWICVFTIVYLMGVM 204


>gi|134095868|ref|YP_001100943.1| cytochrome o ubiquinol oxidase subunit III [Herminiimonas
           arsenicoxydans]
 gi|133739771|emb|CAL62822.1| Cytochrome o ubiquinol oxidase subunit 3 (Cytochrome o ubiquinol
           oxidase subunit III) [Herminiimonas arsenicoxydans]
          Length = 214

 Score =  142 bits (357), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 109/207 (52%), Positives = 142/207 (68%), Gaps = 5/207 (2%)

Query: 4   QKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGP 63
             +  +   + +YVK+          T LGFWIYLMSDCL+FA  F TYAVLG++YA GP
Sbjct: 12  SAMSSADASTRYYVKEHHPE----SSTSLGFWIYLMSDCLIFACLFATYAVLGRSYAGGP 67

Query: 64  APIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEI 123
              ++FD+  + ++T  LL+SS++   AML +   R+   T+ WL +T   G  F+ +E+
Sbjct: 68  TGAELFDLPLVAMNTAFLLVSSITYGVAMLEAHRNRVRS-TLIWLAITGMLGAGFLALEL 126

Query: 124 YEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRL 183
           YEF HLI   A PQ SAFL+SFFALVG HGLHV FG+IWL VL+ Q+ K GL   N+RRL
Sbjct: 127 YEFNHLIHEGAGPQTSAFLTSFFALVGTHGLHVTFGIIWLIVLMFQVGKFGLNVENKRRL 186

Query: 184 ICLSMFWHFLDLIWICVFSFVYLMGVV 210
           +CLSMFWHFLD+IWI VF+FVYLMGV+
Sbjct: 187 MCLSMFWHFLDVIWIGVFTFVYLMGVL 213


>gi|50120080|ref|YP_049247.1| cytochrome o ubiquinol oxidase subunit III [Pectobacterium
           atrosepticum SCRI1043]
 gi|49610606|emb|CAG74051.1| cytochrome o ubiquinol oxidase subunit III [Pectobacterium
           atrosepticum SCRI1043]
          Length = 204

 Score =  142 bits (357), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 96/194 (49%), Positives = 126/194 (64%), Gaps = 1/194 (0%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
              +            GFW+YLMSD ++F   F TYAVL    A GP+  D+F +  + V
Sbjct: 12  AHAEHGHHDTGANKVFGFWVYLMSDLIIFGSLFATYAVLVNGTAGGPSGKDIFQLPFVLV 71

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T  LL SS++   AM+A   K    +  +WL VT  FG++FI MEIYEF HLI     P
Sbjct: 72  ETFALLFSSITYGMAMIA-MNKGNKSQVNTWLGVTFLFGLVFIGMEIYEFHHLIVEGYGP 130

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
            RSAFLS+FFALVG HGLHV  GLIWL +++IQ+ K+GL + N+ RL+CLS+FWHFLD++
Sbjct: 131 DRSAFLSAFFALVGTHGLHVTGGLIWLVIMMIQVSKRGLTATNKTRLMCLSLFWHFLDVV 190

Query: 197 WICVFSFVYLMGVV 210
           WICVF+ VYL+G +
Sbjct: 191 WICVFTVVYLLGAI 204


>gi|149926919|ref|ZP_01915178.1| cytochrome o ubiquinol oxidase, subunit III [Limnobacter sp.
           MED105]
 gi|149824471|gb|EDM83689.1| cytochrome o ubiquinol oxidase, subunit III [Limnobacter sp.
           MED105]
          Length = 207

 Score =  142 bits (357), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 110/210 (52%), Positives = 145/210 (69%), Gaps = 4/210 (1%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           MS   +    + S  Y           +G+ LGFWIYLMSDCL+FA  F TYAV+G+NYA
Sbjct: 1   MSDLTMNAPTDPSARYYVKDHHPK---NGSSLGFWIYLMSDCLIFACLFATYAVIGRNYA 57

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
            GP   ++FD++ + ++T  LLLSS++   A +     R + KT+ WL +T   G+ F+ 
Sbjct: 58  GGPTGAEIFDLNLVALNTAFLLLSSITYGVA-MVGMQNRNVKKTIQWLAITGVLGLAFLA 116

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           +EIYEF H IS+ A PQ S FL++FFALVG HGLHVFFG+IWL VL+ Q+ K GLI  N+
Sbjct: 117 VEIYEFWHFISIGATPQTSGFLTAFFALVGTHGLHVFFGIIWLVVLLFQLKKHGLIVENR 176

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RR++CLSMFWHFLD+IWI VF+FVYLMGV+
Sbjct: 177 RRVMCLSMFWHFLDVIWIGVFTFVYLMGVL 206


>gi|261822514|ref|YP_003260620.1| cytochrome o ubiquinol oxidase subunit III [Pectobacterium wasabiae
           WPP163]
 gi|261606527|gb|ACX89013.1| cytochrome o ubiquinol oxidase, subunit III [Pectobacterium
           wasabiae WPP163]
          Length = 204

 Score =  142 bits (357), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 96/194 (49%), Positives = 126/194 (64%), Gaps = 1/194 (0%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
              +            GFW+YLMSD ++F   F TYAVL    A GP+  D+F +  + V
Sbjct: 12  AHAEHGHHDTGANKVFGFWVYLMSDLIIFGSLFATYAVLVNGTAGGPSGKDIFQLPFVLV 71

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T  LL SS++   AM+A   K    +  +WL VT  FG++FI MEIYEF HLI     P
Sbjct: 72  ETFALLFSSITYGMAMIA-MNKGNKSQVNTWLGVTFLFGLVFIGMEIYEFHHLIVEGYGP 130

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
            RSAFLS+FFALVG HGLHV  GLIWL +++IQ+ K+GL + N+ RL+CLS+FWHFLD++
Sbjct: 131 DRSAFLSAFFALVGTHGLHVTGGLIWLVIMMIQVSKRGLTATNKTRLMCLSLFWHFLDVV 190

Query: 197 WICVFSFVYLMGVV 210
           WICVF+ VYL+G +
Sbjct: 191 WICVFTVVYLLGAI 204


>gi|16126015|ref|NP_420579.1| ubiquinol oxidase subunit III [Caulobacter crescentus CB15]
 gi|221234786|ref|YP_002517222.1| quinol cytochrome oxidase polypeptide III [Caulobacter crescentus
           NA1000]
 gi|13423197|gb|AAK23747.1| ubiquinol oxidase subunit III [Caulobacter crescentus CB15]
 gi|220963958|gb|ACL95314.1| quinol cytochrome oxidase polypeptide III [Caulobacter crescentus
           NA1000]
          Length = 208

 Score =  141 bits (356), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 111/209 (53%), Positives = 150/209 (71%), Gaps = 4/209 (1%)

Query: 2   SRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAA 61
           +  +   + +   FY+  +       +GT LGFWIYLMSDCL+FAV F  YAVLG++YAA
Sbjct: 3   AHSQAVSAADTDQFYLTKEHHPE---NGTLLGFWIYLMSDCLIFAVLFACYAVLGQSYAA 59

Query: 62  GPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIM 121
           GP+  D+FD+  + ++T +LLLSS++  FAM+A+  + +    + WL VT   G+ F+ +
Sbjct: 60  GPSGADLFDLKLVAINTGLLLLSSITYGFAMIAAQAREVRP-VLIWLGVTGLLGVGFLSL 118

Query: 122 EIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQR 181
           EIYEFAHLI   A PQRSAFLS+FF LVG HGLHV FG+IWL  L++Q+ ++GL    +R
Sbjct: 119 EIYEFAHLIHEGATPQRSAFLSAFFLLVGTHGLHVTFGVIWLVTLMVQVAQRGLGIEMRR 178

Query: 182 RLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RL+CLSMFWHFLD+IWI VFSFVYL+GV+
Sbjct: 179 RLMCLSMFWHFLDVIWIGVFSFVYLLGVL 207


>gi|253687436|ref|YP_003016626.1| cytochrome o ubiquinol oxidase, subunit III [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|251754014|gb|ACT12090.1| cytochrome o ubiquinol oxidase, subunit III [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 204

 Score =  141 bits (356), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 96/194 (49%), Positives = 126/194 (64%), Gaps = 1/194 (0%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
              +            GFW+YLMSD ++F   F TYAVL    A GP+  D+F +  + V
Sbjct: 12  AHAEHGHHDTGANKVFGFWVYLMSDLIIFGSLFATYAVLVNGTAGGPSGKDIFQLPFVLV 71

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T  LL SS++   AM+A   K    +  +WL VT  FG++FI MEIYEF HLI     P
Sbjct: 72  ETFALLFSSITYGMAMIA-MNKGNKSQVNAWLGVTFLFGLVFIGMEIYEFHHLIVEGYGP 130

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
            RSAFLS+FFALVG HGLHV  GLIWL +++IQ+ K+GL + N+ RL+CLS+FWHFLD++
Sbjct: 131 DRSAFLSAFFALVGTHGLHVTGGLIWLVIMMIQVSKRGLTATNKTRLMCLSLFWHFLDVV 190

Query: 197 WICVFSFVYLMGVV 210
           WICVF+ VYL+G +
Sbjct: 191 WICVFTVVYLLGAI 204


>gi|62289031|ref|YP_220824.1| ubiquinol oxidase subunit III [Brucella abortus bv. 1 str. 9-941]
 gi|82698968|ref|YP_413542.1| cytochrome c oxidase subunit III [Brucella melitensis biovar
           Abortus 2308]
 gi|189023306|ref|YP_001934074.1| Cytochrome c oxidase, subunit III [Brucella abortus S19]
 gi|237814518|ref|ZP_04593516.1| cytochrome o ubiquinol oxidase, subunit III [Brucella abortus str.
           2308 A]
 gi|254696474|ref|ZP_05158302.1| Cytochrome c oxidase, subunit III [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254731386|ref|ZP_05189964.1| Cytochrome c oxidase, subunit III [Brucella abortus bv. 4 str. 292]
 gi|260546325|ref|ZP_05822065.1| cytochrome c oxidase [Brucella abortus NCTC 8038]
 gi|260759124|ref|ZP_05871472.1| cytochrome o ubiquinol oxidase subunit III [Brucella abortus bv. 4
           str. 292]
 gi|260760849|ref|ZP_05873192.1| cytochrome o ubiquinol oxidase subunit III [Brucella abortus bv. 2
           str. 86/8/59]
 gi|62195163|gb|AAX73463.1| ubiquinol oxidase subunit III [Brucella abortus bv. 1 str. 9-941]
 gi|82615069|emb|CAJ09997.1| Cytochrome c oxidase, subunit III [Brucella melitensis biovar
           Abortus 2308]
 gi|189018878|gb|ACD71600.1| Cytochrome c oxidase, subunit III [Brucella abortus S19]
 gi|237789355|gb|EEP63565.1| cytochrome o ubiquinol oxidase, subunit III [Brucella abortus str.
           2308 A]
 gi|260096432|gb|EEW80308.1| cytochrome c oxidase [Brucella abortus NCTC 8038]
 gi|260669442|gb|EEX56382.1| cytochrome o ubiquinol oxidase subunit III [Brucella abortus bv. 4
           str. 292]
 gi|260671281|gb|EEX58102.1| cytochrome o ubiquinol oxidase subunit III [Brucella abortus bv. 2
           str. 86/8/59]
          Length = 209

 Score =  141 bits (356), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 97/210 (46%), Positives = 131/210 (62%), Gaps = 1/210 (0%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           MS  +   +P          ++       T +GFWIYLMSDC++F+  F TYAVL   +A
Sbjct: 1   MSAIQHTAAPYLGRNDHPAHEDHHDAGSTTLVGFWIYLMSDCILFSGLFATYAVLAHQFA 60

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
            GP   ++FD+  + V T++LL+SSL+   A L+   K      + WL VT   G  F+ 
Sbjct: 61  GGPTGRELFDLQFVLVETMLLLVSSLTYGLATLS-MYKNNRSGVLGWLGVTFLLGAAFLA 119

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           MEIYEF HLI   A P RS+FLS+FF LVG HGLH+  GLIW+ VL   +L+ GL   N+
Sbjct: 120 MEIYEFHHLIVEGAGPDRSSFLSAFFTLVGTHGLHITSGLIWILVLSAMLLRDGLTERNR 179

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
            R++CLS+FWHFLD+IWI VF+ VYL+GV+
Sbjct: 180 TRVMCLSLFWHFLDIIWIGVFTLVYLLGVL 209


>gi|86360306|ref|YP_472194.1| cytochrome O ubiquinol oxidase, subunit III protein [Rhizobium etli
           CFN 42]
 gi|86284408|gb|ABC93467.1| cytochrome O ubiquinol oxidase, subunit III protein [Rhizobium etli
           CFN 42]
          Length = 206

 Score =  141 bits (355), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 116/210 (55%), Positives = 147/210 (70%), Gaps = 5/210 (2%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           MS Q I ++     FY+ +          T LGFW+YLMSDCL+FAV F T+ VLG+NYA
Sbjct: 1   MSDQTIDRAEKPE-FYLTEDHHPEG---STNLGFWLYLMSDCLIFAVLFATHGVLGRNYA 56

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
           AGP+P D+FD+  + ++T +LLLSS++  FAML         +T+ WL VT  FG  FI 
Sbjct: 57  AGPSPADLFDLPIVALNTSMLLLSSITYGFAMLQMERNA-KAETLFWLAVTGLFGAAFIG 115

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           +E+YEF HLI   A P RSAFLSSFF LVG HGLHV FG+IWL  L++Q+   GL+  N+
Sbjct: 116 LELYEFIHLIHEGAGPTRSAFLSSFFTLVGTHGLHVTFGIIWLITLMVQVSMHGLVEANR 175

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RRL+CLSMFWHFLD++WI VFSFVYL+GVV
Sbjct: 176 RRLMCLSMFWHFLDVVWIGVFSFVYLLGVV 205


>gi|218532590|ref|YP_002423406.1| cytochrome o ubiquinol oxidase subunit III [Methylobacterium
           chloromethanicum CM4]
 gi|218524893|gb|ACK85478.1| cytochrome o ubiquinol oxidase, subunit III [Methylobacterium
           chloromethanicum CM4]
          Length = 215

 Score =  141 bits (355), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 116/191 (60%), Positives = 141/191 (73%), Gaps = 4/191 (2%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTI 79
           +        GT LGFWIYLMSDCL+FAV F TYAVLG++YAAGP+P D+FD+  + V+T 
Sbjct: 28  EHHPEG---GTMLGFWIYLMSDCLIFAVLFATYAVLGRSYAAGPSPKDLFDLPIVAVNTS 84

Query: 80  VLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS 139
           +LL SS++  FAMLA      + KT  WL +T  FG  F+ +E+YEFAHLI   A PQRS
Sbjct: 85  MLLFSSITYGFAMLAMEKDD-LAKTQLWLAITGLFGAAFVGLELYEFAHLIHEGATPQRS 143

Query: 140 AFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWIC 199
            FLS+FF LVG HGLHV FGLIWL  L+IQ   KGL+  N+RRL+CLSMFWHFLD+IWI 
Sbjct: 144 GFLSAFFTLVGTHGLHVTFGLIWLVTLMIQTRLKGLVVENKRRLMCLSMFWHFLDVIWIG 203

Query: 200 VFSFVYLMGVV 210
           VF+FVYLMGV+
Sbjct: 204 VFTFVYLMGVL 214


>gi|313756954|gb|ADR78285.1| chimeric cytochrome c oxidase subunit III [synthetic construct]
          Length = 386

 Score =  141 bits (355), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 39/201 (19%), Positives = 79/201 (39%), Gaps = 15/201 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPID 67
                 +     G   G  +++ S+             +    T  + G     G  P++
Sbjct: 192 TYQGHHTPPVQKGLRYGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGGHWPPTGITPLN 251

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
             ++    ++T VL  S  S ++A  +       ++ +  LL+T   G+ F +++  E+ 
Sbjct: 252 PLEVP--LLNTSVLAASYYSYTWAHHSLMENN-RNQMIQALLITILLGLYFTLLQASEY- 307

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
                        + S+FF   G HG+HV  G  +L    I+ L     S +       +
Sbjct: 308 --FESPFTISDGIYGSTFFMTTGFHGMHVIIGSTYLTACFIRQLMFHFTSKHHFGFEAAA 365

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ ++  +Y  G
Sbjct: 366 WYWHFVDVVWLFLYVSIYWWG 386


>gi|86747366|ref|YP_483862.1| cytochrome c oxidase, subunit III [Rhodopseudomonas palustris HaA2]
 gi|86570394|gb|ABD04951.1| Cytochrome c oxidase, subunit III [Rhodopseudomonas palustris HaA2]
          Length = 209

 Score =  140 bits (354), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 114/210 (54%), Positives = 150/210 (71%), Gaps = 2/210 (0%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           MS           +F+V D+     +   T LGFWIYLMSDCL+FA+ F TY VLG NYA
Sbjct: 1   MSVVAAAPQAAEPVFHVVDEHAHP-EGASTMLGFWIYLMSDCLIFAILFATYGVLGANYA 59

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
           AGPAP D+FD+  + V+T +LL+SS++  FAML    ++ +  T++WL VT  FG+ F+ 
Sbjct: 60  AGPAPKDLFDLKLVAVNTAMLLMSSITYGFAMLTMEKRQ-VGATLAWLGVTGLFGLAFLG 118

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           +E+YEF H+I   A PQRSAFLSSFF LVG HGLHV FG+IWL  L++Q+ + GLI  N+
Sbjct: 119 IELYEFHHMIHEGATPQRSAFLSSFFTLVGTHGLHVTFGIIWLVTLMVQVARAGLIEANR 178

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RRL+CLSMFWHFLD++WI VF+FVYL+G +
Sbjct: 179 RRLMCLSMFWHFLDVVWIGVFTFVYLLGTL 208


>gi|241667023|ref|YP_002985107.1| cytochrome o ubiquinol oxidase, subunit III [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240862480|gb|ACS60145.1| cytochrome o ubiquinol oxidase, subunit III [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 208

 Score =  140 bits (354), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 115/210 (54%), Positives = 146/210 (69%), Gaps = 5/210 (2%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           MS Q I  +     FY+ +        + T LGFW+YLMSDCL+FAV F T+ VLG+NYA
Sbjct: 3   MSDQTIDTAEKPE-FYLTEDHHPE---NSTNLGFWLYLMSDCLIFAVLFATHGVLGRNYA 58

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
           AGP+P D+FD+  + ++T +LL SS++  FAML         +T+ WL VT  FG  FI 
Sbjct: 59  AGPSPADLFDLPIVALNTSMLLFSSITYGFAMLQMERNA-KAETLFWLGVTGLFGAAFIG 117

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           +E+YEF HLI   A P RSAFLSSFF LVG HGLHV FG+IWL  L++Q+   GLI  N+
Sbjct: 118 LELYEFIHLIHEGAGPTRSAFLSSFFTLVGTHGLHVTFGIIWLITLMVQVSMHGLIEANR 177

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RRL+CLSMFWHFLD++WI VFSFVYL+GV+
Sbjct: 178 RRLMCLSMFWHFLDVVWIGVFSFVYLLGVL 207


>gi|188584038|ref|YP_001927483.1| cytochrome o ubiquinol oxidase, subunit III [Methylobacterium
           populi BJ001]
 gi|179347536|gb|ACB82948.1| cytochrome o ubiquinol oxidase, subunit III [Methylobacterium
           populi BJ001]
          Length = 215

 Score =  140 bits (354), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 115/191 (60%), Positives = 140/191 (73%), Gaps = 4/191 (2%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTI 79
           +         T LGFWIYLMSDCL+FAV F TYAVLG++YAAGP+P D+FD+  + V+T 
Sbjct: 28  EHHPEG---STMLGFWIYLMSDCLIFAVLFATYAVLGRSYAAGPSPKDLFDLPIVAVNTS 84

Query: 80  VLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS 139
           +LL SS++  FAMLA     L  KT  WL VT  FG  F+ +E++EF+HLI   A PQRS
Sbjct: 85  MLLFSSITYGFAMLAMEKDDLS-KTQLWLAVTGLFGAAFVGLELWEFSHLIHEGATPQRS 143

Query: 140 AFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWIC 199
            FLS+FF LVG HGLHV FGLIWL  L++Q   KGLI  N+RRL+CLSMFWHFLD+IWI 
Sbjct: 144 GFLSAFFTLVGTHGLHVTFGLIWLVTLMVQTRWKGLIPENKRRLMCLSMFWHFLDVIWIG 203

Query: 200 VFSFVYLMGVV 210
           VF+FVYLMGV+
Sbjct: 204 VFTFVYLMGVL 214


>gi|121595098|ref|YP_986994.1| cytochrome c oxidase subunit III [Acidovorax sp. JS42]
 gi|120607178|gb|ABM42918.1| cytochrome bo3 quinol oxidase subunit 3 [Acidovorax sp. JS42]
          Length = 211

 Score =  140 bits (354), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 109/193 (56%), Positives = 138/193 (71%), Gaps = 1/193 (0%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
                     +GT LGFW+YLMSDCL+FA  F TY VLG++YAAGP    +FD++ + ++
Sbjct: 20  YHLAHEPHPENGTSLGFWLYLMSDCLIFAALFATYGVLGRSYAAGPTGAQLFDLTLVAIN 79

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T  LL SS++  FAML      +   T++WL VT   G+ F+ +E+YEFAH+I + A PQ
Sbjct: 80  TAFLLTSSITFGFAMLQKQAGNVR-GTLTWLAVTGLLGLAFLGVELYEFAHMIHLGATPQ 138

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
           RSAFLSSFF LVG HGLHV FGLIWL  L++QI K GLI  N+RRL CLSMFWHFLD++W
Sbjct: 139 RSAFLSSFFTLVGTHGLHVTFGLIWLVTLMLQISKHGLIHENKRRLNCLSMFWHFLDVVW 198

Query: 198 ICVFSFVYLMGVV 210
           I VF+FVYLMGV+
Sbjct: 199 IGVFTFVYLMGVL 211


>gi|73540687|ref|YP_295207.1| transmembrane cytochrome O ubiquinol oxidase (subunit III)
           oxidoreductase protein [Ralstonia eutropha JMP134]
 gi|72118100|gb|AAZ60363.1| probable transmembrane cytochrome O ubiquinol oxidase (subunit III)
           oxidoreductase protein [Ralstonia eutropha JMP134]
          Length = 217

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 95/210 (45%), Positives = 132/210 (62%), Gaps = 4/210 (1%)

Query: 4   QKIGKSPNFSLFYVKDKKESCVDHD---GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
            + G +   +  +  D+      HD    T  GFW+YLMSDC++FA  F  +AVL    A
Sbjct: 9   DRFGAAQAPAHAHSHDETHDHAHHDTSENTIFGFWLYLMSDCILFACLFAAFAVLRGEVA 68

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
            GP+  ++F+++ + V T +LL SS++  FAM++    R   + + WL +T   G  F+ 
Sbjct: 69  GGPSAKELFELNYVLVETFILLFSSITYGFAMISMQ-NRSKGRVLVWLGITFLLGAAFMY 127

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           MEI EF HLI+  A P RSAFLSSFF LVG HGLHV  G++W+ VL+ Q+ KKGL     
Sbjct: 128 MEINEFHHLIAEGAGPSRSAFLSSFFTLVGTHGLHVASGMVWMLVLMWQVSKKGLTPTMS 187

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           +RL CLS+FWHFLD++WI VF+ VYLMG +
Sbjct: 188 KRLNCLSLFWHFLDVVWIGVFTVVYLMGAM 217


>gi|222084385|ref|YP_002542914.1| cytochrome o ubiquinol oxidase, subunit III [Agrobacterium
           radiobacter K84]
 gi|221721833|gb|ACM24989.1| cytochrome o ubiquinol oxidase, subunit III [Agrobacterium
           radiobacter K84]
          Length = 209

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 112/196 (57%), Positives = 142/196 (72%), Gaps = 4/196 (2%)

Query: 15  FYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
           FY+ ++         T LGFWIY+MSDCL+FAV F TYAVLG NYAAGP+P D+F++  +
Sbjct: 17  FYLTEEHHPEG---STMLGFWIYIMSDCLIFAVLFATYAVLGHNYAAGPSPADLFELPLV 73

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            ++T +LL SS++  FAMLA         T+ WL +T  FG  FI  E+YEF HLI   A
Sbjct: 74  ALNTAMLLFSSITYGFAMLAMEKGN-KSGTMMWLAITGLFGAAFIYFELYEFYHLILEGA 132

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            PQRSAFLS+FFALVG HGLHV  G++WL  L++Q+ + GLI  N+RRL+CLSMFWHFLD
Sbjct: 133 GPQRSAFLSAFFALVGTHGLHVTVGIVWLITLMVQVSQHGLIPENKRRLMCLSMFWHFLD 192

Query: 195 LIWICVFSFVYLMGVV 210
           ++WI VFSFVYLMGV+
Sbjct: 193 VVWIGVFSFVYLMGVL 208


>gi|150376511|ref|YP_001313107.1| cytochrome o ubiquinol oxidase subunit III [Sinorhizobium medicae
           WSM419]
 gi|150031058|gb|ABR63174.1| Cytochrome o ubiquinol oxidase subunit III [Sinorhizobium medicae
           WSM419]
          Length = 210

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 119/196 (60%), Positives = 152/196 (77%), Gaps = 4/196 (2%)

Query: 15  FYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
           FY+K++         T LGFW+YLMSDCL+FAV F T+AVLG+NYAAGP+P D+FD+  I
Sbjct: 18  FYLKEEHHPEG---STMLGFWLYLMSDCLIFAVLFATHAVLGRNYAAGPSPADLFDLPLI 74

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            ++T +LL SS++  FAML     RL   T++W+ VTA FG++F+ +E+YEFAHLI   A
Sbjct: 75  ALNTSMLLFSSITYGFAMLEMEKGRLR-ATLAWMAVTALFGIVFVGLELYEFAHLIHEGA 133

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            PQRSAFLSSFF LVG HGLHV  G+IW+FVL+ Q+ K GLI+ N+RRL+CLSMFWHFLD
Sbjct: 134 GPQRSAFLSSFFTLVGTHGLHVSSGIIWMFVLMAQVAKHGLIAENKRRLMCLSMFWHFLD 193

Query: 195 LIWICVFSFVYLMGVV 210
           ++WI VFSFVYLMGV+
Sbjct: 194 VVWIGVFSFVYLMGVL 209


>gi|325291582|ref|YP_004277446.1| cytochrome ubiquinol oxidase subunit III [Agrobacterium sp. H13-3]
 gi|325059435|gb|ADY63126.1| cytochrome ubiquinol oxidase subunit III [Agrobacterium sp. H13-3]
          Length = 208

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 114/198 (57%), Positives = 148/198 (74%), Gaps = 4/198 (2%)

Query: 13  SLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
            +FY+K+        +GT LGFW+YLMSDCL+FA  F TYAV+G+NYAAGP+  D+FD+ 
Sbjct: 15  PVFYLKEDHHPE---NGTSLGFWLYLMSDCLIFATLFATYAVVGRNYAAGPSGADLFDLK 71

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + ++T  LL SS++  FAML    +++   T+ WL +T  FG+ F+ +E+YEF HLI  
Sbjct: 72  LVAINTAFLLFSSITYGFAMLEMEKQKVKT-TLIWLGITGLFGLAFLAVELYEFHHLIEE 130

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
            A PQRSAFLS+FFALVG HGLHV FG+IWL  L+ Q+ K GLI+ N+RRL+CLSMFWHF
Sbjct: 131 GAGPQRSAFLSAFFALVGTHGLHVTFGVIWLVTLMFQVAKHGLIAANKRRLMCLSMFWHF 190

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD+IWI VFSFVYLMGV+
Sbjct: 191 LDVIWIGVFSFVYLMGVL 208


>gi|167461105|ref|ZP_02326194.1| cytochrome caa3 oxidase subunit III CoxC [Paenibacillus larvae
           subsp. larvae BRL-230010]
          Length = 318

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 66/192 (34%), Positives = 114/192 (59%), Gaps = 1/192 (0%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++     LGFW++L  + ++F   F TY  L  +   G    ++F +  I ++T
Sbjct: 127 EPEKATLEGKNKVLGFWLFLGGETVLFGCLFATYLALRNSVGDGKTSDELFQLPMIALAT 186

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
            +LL SSL+  FA++A    R +   + WL ++   G+ F+ +EIYEF   +        
Sbjct: 187 FLLLTSSLTSVFAVMALHRHR-LQSMLRWLAISVVLGLAFLGLEIYEFVEYVHEGHGFTT 245

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF +SF++LVG HG HV FG++W+ +L+IQ  KKGL +    +    +++WHF+D++W+
Sbjct: 246 SAFSTSFYSLVGFHGAHVLFGILWISLLIIQGSKKGLTTVTAPKFYIAALYWHFIDVVWV 305

Query: 199 CVFSFVYLMGVV 210
            +F+ VYLMG V
Sbjct: 306 FIFTVVYLMGKV 317


>gi|317492922|ref|ZP_07951346.1| cytochrome o ubiquinol oxidase [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316919044|gb|EFV40379.1| cytochrome o ubiquinol oxidase [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 206

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 99/194 (51%), Positives = 130/194 (67%), Gaps = 1/194 (0%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
              +       D    GFW+YLMSDC++FA  F TYAVL    A GP+  D+F++  + V
Sbjct: 14  AHAEHGHHDAGDTKVFGFWVYLMSDCILFASLFATYAVLVNGTADGPSGKDIFELPFVLV 73

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T +LL SS++  FAMLA   K  +    +WL +T  FG  FI MEIYEF HLI+    P
Sbjct: 74  ETFLLLFSSITYGFAMLA-MNKGKVASVNTWLGLTFLFGAGFIAMEIYEFHHLIAEGFGP 132

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
            +SAFLS+FF LVG HG+HV  GLIW+ V++IQ+ KKGL + N+ RL+CLS+FWHFLD++
Sbjct: 133 DKSAFLSAFFTLVGTHGIHVTSGLIWIIVMMIQVGKKGLTARNRTRLMCLSLFWHFLDVV 192

Query: 197 WICVFSFVYLMGVV 210
           WICVF+ VYLMG +
Sbjct: 193 WICVFTVVYLMGAM 206


>gi|319783411|ref|YP_004142887.1| cytochrome o ubiquinol oxidase subunit III [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317169299|gb|ADV12837.1| cytochrome o ubiquinol oxidase, subunit III [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 208

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 114/198 (57%), Positives = 147/198 (74%), Gaps = 1/198 (0%)

Query: 13  SLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
           ++F+++D          T LGFWIYLMSDCL+FA+ F  Y VLG NYAAGPAP D+FD+ 
Sbjct: 11  TIFHLEDDHGHAESGSSTMLGFWIYLMSDCLIFAMLFAVYGVLGGNYAAGPAPKDLFDLP 70

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + ++T +LLLSS++  FAML  A  R+      WL++T  FG+ F+ +E+YEFAH I  
Sbjct: 71  LVALNTTMLLLSSITYGFAMLEMAKGRVRP-MQVWLVITGLFGLAFLGIELYEFAHFIHE 129

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
            A PQRS FLSSFF LVG HGLHV FGL+WL VL++Q+ + GLI+ NQRRL+CLSMFWHF
Sbjct: 130 GATPQRSGFLSSFFTLVGTHGLHVTFGLVWLVVLMVQVSRHGLIAANQRRLMCLSMFWHF 189

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD+IWI VF+FVYLMG++
Sbjct: 190 LDVIWIGVFTFVYLMGML 207


>gi|307293186|ref|ZP_07573032.1| cytochrome o ubiquinol oxidase, subunit III [Sphingobium
           chlorophenolicum L-1]
 gi|306881252|gb|EFN12468.1| cytochrome o ubiquinol oxidase, subunit III [Sphingobium
           chlorophenolicum L-1]
          Length = 207

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 113/196 (57%), Positives = 144/196 (73%), Gaps = 2/196 (1%)

Query: 15  FYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
           +++ ++     +   T LGFW+YLMSDCL+FA+ F TYAVLG +YA GP P D+FD+  I
Sbjct: 13  YHLPEEPH-LHEGHSTNLGFWMYLMSDCLIFAILFATYAVLGGSYAGGPGPKDLFDLPLI 71

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            ++T +LL SS++  FAMLA    R +  T  WL VT  FG  F+ +E+YEF+HLI   A
Sbjct: 72  ALNTAMLLFSSITYGFAMLAMEKNR-VSATQGWLFVTLLFGGAFLCIELYEFSHLIHEGA 130

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            PQRSAFLSSFF LVG HGLHV FG +WL  L++Q+ KKGLI  N+RRL+CLSMFWHFLD
Sbjct: 131 GPQRSAFLSSFFTLVGTHGLHVTFGSVWLITLMVQVAKKGLIPANKRRLMCLSMFWHFLD 190

Query: 195 LIWICVFSFVYLMGVV 210
           +IWI VF+FVYLMGV+
Sbjct: 191 VIWIGVFTFVYLMGVL 206


>gi|254563669|ref|YP_003070764.1| cytochrome o ubiquinol oxidase subunit III [Methylobacterium
           extorquens DM4]
 gi|254270947|emb|CAX26952.1| cytochrome o ubiquinol oxidase, subunit III [Methylobacterium
           extorquens DM4]
          Length = 215

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 115/191 (60%), Positives = 140/191 (73%), Gaps = 4/191 (2%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTI 79
           +        GT LGFWIYLMSDCL+FAV F TYAVLG++YAAGP+P D+FD+  + V+T 
Sbjct: 28  EHHPEG---GTMLGFWIYLMSDCLIFAVLFATYAVLGRSYAAGPSPKDLFDLPIVAVNTS 84

Query: 80  VLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS 139
           +LL SS++  FAMLA      + KT  WL +T  FG  F+ +E+YEFAHLI   A PQRS
Sbjct: 85  MLLFSSITYGFAMLAMEKDD-LAKTQLWLAITGLFGAAFVGLELYEFAHLIHEGATPQRS 143

Query: 140 AFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWIC 199
            FLS+FF LVG HGLHV FGLIWL  L+IQ   KGL+  N+ RL+CLSMFWHFLD+IWI 
Sbjct: 144 GFLSAFFTLVGTHGLHVTFGLIWLVTLMIQTRLKGLVVENKLRLMCLSMFWHFLDVIWIG 203

Query: 200 VFSFVYLMGVV 210
           VF+FVYLMGV+
Sbjct: 204 VFTFVYLMGVL 214


>gi|23500959|ref|NP_697086.1| ubiquinol oxidase subunit III [Brucella suis 1330]
 gi|161618034|ref|YP_001591921.1| cytochrome o ubiquinol oxidase, subunit III [Brucella canis ATCC
           23365]
 gi|163842320|ref|YP_001626724.1| cytochrome o ubiquinol oxidase, subunit III [Brucella suis ATCC
           23445]
 gi|225851587|ref|YP_002731820.1| cytochrome o ubiquinol oxidase subunit III [Brucella melitensis
           ATCC 23457]
 gi|254690356|ref|ZP_05153610.1| cytochrome o ubiquinol oxidase, subunit III [Brucella abortus bv. 6
           str. 870]
 gi|254694845|ref|ZP_05156673.1| cytochrome o ubiquinol oxidase, subunit III [Brucella abortus bv. 3
           str. Tulya]
 gi|254700859|ref|ZP_05162687.1| cytochrome o ubiquinol oxidase, subunit III [Brucella suis bv. 5
           str. 513]
 gi|254705225|ref|ZP_05167053.1| cytochrome o ubiquinol oxidase, subunit III [Brucella suis bv. 3
           str. 686]
 gi|254707256|ref|ZP_05169084.1| cytochrome o ubiquinol oxidase, subunit III [Brucella pinnipedialis
           M163/99/10]
 gi|254709203|ref|ZP_05171014.1| cytochrome o ubiquinol oxidase, subunit III [Brucella pinnipedialis
           B2/94]
 gi|254713372|ref|ZP_05175183.1| cytochrome o ubiquinol oxidase, subunit III [Brucella ceti
           M644/93/1]
 gi|254716270|ref|ZP_05178081.1| cytochrome o ubiquinol oxidase, subunit III [Brucella ceti
           M13/05/1]
 gi|254718264|ref|ZP_05180075.1| cytochrome o ubiquinol oxidase, subunit III [Brucella sp. 83/13]
 gi|256030727|ref|ZP_05444341.1| cytochrome o ubiquinol oxidase, subunit III [Brucella pinnipedialis
           M292/94/1]
 gi|256060187|ref|ZP_05450367.1| cytochrome o ubiquinol oxidase, subunit III [Brucella neotomae
           5K33]
 gi|256112551|ref|ZP_05453472.1| cytochrome o ubiquinol oxidase, subunit III [Brucella melitensis
           bv. 3 str. Ether]
 gi|256158734|ref|ZP_05456609.1| cytochrome o ubiquinol oxidase, subunit III [Brucella ceti
           M490/95/1]
 gi|256254131|ref|ZP_05459667.1| cytochrome o ubiquinol oxidase, subunit III [Brucella ceti B1/94]
 gi|256258610|ref|ZP_05464146.1| cytochrome o ubiquinol oxidase, subunit III [Brucella abortus bv. 9
           str. C68]
 gi|256264902|ref|ZP_05467434.1| cytochrome c oxidase [Brucella melitensis bv. 2 str. 63/9]
 gi|256368510|ref|YP_003106016.1| cytochrome o ubiquinol oxidase subunit III [Brucella microti CCM
           4915]
 gi|260169630|ref|ZP_05756441.1| cytochrome o ubiquinol oxidase subunit III [Brucella sp. F5/99]
 gi|260567308|ref|ZP_05837778.1| cytochrome c oxidase [Brucella suis bv. 4 str. 40]
 gi|260755900|ref|ZP_05868248.1| cytochrome o ubiquinol oxidase subunit III [Brucella abortus bv. 6
           str. 870]
 gi|260884924|ref|ZP_05896538.1| cytochrome o ubiquinol oxidase subunit III [Brucella abortus bv. 9
           str. C68]
 gi|261215175|ref|ZP_05929456.1| cytochrome o ubiquinol oxidase subunit III [Brucella abortus bv. 3
           str. Tulya]
 gi|261218047|ref|ZP_05932328.1| cytochrome o ubiquinol oxidase subunit III [Brucella ceti M13/05/1]
 gi|261221274|ref|ZP_05935555.1| cytochrome o ubiquinol oxidase subunit III [Brucella ceti B1/94]
 gi|261314738|ref|ZP_05953935.1| cytochrome o ubiquinol oxidase subunit III [Brucella pinnipedialis
           M163/99/10]
 gi|261316704|ref|ZP_05955901.1| cytochrome o ubiquinol oxidase subunit III [Brucella pinnipedialis
           B2/94]
 gi|261321103|ref|ZP_05960300.1| cytochrome o ubiquinol oxidase subunit III [Brucella ceti
           M644/93/1]
 gi|261324164|ref|ZP_05963361.1| cytochrome o ubiquinol oxidase subunit III [Brucella neotomae 5K33]
 gi|261751369|ref|ZP_05995078.1| cytochrome o ubiquinol oxidase subunit III [Brucella suis bv. 5
           str. 513]
 gi|261755934|ref|ZP_05999643.1| cytochrome o ubiquinol oxidase subunit III [Brucella suis bv. 3
           str. 686]
 gi|261759160|ref|ZP_06002869.1| cytochrome o ubiquinol oxidase subunit III [Brucella sp. F5/99]
 gi|265983225|ref|ZP_06095960.1| cytochrome o ubiquinol oxidase subunit III [Brucella sp. 83/13]
 gi|265987774|ref|ZP_06100331.1| cytochrome o ubiquinol oxidase subunit III [Brucella pinnipedialis
           M292/94/1]
 gi|265993991|ref|ZP_06106548.1| cytochrome o ubiquinol oxidase subunit III [Brucella melitensis bv.
           3 str. Ether]
 gi|265997235|ref|ZP_06109792.1| cytochrome o ubiquinol oxidase subunit III [Brucella ceti
           M490/95/1]
 gi|294851453|ref|ZP_06792126.1| cytochrome o ubiquinol oxidase [Brucella sp. NVSL 07-0026]
 gi|297247449|ref|ZP_06931167.1| cytochrome o ubiquinol oxidase, subunit III [Brucella abortus bv. 5
           str. B3196]
 gi|306840007|ref|ZP_07472801.1| cytochrome o ubiquinol oxidase, subunit III [Brucella sp. NF 2653]
 gi|306843644|ref|ZP_07476245.1| cytochrome o ubiquinol oxidase, subunit III [Brucella sp. BO1]
 gi|23346816|gb|AAN29001.1| ubiquinol oxidase subunit III [Brucella suis 1330]
 gi|161334845|gb|ABX61150.1| cytochrome o ubiquinol oxidase, subunit III [Brucella canis ATCC
           23365]
 gi|163673043|gb|ABY37154.1| cytochrome o ubiquinol oxidase, subunit III [Brucella suis ATCC
           23445]
 gi|225639952|gb|ACN99865.1| cytochrome o ubiquinol oxidase, subunit III [Brucella melitensis
           ATCC 23457]
 gi|255998668|gb|ACU47067.1| cytochrome o ubiquinol oxidase subunit III [Brucella microti CCM
           4915]
 gi|260156826|gb|EEW91906.1| cytochrome c oxidase [Brucella suis bv. 4 str. 40]
 gi|260676008|gb|EEX62829.1| cytochrome o ubiquinol oxidase subunit III [Brucella abortus bv. 6
           str. 870]
 gi|260874452|gb|EEX81521.1| cytochrome o ubiquinol oxidase subunit III [Brucella abortus bv. 9
           str. C68]
 gi|260916782|gb|EEX83643.1| cytochrome o ubiquinol oxidase subunit III [Brucella abortus bv. 3
           str. Tulya]
 gi|260919858|gb|EEX86511.1| cytochrome o ubiquinol oxidase subunit III [Brucella ceti B1/94]
 gi|260923136|gb|EEX89704.1| cytochrome o ubiquinol oxidase subunit III [Brucella ceti M13/05/1]
 gi|261293793|gb|EEX97289.1| cytochrome o ubiquinol oxidase subunit III [Brucella ceti
           M644/93/1]
 gi|261295927|gb|EEX99423.1| cytochrome o ubiquinol oxidase subunit III [Brucella pinnipedialis
           B2/94]
 gi|261300144|gb|EEY03641.1| cytochrome o ubiquinol oxidase subunit III [Brucella neotomae 5K33]
 gi|261303764|gb|EEY07261.1| cytochrome o ubiquinol oxidase subunit III [Brucella pinnipedialis
           M163/99/10]
 gi|261739144|gb|EEY27140.1| cytochrome o ubiquinol oxidase subunit III [Brucella sp. F5/99]
 gi|261741122|gb|EEY29048.1| cytochrome o ubiquinol oxidase subunit III [Brucella suis bv. 5
           str. 513]
 gi|261745687|gb|EEY33613.1| cytochrome o ubiquinol oxidase subunit III [Brucella suis bv. 3
           str. 686]
 gi|262551703|gb|EEZ07693.1| cytochrome o ubiquinol oxidase subunit III [Brucella ceti
           M490/95/1]
 gi|262764972|gb|EEZ10893.1| cytochrome o ubiquinol oxidase subunit III [Brucella melitensis bv.
           3 str. Ether]
 gi|263095387|gb|EEZ18988.1| cytochrome c oxidase [Brucella melitensis bv. 2 str. 63/9]
 gi|264659971|gb|EEZ30232.1| cytochrome o ubiquinol oxidase subunit III [Brucella pinnipedialis
           M292/94/1]
 gi|264661817|gb|EEZ32078.1| cytochrome o ubiquinol oxidase subunit III [Brucella sp. 83/13]
 gi|294820042|gb|EFG37041.1| cytochrome o ubiquinol oxidase [Brucella sp. NVSL 07-0026]
 gi|297174618|gb|EFH33965.1| cytochrome o ubiquinol oxidase, subunit III [Brucella abortus bv. 5
           str. B3196]
 gi|306276335|gb|EFM58035.1| cytochrome o ubiquinol oxidase, subunit III [Brucella sp. BO1]
 gi|306404971|gb|EFM61256.1| cytochrome o ubiquinol oxidase, subunit III [Brucella sp. NF 2653]
 gi|326408056|gb|ADZ65121.1| cytochrome o ubiquinol oxidase subunit III [Brucella melitensis
           M28]
 gi|326537772|gb|ADZ85987.1| cytochrome o ubiquinol oxidase, subunit III [Brucella melitensis
           M5-90]
          Length = 209

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 94/194 (48%), Positives = 125/194 (64%), Gaps = 3/194 (1%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
             +          T +GFWIYLMSDC++F+  F TYAVL   +A GP   ++FD+  + V
Sbjct: 19  AHEDHHDA--GSTTLVGFWIYLMSDCILFSGLFATYAVLAHQFAGGPTGRELFDLQFVLV 76

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T++LL+SSL+   A L+   K      + WL VT   G  F+ MEIYEF HLI   A P
Sbjct: 77  ETMLLLVSSLTYGLATLS-MYKNNRSGVLGWLGVTFLLGAAFLAMEIYEFHHLIVEGAGP 135

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
            RS+FLS+FF LVG HGLH+  GLIW+ VL   +L+ GL   N+ R++CLS+FWHFLD+I
Sbjct: 136 DRSSFLSAFFTLVGTHGLHITSGLIWILVLSAMLLRDGLTERNRTRVMCLSLFWHFLDII 195

Query: 197 WICVFSFVYLMGVV 210
           WI VF+ VYL+GV+
Sbjct: 196 WIGVFTLVYLLGVL 209


>gi|306842663|ref|ZP_07475308.1| cytochrome o ubiquinol oxidase, subunit III [Brucella sp. BO2]
 gi|306287198|gb|EFM58695.1| cytochrome o ubiquinol oxidase, subunit III [Brucella sp. BO2]
          Length = 209

 Score =  140 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 94/194 (48%), Positives = 125/194 (64%), Gaps = 3/194 (1%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
             +          T +GFWIYLMSDC++F+  F TYAVL   +A GP   ++FD+  + V
Sbjct: 19  AHEDHHDA--GSTTLVGFWIYLMSDCILFSGLFATYAVLAHQFAGGPTGRELFDLQFVLV 76

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T++LL+SSL+   A L+   K      + WL VT   G  F+ MEIYEF HLI   A P
Sbjct: 77  ETMLLLVSSLTYGLATLS-MYKNNRSGVLGWLGVTFLLGAAFLAMEIYEFHHLIVEGAGP 135

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
            RS+FLS+FF LVG HGLH+  GLIW+ VL   +L+ GL   N+ R++CLS+FWHFLD+I
Sbjct: 136 DRSSFLSAFFTLVGTHGLHITSGLIWILVLSAMLLRDGLTERNRTRVMCLSLFWHFLDII 195

Query: 197 WICVFSFVYLMGVV 210
           WI VF+ VYL+GV+
Sbjct: 196 WIGVFTLVYLLGVL 209


>gi|227113458|ref|ZP_03827114.1| cytochrome o ubiquinol oxidase subunit III [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 204

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 94/194 (48%), Positives = 126/194 (64%), Gaps = 1/194 (0%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
              +            GFW+YLMSD ++F   F TYAVL    A GP+  ++F +  + V
Sbjct: 12  AHAEHGHHDTGATKVFGFWVYLMSDLIIFGSLFATYAVLVNGTAGGPSGKELFQLPFVLV 71

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T  LL SS++   AM+A   K    +  +WL VT  FG++FI MEIYEF HLI     P
Sbjct: 72  ETFALLFSSITYGMAMIA-MNKGNKSQVNTWLGVTFLFGLVFIGMEIYEFHHLIVEGYGP 130

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
            RSAFLS+FFALVG HG+HV  GLIWL +++IQ+ K+GL + N+ RL+CLS+FWHFLD++
Sbjct: 131 DRSAFLSAFFALVGTHGIHVTGGLIWLVIMMIQVSKRGLTATNKTRLMCLSLFWHFLDVV 190

Query: 197 WICVFSFVYLMGVV 210
           WICVF+ VYL+G +
Sbjct: 191 WICVFTVVYLLGAM 204


>gi|16759421|ref|NP_455038.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|29142807|ref|NP_806149.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|56414403|ref|YP_151478.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|167551746|ref|ZP_02345499.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|213052104|ref|ZP_03344982.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhi str. E00-7866]
 gi|213425864|ref|ZP_03358614.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
 gi|213584682|ref|ZP_03366508.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-0664]
 gi|213621012|ref|ZP_03373795.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-2068]
 gi|25285521|pir||AD0557 cytochrome o ubiquinol oxidase chain III [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16501712|emb|CAD08900.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhi]
 gi|29138439|gb|AAO70009.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|56128660|gb|AAV78166.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|205323470|gb|EDZ11309.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
          Length = 204

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 95/195 (48%), Positives = 127/195 (65%), Gaps = 2/195 (1%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF 75
           +  +             GFW+YLMSDC++F++ F TYAVL    A GP   D+F++  + 
Sbjct: 12  HAHEHGHHDAGQ-NKIFGFWVYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVL 70

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           V T +LL SS++   A +A        + +SWL +T  FG  FI MEIYEF HLI     
Sbjct: 71  VETFLLLFSSITYGMAAIAMHKNN-KSQVISWLALTFLFGAGFIGMEIYEFHHLIVNGMG 129

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           P RS FLS+FFALVG HGLHV  GLIW+ VL++Q+ ++GL S N+ R++CLS+FWHFLD+
Sbjct: 130 PDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQVARRGLTSTNRTRIMCLSLFWHFLDV 189

Query: 196 IWICVFSFVYLMGVV 210
           IWICVF+ VYLMG +
Sbjct: 190 IWICVFTVVYLMGAM 204


>gi|82542918|ref|YP_406865.1| cytochrome o ubiquinol oxidase subunit III [Shigella boydii Sb227]
 gi|187731346|ref|YP_001879140.1| cytochrome o ubiquinol oxidase subunit III [Shigella boydii CDC
           3083-94]
 gi|81244329|gb|ABB65037.1| cytochrome o ubiquinol oxidase subunit III [Shigella boydii Sb227]
 gi|187428338|gb|ACD07612.1| cytochrome o ubiquinol oxidase, subunit III [Shigella boydii CDC
           3083-94]
 gi|320186059|gb|EFW60804.1| Cytochrome O ubiquinol oxidase subunit III [Shigella flexneri CDC
           796-83]
          Length = 204

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 100/204 (49%), Positives = 132/204 (64%), Gaps = 2/204 (0%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTY-LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI 66
            +   +       +    D  GT   GFWIYLMSDC++F++ F TYAVL    A GP   
Sbjct: 2   ATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGK 61

Query: 67  DVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEF 126
           D+F++  + V T +LL SS++   A +A   K    + +SWL +T  FG  FI MEIYEF
Sbjct: 62  DIFELPFVLVETFLLLFSSITYGMAAIA-MYKNNKSQVISWLALTCLFGAGFIGMEIYEF 120

Query: 127 AHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
            HLI     P RS FLS+FFALVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CL
Sbjct: 121 HHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCL 180

Query: 187 SMFWHFLDLIWICVFSFVYLMGVV 210
           S+FWHFLD++WICVF+ VYLMG +
Sbjct: 181 SLFWHFLDVVWICVFTVVYLMGAM 204


>gi|116255240|ref|YP_771073.1| putative cytochrome o ubiquinol oxidase subunit III [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115259888|emb|CAK02982.1| putative cytochrome o ubiquinol oxidase subunit III [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 209

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 115/210 (54%), Positives = 146/210 (69%), Gaps = 5/210 (2%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           MS Q I  +     FY+ +        + T LGFW+YLMSDCL+FAV F T+ VLG+NYA
Sbjct: 4   MSDQTIDTAEKPE-FYLTEDHHPE---NSTNLGFWLYLMSDCLIFAVLFATHGVLGRNYA 59

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
           AGP+P D+FD+  + ++T +LL SS++  FAML         +T+ WL VT  FG  FI 
Sbjct: 60  AGPSPADLFDLPIVALNTSMLLFSSITYGFAMLQMERNA-KAETLFWLGVTGLFGAAFIG 118

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           +E+YEF HLI   A P RSAFLSSFF LVG HGLHV FG+IWL  L++Q+   GLI  N+
Sbjct: 119 LELYEFVHLIHEGAGPTRSAFLSSFFTLVGTHGLHVTFGIIWLITLMVQVSMHGLIEANR 178

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RRL+CLSMFWHFLD++WI VFSFVYL+GV+
Sbjct: 179 RRLMCLSMFWHFLDVVWIGVFSFVYLLGVL 208


>gi|227327521|ref|ZP_03831545.1| cytochrome o ubiquinol oxidase subunit III [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 204

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 94/194 (48%), Positives = 125/194 (64%), Gaps = 1/194 (0%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
              +            GFW+YLMSD ++F   F TYAVL    A GP   ++F +  + V
Sbjct: 12  AHAEHGHHDTGATKVFGFWVYLMSDLIIFGSLFATYAVLVNGTAGGPTGKELFQLPFVLV 71

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T  LL SS++   AM+A   K    +  +WL VT  FG++FI MEIYEF HLI     P
Sbjct: 72  ETFALLFSSITYGMAMIA-MNKGNKSQVNAWLGVTFLFGLVFIGMEIYEFHHLIVEGYGP 130

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
            RSAFLS+FFALVG HG+HV  GLIWL +++IQ+ K+GL + N+ RL+CLS+FWHFLD++
Sbjct: 131 DRSAFLSAFFALVGTHGIHVTGGLIWLVIMMIQVSKRGLTATNKTRLMCLSLFWHFLDVV 190

Query: 197 WICVFSFVYLMGVV 210
           WICVF+ VYL+G +
Sbjct: 191 WICVFTVVYLLGAM 204


>gi|17988182|ref|NP_540816.1| cytochrome O ubiquinol oxidase subunit III [Brucella melitensis bv.
           1 str. 16M]
 gi|256045834|ref|ZP_05448710.1| cytochrome O ubiquinol oxidase subunit III [Brucella melitensis bv.
           1 str. Rev.1]
 gi|260563125|ref|ZP_05833611.1| cytochrome c oxidase [Brucella melitensis bv. 1 str. 16M]
 gi|265992248|ref|ZP_06104805.1| cytochrome o ubiquinol oxidase subunit III [Brucella melitensis bv.
           1 str. Rev.1]
 gi|17983943|gb|AAL53080.1| cytochrome o ubiquinol oxidase subunit iii [Brucella melitensis bv.
           1 str. 16M]
 gi|260153141|gb|EEW88233.1| cytochrome c oxidase [Brucella melitensis bv. 1 str. 16M]
 gi|263003314|gb|EEZ15607.1| cytochrome o ubiquinol oxidase subunit III [Brucella melitensis bv.
           1 str. Rev.1]
          Length = 209

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 94/194 (48%), Positives = 126/194 (64%), Gaps = 3/194 (1%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
             +          T +GFWIYLMSDC++F+  F TYAVL   +A GP   ++FD+  + V
Sbjct: 19  AHEDHHDA--GSTTLVGFWIYLMSDCILFSGLFATYAVLAHQFAGGPTGRELFDLQFVLV 76

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T++LL+SSL+   A L+   K      + WL VT   G  F++MEIYEF HLI   A P
Sbjct: 77  ETMLLLVSSLTHGLATLS-MYKNNRSGVLGWLGVTFLLGAAFLVMEIYEFHHLIVEGAGP 135

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
            RS+FLS+FF LVG HGLH+  GLIW+ VL   +L+ GL   N+ R++CLS+FWHFLD+I
Sbjct: 136 DRSSFLSAFFTLVGTHGLHITSGLIWILVLSAMLLRDGLTERNRTRVMCLSLFWHFLDII 195

Query: 197 WICVFSFVYLMGVV 210
           WI VF+ VYL+GV+
Sbjct: 196 WIGVFTLVYLLGVL 209


>gi|239830889|ref|ZP_04679218.1| cytochrome o ubiquinol oxidase, subunit III [Ochrobactrum
           intermedium LMG 3301]
 gi|239823156|gb|EEQ94724.1| cytochrome o ubiquinol oxidase, subunit III [Ochrobactrum
           intermedium LMG 3301]
          Length = 209

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 98/210 (46%), Positives = 134/210 (63%), Gaps = 1/210 (0%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           MS      +P          ++       T +GFWIYLMSDC++F+  F TYAVL   +A
Sbjct: 1   MSASISTAAPFLGGNEHPAHEDHHDAGSTTLVGFWIYLMSDCVLFSGLFATYAVLAHQFA 60

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
            GP   ++FD++ + + T++LL+SSL+   A L+   K+     + WL +T   G  F+ 
Sbjct: 61  GGPTGRELFDLNFVLIETMLLLVSSLTYGLATLS-MFKKNRAGLLFWLGITFLLGAAFLA 119

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           ME+YEF HLI   A P RSAFLS+FFALVG HGLH+  GLIW+ VL  Q+L+ GL   NQ
Sbjct: 120 MEVYEFNHLIHEGAGPGRSAFLSAFFALVGTHGLHITSGLIWILVLSAQLLRDGLTEKNQ 179

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
            R++CLS+FWHFLD+IWI VF+ VYL+GV+
Sbjct: 180 TRVMCLSLFWHFLDIIWIGVFTLVYLLGVL 209


>gi|13475708|ref|NP_107275.1| cytochrome o ubiquinol oxidase subunit III [Mesorhizobium loti
           MAFF303099]
 gi|14026464|dbj|BAB53061.1| cytochrome o ubiquinol oxidase subunit III [Mesorhizobium loti
           MAFF303099]
          Length = 208

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 113/207 (54%), Positives = 147/207 (71%), Gaps = 5/207 (2%)

Query: 4   QKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGP 63
              G  P F L    +++    +   T LGFW+YLMSDCL+FA+ F  Y VLG NYAAGP
Sbjct: 6   TTAGTEPVFHL----EEEHVHAEGSSTMLGFWLYLMSDCLIFAMLFAAYGVLGANYAAGP 61

Query: 64  APIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEI 123
           AP D+FD+  + V+T +LLLSS++  FAML    K  +  T +WL VT  FG+ F+ +E+
Sbjct: 62  APKDLFDLDLVAVNTTMLLLSSITYGFAMLT-MDKGRVAATQAWLAVTGLFGLAFLSIEL 120

Query: 124 YEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRL 183
           YEFAH+I   A PQRSAFLSSFF LVG HGLHV FG++WL  L+ Q+ + GLI  N+RR+
Sbjct: 121 YEFAHMIHEGATPQRSAFLSSFFTLVGTHGLHVTFGIVWLVTLMTQVARFGLIEANRRRV 180

Query: 184 ICLSMFWHFLDLIWICVFSFVYLMGVV 210
           +CLSMFWHFLD++WI VF+FVYLMG++
Sbjct: 181 MCLSMFWHFLDVVWIGVFTFVYLMGML 207


>gi|91975077|ref|YP_567736.1| cytochrome c oxidase, subunit III [Rhodopseudomonas palustris
           BisB5]
 gi|91681533|gb|ABE37835.1| cytochrome c oxidase, subunit III [Rhodopseudomonas palustris
           BisB5]
          Length = 209

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 115/210 (54%), Positives = 149/210 (70%), Gaps = 2/210 (0%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           MS           +F+V D+     +   T LGFW+YLMSDCL+FA+ F TY VLG NYA
Sbjct: 1   MSVAVATPQTAEPVFHVVDEHAHP-EGASTMLGFWLYLMSDCLIFAILFATYGVLGANYA 59

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
           AGPAP D+FD+  + V+T +LLLSS++  FAML  A  R +  T  WL +T  FG+ F+ 
Sbjct: 60  AGPAPKDLFDLKLVAVNTAMLLLSSITYGFAMLEMARAR-VGATQLWLGITGLFGLAFLG 118

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           +E+YEFAH+I   A PQRSAFLSSFF LVG HGLHV FG++WL  L++Q+ + GLI  N+
Sbjct: 119 IELYEFAHMIHEGATPQRSAFLSSFFTLVGTHGLHVTFGIVWLVTLMVQVARTGLIEANR 178

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RRL+CLSMFWHFLD++WI VF+FVYL+G +
Sbjct: 179 RRLMCLSMFWHFLDVVWIGVFTFVYLLGTL 208


>gi|307129920|ref|YP_003881936.1| cytochrome o ubiquinol oxidase subunit III [Dickeya dadantii 3937]
 gi|306527449|gb|ADM97379.1| cytochrome o ubiquinol oxidase subunit III [Dickeya dadantii 3937]
          Length = 204

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 98/194 (50%), Positives = 129/194 (66%), Gaps = 1/194 (0%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
              +            GFWIYLMSDC++F + F TYAVL    A GP   ++FD+  + V
Sbjct: 12  AHAEHGHHDTGANKVFGFWIYLMSDCILFGMLFATYAVLVNGTAGGPTGKELFDLKFVLV 71

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T  LL SS++   AM+A   K    +  +WL +T  FG++FI MEIYEF HLI+  A P
Sbjct: 72  ETFALLFSSITYGMAMIA-MNKGNKSQVNAWLGLTFLFGLVFIGMEIYEFHHLIAEGAGP 130

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
            RSAFLS+FFALVG HG+HV  GLIW+ +++IQ+ K GL S N+ RL+CLS+FWHFLD++
Sbjct: 131 DRSAFLSAFFALVGTHGIHVTSGLIWIAIMMIQVTKYGLTSRNKTRLMCLSLFWHFLDVV 190

Query: 197 WICVFSFVYLMGVV 210
           WICVF+ VYLMG +
Sbjct: 191 WICVFTVVYLMGAM 204


>gi|16763822|ref|NP_459437.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|62179053|ref|YP_215470.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|161615369|ref|YP_001589334.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Paratyphi B str. SPB7]
 gi|167992293|ref|ZP_02573391.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168232416|ref|ZP_02657474.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|168237553|ref|ZP_02662611.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|168240265|ref|ZP_02665197.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|168261125|ref|ZP_02683098.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|168465532|ref|ZP_02699414.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|168818950|ref|ZP_02830950.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|194446076|ref|YP_002039683.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194450685|ref|YP_002044476.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194470084|ref|ZP_03076068.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194736872|ref|YP_002113472.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|197251191|ref|YP_002145422.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197265057|ref|ZP_03165131.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|198243166|ref|YP_002214395.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|200390434|ref|ZP_03217045.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204927033|ref|ZP_03218235.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|238911427|ref|ZP_04655264.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Tennessee str. CDC07-0191]
 gi|16418948|gb|AAL19396.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|62126686|gb|AAX64389.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|161364733|gb|ABX68501.1| hypothetical protein SPAB_03140 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194404739|gb|ACF64961.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194408989|gb|ACF69208.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194456448|gb|EDX45287.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194712374|gb|ACF91595.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|195631945|gb|EDX50465.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|197214894|gb|ACH52291.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197243312|gb|EDY25932.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|197289515|gb|EDY28878.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|197937682|gb|ACH75015.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|199602879|gb|EDZ01425.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204323698|gb|EDZ08893.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205329523|gb|EDZ16287.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205333348|gb|EDZ20112.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|205339947|gb|EDZ26711.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|205344157|gb|EDZ30921.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|205349684|gb|EDZ36315.1| cytochrome o ubiquinol oxidase, subunit III [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|267992154|gb|ACY87039.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|312911474|dbj|BAJ35448.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhimurium str. T000240]
 gi|320084714|emb|CBY94505.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321226017|gb|EFX51068.1| Cytochrome O ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhimurium str. TN061786]
 gi|322642058|gb|EFY38668.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. 531954]
 gi|322647877|gb|EFY44352.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322652555|gb|EFY48909.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. OH_2009072675]
 gi|322653283|gb|EFY49616.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322660568|gb|EFY56804.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Montevideo str. 19N]
 gi|322713514|gb|EFZ05085.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. A50]
 gi|323128760|gb|ADX16190.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
 gi|326622143|gb|EGE28488.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Dublin str. 3246]
 gi|332987390|gb|AEF06373.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 204

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 94/195 (48%), Positives = 127/195 (65%), Gaps = 2/195 (1%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF 75
           +  +             GFW+YLMSDC++F++ F TYAVL    A GP   D+F++  + 
Sbjct: 12  HAHEHGHHDAGQ-NKIFGFWVYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVL 70

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           V T +LL SS++   A +A        + +SWL +T  FG  FI ME+YEF HLI     
Sbjct: 71  VETFLLLFSSITYGMAAIAMHKNN-KSQVISWLALTFLFGAGFIGMELYEFHHLIVNGMG 129

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           P RS FLS+FFALVG HGLHV  GLIW+ VL++Q+ ++GL S N+ R++CLS+FWHFLD+
Sbjct: 130 PDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQVARRGLTSTNRTRIMCLSLFWHFLDV 189

Query: 196 IWICVFSFVYLMGVV 210
           IWICVF+ VYLMG +
Sbjct: 190 IWICVFTVVYLMGAM 204


>gi|153007395|ref|YP_001368610.1| cytochrome o ubiquinol oxidase subunit III [Ochrobactrum anthropi
           ATCC 49188]
 gi|151559283|gb|ABS12781.1| Cytochrome o ubiquinol oxidase subunit III [Ochrobactrum anthropi
           ATCC 49188]
          Length = 209

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 96/194 (49%), Positives = 129/194 (66%), Gaps = 3/194 (1%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
             +          T +GFWIYLMSDC++F+  F TYAVL   +A GP   ++FD++ + +
Sbjct: 19  AHEDHHDA--GSTTLVGFWIYLMSDCVLFSGLFATYAVLAHQFAGGPTGRELFDLNFVLI 76

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T++LL+SSL+   A L+   K+     + WL VT   G  F+ ME+YEF HLI   A P
Sbjct: 77  ETMLLLVSSLTYGLATLS-MFKKNRAGLLFWLGVTFLLGAAFLAMEVYEFNHLIHEGAGP 135

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
            RSAFLS+FFALVG HGLH+  GLIW+ VL  Q+L+ GL   NQ R++CLS+FWHFLD+I
Sbjct: 136 GRSAFLSAFFALVGTHGLHITSGLIWILVLSAQLLRDGLTEKNQTRVMCLSLFWHFLDII 195

Query: 197 WICVFSFVYLMGVV 210
           WI VF+ VYL+GV+
Sbjct: 196 WIGVFTLVYLLGVL 209


>gi|218549902|ref|YP_002383693.1| cytochrome o ubiquinol oxidase subunit III [Escherichia fergusonii
           ATCC 35469]
 gi|218357443|emb|CAQ90082.1| cytochrome o ubiquinol oxidase subunit III [Escherichia fergusonii
           ATCC 35469]
 gi|323965116|gb|EGB60575.1| cytochrome o ubiquinol oxidase [Escherichia coli M863]
 gi|323976086|gb|EGB71179.1| cytochrome o ubiquinol oxidase [Escherichia coli TW10509]
          Length = 204

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 97/195 (49%), Positives = 128/195 (65%), Gaps = 2/195 (1%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF 75
           +  +             GFWIYLMSDC++F++ F TYAVL    A GP   D+F++  + 
Sbjct: 12  HAHEHGHHDAGG-NKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVL 70

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           V T +LL SS++   A +A   K    + +SWL +T  FG  FI MEIYEF HLI     
Sbjct: 71  VETFLLLFSSITYGMAAIA-MYKNNKSQVISWLALTWLFGAGFIGMEIYEFHHLIVNGMG 129

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           P RS FLS+FFALVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CLS+FWHFLD+
Sbjct: 130 PDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDV 189

Query: 196 IWICVFSFVYLMGVV 210
           +WICVF+ VYLMG +
Sbjct: 190 VWICVFTVVYLMGAM 204


>gi|148560198|ref|YP_001258091.1| cytochrome o ubiquinol oxidase subunit III [Brucella ovis ATCC
           25840]
 gi|148371455|gb|ABQ61434.1| cytochrome o ubiquinol oxidase, subunit III [Brucella ovis ATCC
           25840]
          Length = 209

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 93/194 (47%), Positives = 124/194 (63%), Gaps = 3/194 (1%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
             +          T +GFWIYLMSDC++F+  F TYAVL   +A GP   ++FD+  + V
Sbjct: 19  AHEDHHDA--GSTTLVGFWIYLMSDCILFSGLFATYAVLAHRFAGGPTGRELFDLQFVLV 76

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T++LL+SSL+   A L+   K      + WL VT   G  F+ MEIYEF HLI   A P
Sbjct: 77  ETMLLLVSSLTYGLATLS-MYKNNRSGVLGWLGVTFLLGAAFLAMEIYEFHHLIVEGAGP 135

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
            RS+FLS+FF LVG HG H+  GLIW+ VL   +L+ GL   N+ R++CLS+FWHFLD+I
Sbjct: 136 DRSSFLSAFFTLVGTHGFHITSGLIWILVLSAMLLRDGLTERNRTRVMCLSLFWHFLDII 195

Query: 197 WICVFSFVYLMGVV 210
           WI VF+ VYL+GV+
Sbjct: 196 WIGVFTLVYLLGVL 209


>gi|315646200|ref|ZP_07899320.1| quinol oxidase polypeptide III [Paenibacillus vortex V453]
 gi|315278399|gb|EFU41715.1| quinol oxidase polypeptide III [Paenibacillus vortex V453]
          Length = 208

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 94/203 (46%), Positives = 125/203 (61%), Gaps = 2/203 (0%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTY-LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI 66
            S      +  D+     D +     GFWIYLM+D ++F   F TY VL +N   GP P 
Sbjct: 6   TSEQILQAHAHDEHHGHPDMEEVRTFGFWIYLMTDVIIFGTLFATYIVLQQNTDGGPGPA 65

Query: 67  DVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEF 126
           D+F + GI  ST +LL SS +C  A+L+     +    +SWL VTA  G IFI MEI EF
Sbjct: 66  DLFQMGGIITSTFILLASSYTCGLALLSMHKHNVK-GLISWLAVTAGLGAIFIGMEIAEF 124

Query: 127 AHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
            HL+   A    SAFLS+FF LVG HGLHV FGL+W+  L+IQ+ K+G+    +R++  +
Sbjct: 125 NHLVHEGATIGTSAFLSAFFTLVGTHGLHVLFGLVWMIALIIQLAKRGITPVTKRKVNVI 184

Query: 187 SMFWHFLDLIWICVFSFVYLMGV 209
           S+FWHFLD++WI VF+ VYLMGV
Sbjct: 185 SLFWHFLDVVWIFVFTVVYLMGV 207


>gi|124266932|ref|YP_001020936.1| cytochrome ubiquinol oxidase subunit III [Methylibium
           petroleiphilum PM1]
 gi|124259707|gb|ABM94701.1| cytochrome ubiquinol oxidase subunit III [Methylibium
           petroleiphilum PM1]
          Length = 215

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 107/204 (52%), Positives = 146/204 (71%), Gaps = 4/204 (1%)

Query: 7   GKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI 66
             +     F+V  +       +GT LGFW+YLMSDCL+FA  F  + VLG++YA GP+  
Sbjct: 15  AGATATPRFHVVGEHH---VENGTLLGFWLYLMSDCLIFACLFAVHGVLGRSYAGGPSGA 71

Query: 67  DVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEF 126
           ++FD+  + ++T +LLLSS++  FAM+    +R    T+ WL +T  FG  FI +E+YEF
Sbjct: 72  ELFDLKLVAINTSLLLLSSITYGFAMIEMQRRRQ-GATLLWLAITGLFGAGFIGLELYEF 130

Query: 127 AHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
           AHLI   AVPQRSAFLSSFF LVG HGLHV FG++WL  L++Q+ + GL++ N+RRL+CL
Sbjct: 131 AHLIHEGAVPQRSAFLSSFFTLVGTHGLHVSFGVVWLVTLMVQVGRHGLVAENRRRLMCL 190

Query: 187 SMFWHFLDLIWICVFSFVYLMGVV 210
           SMFWHFLD++WI VF+FVYLMGV+
Sbjct: 191 SMFWHFLDVVWIGVFTFVYLMGVL 214


>gi|157146954|ref|YP_001454273.1| cytochrome o ubiquinol oxidase subunit III [Citrobacter koseri ATCC
           BAA-895]
 gi|157084159|gb|ABV13837.1| hypothetical protein CKO_02731 [Citrobacter koseri ATCC BAA-895]
          Length = 206

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 97/195 (49%), Positives = 127/195 (65%), Gaps = 2/195 (1%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF 75
           +  +             GFWIYLMSDC++F++ F TYAVL    A GP   D+F++  + 
Sbjct: 14  HAHEHGHHDAGQT-KIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVL 72

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           V T +LL SS++   A +A        + VSWL +T  FG  FI MEIYEF HLI     
Sbjct: 73  VETFLLLFSSITYGMAAIAMHKDN-KSQVVSWLALTFLFGAGFIGMEIYEFHHLIVEGMG 131

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           P RS FLS+FFALVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CLS+FWHFLD+
Sbjct: 132 PDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDV 191

Query: 196 IWICVFSFVYLMGVV 210
           +WICVF+ VYLMG +
Sbjct: 192 VWICVFTVVYLMGAM 206


>gi|304414865|ref|ZP_07395783.1| cytochrome o ubiquinol oxidase subunit III [Candidatus Regiella
           insecticola LSR1]
 gi|304283134|gb|EFL91548.1| cytochrome o ubiquinol oxidase subunit III [Candidatus Regiella
           insecticola LSR1]
          Length = 210

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 94/211 (44%), Positives = 133/211 (63%), Gaps = 2/211 (0%)

Query: 1   MSRQKIGKSPNFSLFY-VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY 59
           MS + +    N +    +  +            GFWIYLMSDC++FA  F  YAVL    
Sbjct: 1   MSTETLAHPNNITHHNSIHSEHHHQDMGAIKVFGFWIYLMSDCILFAALFANYAVLVNGI 60

Query: 60  AAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFI 119
           A GP+  D+FD+  + + T +LLLSS++   AML    K   ++    L +T   G+ F+
Sbjct: 61  ADGPSGKDIFDLRFVLIETFLLLLSSITYGIAMLGI-NKGCKNQVNISLALTFILGLGFV 119

Query: 120 IMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGN 179
            MEI+EF  LI+    P RSAFLSSFFALV  HG+HV  GLIW+ +++IQ++++GL + N
Sbjct: 120 AMEIFEFHELIAEGYGPDRSAFLSSFFALVATHGIHVSAGLIWIIIMIIQVMRRGLNTTN 179

Query: 180 QRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           Q RL+CLS+FWHFLD++WICVF+ VYL+G +
Sbjct: 180 QTRLMCLSLFWHFLDVVWICVFTIVYLLGAM 210


>gi|295695108|ref|YP_003588346.1| Cytochrome-c oxidase [Bacillus tusciae DSM 2912]
 gi|295410710|gb|ADG05202.1| Cytochrome-c oxidase [Bacillus tusciae DSM 2912]
          Length = 213

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 65/191 (34%), Positives = 110/191 (57%), Gaps = 1/191 (0%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTI 79
            + + ++     LGFW++L  +C +FA  F TY  L      GP   ++F +  I ++TI
Sbjct: 21  PETATLEGKNKVLGFWVFLGGECALFASLFATYLTLRGQTLNGPTAQELFHLPIIGLATI 80

Query: 80  VLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS 139
           +LL SSL+    + A     L    + WL VT   G+ F+ +++ EF        V   S
Sbjct: 81  LLLTSSLTGVLGINAMHRGNLRS-LLRWLGVTVLLGLGFLAVQVVEFITYAGEGFVFGTS 139

Query: 140 AFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWIC 199
           AF S+FF LVG HG HV FG++W+ +L++Q+ ++G+      ++   S++WHF+D++W+ 
Sbjct: 140 AFSSAFFTLVGFHGGHVAFGVVWISILILQLKREGITPRKAPKVFIASLYWHFVDVVWVF 199

Query: 200 VFSFVYLMGVV 210
           +F+ VYLMG++
Sbjct: 200 IFTVVYLMGIL 210


>gi|227820111|ref|YP_002824082.1| cytochrome O ubiquinol oxidase subunit III [Sinorhizobium fredii
           NGR234]
 gi|227339110|gb|ACP23329.1| cytochrome o ubiquinol oxidase subunit III [Sinorhizobium fredii
           NGR234]
          Length = 210

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 114/196 (58%), Positives = 148/196 (75%), Gaps = 4/196 (2%)

Query: 15  FYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
           FY++++         T LGFW+YLMSDCL+FAV F T+AV+G+NYAAGP+P D+FD+  +
Sbjct: 18  FYLEEEHHPEG---STMLGFWLYLMSDCLIFAVLFATHAVVGRNYAAGPSPADLFDLPLV 74

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            V+T +LL SS++  FAML     +    T+ W+ VTA FGM F+ +E+YEFAH+I   A
Sbjct: 75  AVNTSMLLFSSITYGFAMLEMEKAKKST-TLVWMAVTALFGMAFVGLELYEFAHMIHEGA 133

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            PQRSAFLSSFF LVG HGLHV  G+IW+ VL+ Q+ K+GLI  N+RRL+CLSMFWHFLD
Sbjct: 134 GPQRSAFLSSFFTLVGTHGLHVTSGIIWMLVLMAQVAKRGLILENKRRLMCLSMFWHFLD 193

Query: 195 LIWICVFSFVYLMGVV 210
           ++WI VFSFVYLMGV+
Sbjct: 194 VVWIGVFSFVYLMGVL 209


>gi|49079172|gb|AAT49862.1| PA1319 [synthetic construct]
          Length = 210

 Score =  139 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 95/193 (49%), Positives = 128/193 (66%), Gaps = 1/193 (0%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            D   +      T  GFW+YLM+DC++FA  F TYAVL  + A GP+  D+F++  + V 
Sbjct: 18  HDHDHAHDSGGNTVFGFWLYLMTDCVLFASVFATYAVLVHHTAGGPSGKDIFELPYVLVE 77

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T +LL+SS +   AML++       + ++WL VT   G  FI MEI EF HLI+    P 
Sbjct: 78  TAILLVSSCTYGLAMLSAHKGA-KGQAIAWLGVTFLLGAAFIGMEINEFHHLIAEGFGPS 136

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
           RSAFLSSFF LVG+HGLHV  GL+W+ VL+ QI  +GL + N  R++CLS+FWHFLD++W
Sbjct: 137 RSAFLSSFFTLVGMHGLHVSAGLLWMLVLMAQIWTRGLTAQNNTRMMCLSLFWHFLDIVW 196

Query: 198 ICVFSFVYLMGVV 210
           ICVF+ VYLMG +
Sbjct: 197 ICVFTVVYLMGAL 209


>gi|325921008|ref|ZP_08182891.1| cytochrome bo3 quinol oxidase subunit 3 [Xanthomonas gardneri ATCC
           19865]
 gi|325548515|gb|EGD19486.1| cytochrome bo3 quinol oxidase subunit 3 [Xanthomonas gardneri ATCC
           19865]
          Length = 209

 Score =  139 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 100/193 (51%), Positives = 125/193 (64%), Gaps = 1/193 (0%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            D  E       T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V 
Sbjct: 18  HDDHEHHDAGGNTVFGFWVYLMSDCLLFAGLFATYAVLSGATVDGPTAKELFDLKFVLVE 77

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T +LL SSLS   AM+++  + +     +WL VTA  G+ F+ ME++EF HLI   A P 
Sbjct: 78  TFLLLFSSLSFGVAMISAHKRSMT-GLYAWLGVTALLGIGFLCMEVWEFNHLIHEGAGPG 136

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
           RSAFLS+FF LVG HGLHV  GL+W+ VLVIQI K GL   N  RL CLS+FWHFLD+IW
Sbjct: 137 RSAFLSAFFTLVGTHGLHVASGLLWMAVLVIQISKNGLTPRNSTRLACLSLFWHFLDIIW 196

Query: 198 ICVFSFVYLMGVV 210
           I VF+ VYL+G +
Sbjct: 197 IGVFTVVYLLGAL 209


>gi|85058643|ref|YP_454345.1| cytochrome o ubiquinol oxidase subunit III [Sodalis glossinidius
           str. 'morsitans']
 gi|84779163|dbj|BAE73940.1| cytochrome o ubiquinol oxidase subunit III [Sodalis glossinidius
           str. 'morsitans']
          Length = 204

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 95/194 (48%), Positives = 124/194 (63%), Gaps = 1/194 (0%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
              +            GFWIYLMSDC++FA  F TYAVL  + A GP   D+F++  + V
Sbjct: 12  AHTEHGHHDAGATKVFGFWIYLMSDCILFATLFATYAVLSNSVAGGPTGKDIFELPFVLV 71

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T  LL SS++   A+LA   +    +   WL +T  FG+ FI ME+YEF HLI+    P
Sbjct: 72  ETFFLLFSSITYGMAILA-MYRGYKSRVNVWLGMTFLFGLGFICMELYEFHHLIAEGYGP 130

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
            RSAFLS FF LVG HGLHV  GLIW+ V+++Q+ ++GL   NQ RL CLS+FWHFLD++
Sbjct: 131 DRSAFLSGFFTLVGTHGLHVTSGLIWILVMMVQVSRRGLTPVNQTRLQCLSLFWHFLDVV 190

Query: 197 WICVFSFVYLMGVV 210
           WICVF+ VYLMG +
Sbjct: 191 WICVFTVVYLMGAL 204


>gi|103486991|ref|YP_616552.1| cytochrome c oxidase, subunit III [Sphingopyxis alaskensis RB2256]
 gi|98977068|gb|ABF53219.1| cytochrome c oxidase, subunit III [Sphingopyxis alaskensis RB2256]
          Length = 208

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 108/191 (56%), Positives = 140/191 (73%), Gaps = 1/191 (0%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTI 79
            +    +   T LGFWIYLMSDCL+FA+ F  YAVLG +YAAGPAP D+FD+  I ++T 
Sbjct: 18  DEHPHPEGHSTMLGFWIYLMSDCLIFAILFACYAVLGGSYAAGPAPKDLFDLKLIALNTA 77

Query: 80  VLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS 139
           +LL SS++  FA+L     R+      WL VT  FG+ F+ +E+YEF HLI + A PQRS
Sbjct: 78  MLLFSSITYGFAVLQMQQGRVK-GVQLWLAVTGLFGLAFLGIELYEFHHLIEIGATPQRS 136

Query: 140 AFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWIC 199
           AFLS+FF LVG HGLHV FG+IWL  L++Q+ K GLI+ N+RR++CLSMFWHFLD++WI 
Sbjct: 137 AFLSAFFTLVGTHGLHVTFGIIWLVTLMVQLSKHGLIAANKRRVMCLSMFWHFLDVVWIG 196

Query: 200 VFSFVYLMGVV 210
           VF+FVYL GV+
Sbjct: 197 VFTFVYLTGVL 207


>gi|123443351|ref|YP_001007325.1| cytochrome o ubiquinol oxidase subunit III [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|332160741|ref|YP_004297318.1| cytochrome o ubiquinol oxidase subunit III [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|122090312|emb|CAL13178.1| cytochrome O ubiquinol oxidase subunit III [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|318604620|emb|CBY26118.1| cytochrome O ubiquinol oxidase subunit III [Yersinia enterocolitica
           subsp. palearctica Y11]
 gi|325664971|gb|ADZ41615.1| cytochrome o ubiquinol oxidase subunit III [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
          Length = 204

 Score =  139 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 95/195 (48%), Positives = 129/195 (66%), Gaps = 1/195 (0%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF 75
               +            GFWIYLMSDC++FA  F TYAVL    A GP+  D+FD++ + 
Sbjct: 11  VAHAEHGHHDAGATKVFGFWIYLMSDCILFATLFATYAVLVNGTAGGPSGRDIFDLNFVL 70

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           V T +LL SS++   AML    K   ++  +WL +T  FG+ F+ MEIYEF HLI+    
Sbjct: 71  VETFLLLFSSITYGIAML-GMNKGHKNQVNTWLGLTFLFGLGFVAMEIYEFHHLIAEGYG 129

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           P RSAFLSSFFALV  HG+HV  GL+W+ +++IQ+ K+GL   N+ RL+CLS+FWHFLD+
Sbjct: 130 PDRSAFLSSFFALVATHGIHVTAGLVWIIIMMIQVAKRGLNETNRTRLMCLSLFWHFLDV 189

Query: 196 IWICVFSFVYLMGVV 210
           +WICVF+ VYL+G +
Sbjct: 190 VWICVFTVVYLLGAM 204


>gi|271499590|ref|YP_003332615.1| cytochrome o ubiquinol oxidase subunit III [Dickeya dadantii
           Ech586]
 gi|270343145|gb|ACZ75910.1| cytochrome o ubiquinol oxidase, subunit III [Dickeya dadantii
           Ech586]
          Length = 204

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 97/194 (50%), Positives = 128/194 (65%), Gaps = 1/194 (0%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
              +            GFWIYLMSDC++F + F TY+VL    A GP   ++FD+  + V
Sbjct: 12  AHAEHGHHDTGSNKVFGFWIYLMSDCILFGMLFATYSVLVNGTAGGPTGKELFDLKFVLV 71

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T  LL SS++   AM+A   K    +  +WL +T  FG++FI ME+YEF HLI   A P
Sbjct: 72  ETFALLFSSITYGMAMIA-MNKGNKSQVNAWLGLTFLFGLVFIGMEVYEFHHLIVEGAGP 130

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
            RSAFLSSFFALVG HG+HV  GLIW+ +++IQ+ K GL S N+ RL+CLS+FWHFLD++
Sbjct: 131 DRSAFLSSFFALVGTHGIHVTSGLIWIAIMMIQVTKYGLTSTNKTRLMCLSLFWHFLDVV 190

Query: 197 WICVFSFVYLMGVV 210
           WICVF+ VYLMG +
Sbjct: 191 WICVFTVVYLMGAM 204


>gi|15596516|ref|NP_250010.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas aeruginosa
           PAO1]
 gi|116049271|ref|YP_791926.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|152989269|ref|YP_001349425.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas aeruginosa
           PA7]
 gi|218892576|ref|YP_002441445.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas aeruginosa
           LESB58]
 gi|296390304|ref|ZP_06879779.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas aeruginosa
           PAb1]
 gi|313106308|ref|ZP_07792552.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas aeruginosa
           39016]
 gi|81783807|sp|Q9I425|CYOC_PSEAE RecName: Full=Cytochrome o ubiquinol oxidase subunit 3; AltName:
           Full=Cytochrome o ubiquinol oxidase subunit III
 gi|9947257|gb|AAG04708.1|AE004561_4 cytochrome o ubiquinol oxidase subunit III [Pseudomonas aeruginosa
           PAO1]
 gi|115584492|gb|ABJ10507.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|150964427|gb|ABR86452.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas aeruginosa
           PA7]
 gi|218772804|emb|CAW28589.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas aeruginosa
           LESB58]
 gi|310879054|gb|EFQ37648.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas aeruginosa
           39016]
          Length = 209

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 95/193 (49%), Positives = 128/193 (66%), Gaps = 1/193 (0%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            D   +      T  GFW+YLM+DC++FA  F TYAVL  + A GP+  D+F++  + V 
Sbjct: 18  HDHDHAHDSGGNTVFGFWLYLMTDCVLFASVFATYAVLVHHTAGGPSGKDIFELPYVLVE 77

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T +LL+SS +   AML++       + ++WL VT   G  FI MEI EF HLI+    P 
Sbjct: 78  TAILLVSSCTYGLAMLSAHKGA-KGQAIAWLGVTFLLGAAFIGMEINEFHHLIAEGFGPS 136

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
           RSAFLSSFF LVG+HGLHV  GL+W+ VL+ QI  +GL + N  R++CLS+FWHFLD++W
Sbjct: 137 RSAFLSSFFTLVGMHGLHVSAGLLWMLVLMAQIWTRGLTAQNNTRMMCLSLFWHFLDIVW 196

Query: 198 ICVFSFVYLMGVV 210
           ICVF+ VYLMG +
Sbjct: 197 ICVFTVVYLMGAL 209


>gi|327188657|gb|EGE55863.1| cytochrome O ubiquinol oxidase protein, subunit III [Rhizobium etli
           CNPAF512]
          Length = 206

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 114/210 (54%), Positives = 145/210 (69%), Gaps = 5/210 (2%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           MS   +  +     FY+ +        + T LGFW+YLMSDCL+FAV F T+ VLG+NYA
Sbjct: 1   MSDHTVDTAEKPE-FYLTEDHHPE---NSTNLGFWLYLMSDCLIFAVLFATHGVLGRNYA 56

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
           AGP+P D+FD+  + ++T +LL SS++  FAML         +T+ WL VT  FG  FI 
Sbjct: 57  AGPSPADLFDLPIVALNTSMLLFSSITYGFAMLQMERNA-KAETLFWLAVTGLFGAAFIG 115

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           +E+YEF HLI   A P RSAFLSSFF LVG HGLHV FG+IWL  L++Q+   GLI  N+
Sbjct: 116 LELYEFIHLIHEGAGPTRSAFLSSFFTLVGTHGLHVTFGIIWLITLMVQVSMHGLIEANR 175

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RRL+CLSMFWHFLD++WI VFSFVYL+GVV
Sbjct: 176 RRLMCLSMFWHFLDVVWIGVFSFVYLLGVV 205


>gi|238897314|ref|YP_002922991.1| cytochrome o ubiquinol oxidase, subunit III [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
 gi|229465069|gb|ACQ66843.1| cytochrome o ubiquinol oxidase, subunit III [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
          Length = 204

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 97/193 (50%), Positives = 125/193 (64%), Gaps = 3/193 (1%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            D+            GFWIYLMSDC++FA  F TY VL    A GP   D+F++  + V 
Sbjct: 15  HDEHHEN--GSTKIFGFWIYLMSDCILFAALFATYVVLVNGTAGGPMGKDIFNLPFVLVE 72

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T +LL SS++  FA+LA   +        WL +T   G+ F+ MEI+EF  LI   A P 
Sbjct: 73  TFLLLFSSMTYGFAILA-MNQGQKKSVNIWLGLTFLLGLSFVGMEIFEFHELIGEGAGPD 131

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
           RSAFLSSFFALVG HGLHV  GLIW+ V+++QI ++GL   NQ RL+CLS+FWHFLD+IW
Sbjct: 132 RSAFLSSFFALVGTHGLHVALGLIWIVVMMVQISQRGLNPINQTRLMCLSLFWHFLDVIW 191

Query: 198 ICVFSFVYLMGVV 210
           ICVF+ VYL+G +
Sbjct: 192 ICVFTIVYLLGAM 204


>gi|283784256|ref|YP_003364121.1| cytochrome o ubiquinol oxidase subunit 3 [Citrobacter rodentium
           ICC168]
 gi|282947710|emb|CBG87265.1| cytochrome o ubiquinol oxidase subunit 3 [Citrobacter rodentium
           ICC168]
          Length = 204

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 97/195 (49%), Positives = 127/195 (65%), Gaps = 2/195 (1%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF 75
           +  +             GFWIYLMSDC++F++ F TYAVL    A GP   D+F++  + 
Sbjct: 12  HAHEHGHHDAGQT-KIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVL 70

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           V T +LL SS++   A +A        + VSWL +T  FG  FI MEIYEF HLI     
Sbjct: 71  VETFLLLFSSITYGMAAIAMHKNN-KSQVVSWLALTFLFGAGFIGMEIYEFHHLIVNGMG 129

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           P RS FLS+FFALVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CLS+FWHFLD+
Sbjct: 130 PDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDV 189

Query: 196 IWICVFSFVYLMGVV 210
           +WICVF+ VYLMG +
Sbjct: 190 VWICVFTVVYLMGAM 204


>gi|16128415|ref|NP_414964.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli str.
           K-12 substr. MG1655]
 gi|24111812|ref|NP_706322.1| cytochrome o ubiquinol oxidase subunit III [Shigella flexneri 2a
           str. 301]
 gi|26246436|ref|NP_752475.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           CFT073]
 gi|30061929|ref|NP_836100.1| cytochrome o ubiquinol oxidase subunit III [Shigella flexneri 2a
           str. 2457T]
 gi|74311005|ref|YP_309424.1| cytochrome o ubiquinol oxidase subunit III [Shigella sonnei Ss046]
 gi|89107300|ref|AP_001080.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli str.
           K-12 substr. W3110]
 gi|110804457|ref|YP_687977.1| cytochrome o ubiquinol oxidase subunit III [Shigella flexneri 5
           str. 8401]
 gi|157157815|ref|YP_001461616.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           E24377A]
 gi|157159955|ref|YP_001457273.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli HS]
 gi|170021198|ref|YP_001726152.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli ATCC
           8739]
 gi|170080016|ref|YP_001729336.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli str.
           K-12 substr. DH10B]
 gi|170680623|ref|YP_001742571.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           SMS-3-5]
 gi|188495693|ref|ZP_03002963.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           53638]
 gi|191166709|ref|ZP_03028536.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli B7A]
 gi|193065155|ref|ZP_03046228.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli E22]
 gi|194428821|ref|ZP_03061356.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli B171]
 gi|194432598|ref|ZP_03064884.1| cytochrome o ubiquinol oxidase, subunit III [Shigella dysenteriae
           1012]
 gi|194438854|ref|ZP_03070939.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           101-1]
 gi|209917646|ref|YP_002291730.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli SE11]
 gi|218552996|ref|YP_002385909.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli IAI1]
 gi|218688293|ref|YP_002396505.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli ED1a]
 gi|218693893|ref|YP_002401560.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli 55989]
 gi|218698658|ref|YP_002406287.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli IAI39]
 gi|218703713|ref|YP_002411232.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           UMN026]
 gi|227884561|ref|ZP_04002366.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli 83972]
 gi|238899718|ref|YP_002925514.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           BW2952]
 gi|253774582|ref|YP_003037413.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254160499|ref|YP_003043607.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli B str.
           REL606]
 gi|256020400|ref|ZP_05434265.1| cytochrome o ubiquinol oxidase subunit III [Shigella sp. D9]
 gi|256023953|ref|ZP_05437818.1| cytochrome o ubiquinol oxidase subunit III [Escherichia sp.
           4_1_40B]
 gi|260842631|ref|YP_003220409.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O103:H2 str. 12009]
 gi|260853653|ref|YP_003227544.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O26:H11 str. 11368]
 gi|260866591|ref|YP_003232993.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O111:H- str. 11128]
 gi|293403550|ref|ZP_06647641.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           FVEC1412]
 gi|293408579|ref|ZP_06652418.1| cytochrome o ubiquinol oxidase [Escherichia coli B354]
 gi|293413685|ref|ZP_06656334.1| cytochrome o ubiquinol oxidase [Escherichia coli B185]
 gi|293418500|ref|ZP_06660935.1| cytochrome o ubiquinol oxidase [Escherichia coli B088]
 gi|298379162|ref|ZP_06989043.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           FVEC1302]
 gi|300818241|ref|ZP_07098452.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           107-1]
 gi|300820327|ref|ZP_07100479.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           119-7]
 gi|300900498|ref|ZP_07118665.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           198-1]
 gi|300903305|ref|ZP_07121233.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           84-1]
 gi|300918189|ref|ZP_07134796.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           115-1]
 gi|300924155|ref|ZP_07140147.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           182-1]
 gi|300930270|ref|ZP_07145683.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           187-1]
 gi|300937044|ref|ZP_07151910.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           21-1]
 gi|300947919|ref|ZP_07162067.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           116-1]
 gi|300957995|ref|ZP_07170160.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           175-1]
 gi|300988017|ref|ZP_07178497.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           45-1]
 gi|301022579|ref|ZP_07186451.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           69-1]
 gi|301025683|ref|ZP_07189199.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           196-1]
 gi|301049631|ref|ZP_07196582.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           185-1]
 gi|301301578|ref|ZP_07207713.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           124-1]
 gi|301330704|ref|ZP_07223306.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           78-1]
 gi|301647353|ref|ZP_07247165.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           146-1]
 gi|307312192|ref|ZP_07591828.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli W]
 gi|331640948|ref|ZP_08342083.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli H736]
 gi|331645604|ref|ZP_08346708.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli M605]
 gi|331651366|ref|ZP_08352391.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli M718]
 gi|331661809|ref|ZP_08362732.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           TA143]
 gi|331666784|ref|ZP_08367658.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           TA271]
 gi|331671976|ref|ZP_08372772.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           TA280]
 gi|331676101|ref|ZP_08376813.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli H591]
 gi|331681824|ref|ZP_08382457.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli H299]
 gi|332281580|ref|ZP_08393993.1| cytochrome o ubiquinol oxidase subunit III [Shigella sp. D9]
 gi|78099994|sp|P0ABJ4|CYOC_ECOL6 RecName: Full=Cytochrome o ubiquinol oxidase subunit 3; AltName:
           Full=Cytochrome o ubiquinol oxidase subunit III;
           AltName: Full=Ubiquinol oxidase chain C
 gi|78099995|sp|P0ABJ3|CYOC_ECOLI RecName: Full=Cytochrome o ubiquinol oxidase subunit 3; AltName:
           Full=Cytochrome o ubiquinol oxidase subunit III;
           AltName: Full=Ubiquinol oxidase chain C
 gi|78099996|sp|P0ABJ5|CYOC_SHIFL RecName: Full=Cytochrome o ubiquinol oxidase subunit 3; AltName:
           Full=Cytochrome o ubiquinol oxidase subunit III;
           AltName: Full=Ubiquinol oxidase chain C
 gi|11514519|pdb|1FFT|C Chain C, The Structure Of Ubiquinol Oxidase From Escherichia Coli
 gi|11514523|pdb|1FFT|H Chain H, The Structure Of Ubiquinol Oxidase From Escherichia Coli
 gi|26106834|gb|AAN79019.1|AE016756_202 Cytochrome O ubiquinol oxidase subunit III [Escherichia coli
           CFT073]
 gi|145654|gb|AAA23633.1| cytochrome o ubiquinol oxidase C subunit [Escherichia coli]
 gi|1773114|gb|AAB40186.1| cytochrome o ubiquinol oxidase [Escherichia coli]
 gi|1786633|gb|AAC73533.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli str.
           K-12 substr. MG1655]
 gi|24050602|gb|AAN42029.1| cytochrome o ubiquinol oxidase subunit III [Shigella flexneri 2a
           str. 301]
 gi|30040173|gb|AAP15906.1| cytochrome o ubiquinol oxidase subunit III [Shigella flexneri 2a
           str. 2457T]
 gi|73854482|gb|AAZ87189.1| cytochrome o ubiquinol oxidase subunit III [Shigella sonnei Ss046]
 gi|85674570|dbj|BAE76210.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli str.
           K12 substr. W3110]
 gi|110614005|gb|ABF02672.1| cytochrome o ubiquinol oxidase subunit III [Shigella flexneri 5
           str. 8401]
 gi|157065635|gb|ABV04890.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli HS]
 gi|157079845|gb|ABV19553.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           E24377A]
 gi|169756126|gb|ACA78825.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli ATCC
           8739]
 gi|169887851|gb|ACB01558.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli str.
           K-12 substr. DH10B]
 gi|170518341|gb|ACB16519.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           SMS-3-5]
 gi|188490892|gb|EDU65995.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           53638]
 gi|190903220|gb|EDV62942.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli B7A]
 gi|192927129|gb|EDV81750.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli E22]
 gi|194413124|gb|EDX29411.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli B171]
 gi|194419159|gb|EDX35242.1| cytochrome o ubiquinol oxidase, subunit III [Shigella dysenteriae
           1012]
 gi|194422148|gb|EDX38150.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           101-1]
 gi|209910905|dbj|BAG75979.1| cytochrome O ubiquinol oxidase subunit III [Escherichia coli SE11]
 gi|218350625|emb|CAU96317.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli 55989]
 gi|218359764|emb|CAQ97305.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli IAI1]
 gi|218368644|emb|CAR16383.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli IAI39]
 gi|218425857|emb|CAR06663.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli ED1a]
 gi|218430810|emb|CAR11684.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           UMN026]
 gi|227838647|gb|EEJ49113.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli 83972]
 gi|238860709|gb|ACR62707.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           BW2952]
 gi|242376211|emb|CAQ30902.1| cytochrome bo terminal oxidase subunit III, subunit of cytochrome
           bo terminal oxidase [Escherichia coli BL21(DE3)]
 gi|253325626|gb|ACT30228.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253972400|gb|ACT38071.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli B str.
           REL606]
 gi|253976610|gb|ACT42280.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           BL21(DE3)]
 gi|257752302|dbj|BAI23804.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O26:H11 str. 11368]
 gi|257757778|dbj|BAI29275.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O103:H2 str. 12009]
 gi|257762947|dbj|BAI34442.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O111:H- str. 11128]
 gi|260450383|gb|ACX40805.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli DH1]
 gi|281177600|dbj|BAI53930.1| cytochrome O ubiquinol oxidase subunit III [Escherichia coli SE15]
 gi|281599766|gb|ADA72750.1| Cytochrome o ubiquinol oxidase subunit 3 [Shigella flexneri
           2002017]
 gi|284920240|emb|CBG33299.1| cytochrome o ubiquinol oxidase subunit 3 [Escherichia coli 042]
 gi|291325028|gb|EFE64443.1| cytochrome o ubiquinol oxidase [Escherichia coli B088]
 gi|291429403|gb|EFF02423.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           FVEC1412]
 gi|291433743|gb|EFF06716.1| cytochrome o ubiquinol oxidase [Escherichia coli B185]
 gi|291471757|gb|EFF14240.1| cytochrome o ubiquinol oxidase [Escherichia coli B354]
 gi|298280275|gb|EFI21779.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           FVEC1302]
 gi|299879995|gb|EFI88206.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           196-1]
 gi|300298624|gb|EFJ55009.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           185-1]
 gi|300315331|gb|EFJ65115.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           175-1]
 gi|300355979|gb|EFJ71849.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           198-1]
 gi|300397460|gb|EFJ80998.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           69-1]
 gi|300404600|gb|EFJ88138.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           84-1]
 gi|300407569|gb|EFJ91107.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           45-1]
 gi|300414640|gb|EFJ97950.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           115-1]
 gi|300419608|gb|EFK02919.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           182-1]
 gi|300452519|gb|EFK16139.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           116-1]
 gi|300457875|gb|EFK21368.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           21-1]
 gi|300461842|gb|EFK25335.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           187-1]
 gi|300527112|gb|EFK48181.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           119-7]
 gi|300529132|gb|EFK50194.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           107-1]
 gi|300843075|gb|EFK70835.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           124-1]
 gi|300843365|gb|EFK71125.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           78-1]
 gi|301074498|gb|EFK89304.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           146-1]
 gi|306907694|gb|EFN38196.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli W]
 gi|307552336|gb|ADN45111.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli ABU
           83972]
 gi|309700691|emb|CBI99987.1| cytochrome o ubiquinol oxidase subunit 3 [Escherichia coli ETEC
           H10407]
 gi|315059710|gb|ADT74037.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli W]
 gi|315135112|dbj|BAJ42271.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli DH1]
 gi|315256255|gb|EFU36223.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           85-1]
 gi|315294191|gb|EFU53542.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           153-1]
 gi|315299552|gb|EFU58800.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           16-3]
 gi|320201674|gb|EFW76250.1| Cytochrome O ubiquinol oxidase subunit III [Escherichia coli
           EC4100B]
 gi|323170515|gb|EFZ56165.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           LT-68]
 gi|323379725|gb|ADX51993.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli KO11]
 gi|323938615|gb|EGB34864.1| cytochrome o ubiquinol oxidase [Escherichia coli E1520]
 gi|323943236|gb|EGB39392.1| cytochrome o ubiquinol oxidase [Escherichia coli E482]
 gi|323945334|gb|EGB41390.1| cytochrome o ubiquinol oxidase [Escherichia coli H120]
 gi|323963419|gb|EGB58981.1| cytochrome o ubiquinol oxidase [Escherichia coli H489]
 gi|323972283|gb|EGB67493.1| cytochrome o ubiquinol oxidase [Escherichia coli TA007]
 gi|324010060|gb|EGB79279.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           57-2]
 gi|324016710|gb|EGB85929.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           117-3]
 gi|324114657|gb|EGC08625.1| cytochrome o ubiquinol oxidase [Escherichia fergusonii B253]
 gi|324116917|gb|EGC10830.1| cytochrome o ubiquinol oxidase [Escherichia coli E1167]
 gi|325498279|gb|EGC96138.1| cytochrome o ubiquinol oxidase subunit III [Escherichia fergusonii
           ECD227]
 gi|330910222|gb|EGH38732.1| cytochrome O ubiquinol oxidase subunit 3 [Escherichia coli AA86]
 gi|331037746|gb|EGI09966.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli H736]
 gi|331045766|gb|EGI17892.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli M605]
 gi|331051107|gb|EGI23159.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli M718]
 gi|331060231|gb|EGI32195.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           TA143]
 gi|331066008|gb|EGI37892.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           TA271]
 gi|331070965|gb|EGI42324.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           TA280]
 gi|331076159|gb|EGI47441.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli H591]
 gi|331081026|gb|EGI52191.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli H299]
 gi|332094585|gb|EGI99631.1| cytochrome o ubiquinol oxidase, subunit III [Shigella boydii
           5216-82]
 gi|332103932|gb|EGJ07278.1| cytochrome o ubiquinol oxidase subunit III [Shigella sp. D9]
 gi|332341793|gb|AEE55127.1| cytochrome O ubiquinol oxidase subunit III CyoC [Escherichia coli
           UMNK88]
 gi|332761785|gb|EGJ92064.1| cytochrome o ubiquinol oxidase, subunit III [Shigella flexneri
           2747-71]
 gi|333007961|gb|EGK27437.1| cytochrome o ubiquinol oxidase, subunit III [Shigella flexneri
           K-218]
 gi|333021982|gb|EGK41228.1| cytochrome o ubiquinol oxidase, subunit III [Shigella flexneri
           K-304]
          Length = 204

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 100/204 (49%), Positives = 132/204 (64%), Gaps = 2/204 (0%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTY-LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI 66
            +   +       +    D  GT   GFWIYLMSDC++F++ F TYAVL    A GP   
Sbjct: 2   ATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGK 61

Query: 67  DVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEF 126
           D+F++  + V T +LL SS++   A +A   K    + +SWL +T  FG  FI MEIYEF
Sbjct: 62  DIFELPFVLVETFLLLFSSITYGMAAIA-MYKNNKSQVISWLALTWLFGAGFIGMEIYEF 120

Query: 127 AHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
            HLI     P RS FLS+FFALVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CL
Sbjct: 121 HHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCL 180

Query: 187 SMFWHFLDLIWICVFSFVYLMGVV 210
           S+FWHFLD++WICVF+ VYLMG +
Sbjct: 181 SLFWHFLDVVWICVFTVVYLMGAM 204


>gi|290474674|ref|YP_003467554.1| cytochrome o ubiquinol oxidase subunit III [Xenorhabdus bovienii
           SS-2004]
 gi|289173987|emb|CBJ80774.1| cytochrome o ubiquinol oxidase, subunit III [Xenorhabdus bovienii
           SS-2004]
          Length = 203

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 94/194 (48%), Positives = 125/194 (64%), Gaps = 1/194 (0%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
             +             GFWIYLMSD ++FA  F TYAVL    A GP+  D+F++  + V
Sbjct: 11  AHEHHGHHDVGSMKIFGFWIYLMSDLVLFASLFATYAVLANGTAGGPSGKDIFELPFVLV 70

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T +LL SS++  FAML+   K    +   WL +T  FG+ F+ MEIYEF  LIS    P
Sbjct: 71  ETFLLLFSSITYGFAMLS-MNKGKTGQVNLWLFITFLFGLGFVSMEIYEFHKLISEGFGP 129

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
            RSAFLSSFFALV  HG+HV  GLIW+ ++++Q+ ++GL   N+ RL CLS+FWHFLD++
Sbjct: 130 DRSAFLSSFFALVATHGIHVTCGLIWIIIMMVQVARRGLTEVNRTRLSCLSLFWHFLDVV 189

Query: 197 WICVFSFVYLMGVV 210
           WICVF+ VYLMG +
Sbjct: 190 WICVFTVVYLMGAM 203


>gi|329915609|ref|ZP_08276293.1| Cytochrome O ubiquinol oxidase subunit III [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327544870|gb|EGF30240.1| Cytochrome O ubiquinol oxidase subunit III [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 202

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 103/191 (53%), Positives = 135/191 (70%), Gaps = 4/191 (2%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTI 79
           +       +GT LGFW+YLMSDCL+FA  F  YAVLG+NYA GP   ++FD+  + ++T 
Sbjct: 15  EHHPE---NGTTLGFWLYLMSDCLVFAALFAVYAVLGRNYAGGPTGAELFDLPLVALNTA 71

Query: 80  VLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS 139
            LL+SS++  FAML    KR+   T+ W+ +T   G  FI +E+YEF HLI   A PQRS
Sbjct: 72  FLLVSSITYGFAMLEMQRKRVRS-TLIWMGITGLIGACFIGLEMYEFIHLIHEGAGPQRS 130

Query: 140 AFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWIC 199
            FL++FF LVG HGLHV FG+IWL  L++Q+   GL + N RRL+CLSMFWHFLD++WI 
Sbjct: 131 GFLTAFFTLVGTHGLHVMFGIIWLVTLMLQVSVHGLTTENSRRLMCLSMFWHFLDVVWIG 190

Query: 200 VFSFVYLMGVV 210
           VF+FVYLMGV+
Sbjct: 191 VFTFVYLMGVL 201


>gi|311280673|ref|YP_003942904.1| cytochrome o ubiquinol oxidase, subunit III [Enterobacter cloacae
           SCF1]
 gi|308749868|gb|ADO49620.1| cytochrome o ubiquinol oxidase, subunit III [Enterobacter cloacae
           SCF1]
          Length = 204

 Score =  138 bits (347), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 98/195 (50%), Positives = 129/195 (66%), Gaps = 2/195 (1%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF 75
           +  +             GFWIYLMSDC++F++ F TYAVL  N A GP+  D+F++  + 
Sbjct: 12  HAHEHGHHDS-GSTKVFGFWIYLMSDCILFSILFATYAVLVNNTAGGPSGKDIFELPFVL 70

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           V T +LL SS++   A +A   K    + +SWL +T  FG  FI ME+YEF HLI     
Sbjct: 71  VETALLLFSSITYGLAAIA-MYKNNKSQVISWLALTWLFGAGFIGMELYEFHHLIVEGMG 129

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           P RS FLS+FFALVG HGLHV  GLIW+ VL+ QI ++GL S N+ R++CLS+FWHFLD+
Sbjct: 130 PDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMFQIARRGLTSTNRTRIMCLSLFWHFLDV 189

Query: 196 IWICVFSFVYLMGVV 210
           +WICVFS VYLMG +
Sbjct: 190 VWICVFSVVYLMGAM 204


>gi|289662731|ref|ZP_06484312.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas campestris
           pv. vasculorum NCPPB702]
          Length = 210

 Score =  138 bits (347), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 101/192 (52%), Positives = 126/192 (65%), Gaps = 1/192 (0%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
              E       T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T
Sbjct: 20  HDHEHHDGGGNTVFGFWVYLMSDCLLFAGLFATYAVLSGATVDGPTAKELFDLKFVLVET 79

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
            +LL SSLS  FAM+A+  +++      WL VTA  G+ F+ ME++EF HLI   A P R
Sbjct: 80  FLLLFSSLSFGFAMIAAHKRKM-GGLYGWLAVTALLGIGFLCMEVWEFNHLIHEGAGPSR 138

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAFLS+FF LVG HGLHV  GL+W+ VLVIQI K GL + N  RL CLS+FWHFLD+IWI
Sbjct: 139 SAFLSAFFTLVGTHGLHVASGLLWMAVLVIQISKNGLTARNSTRLACLSLFWHFLDIIWI 198

Query: 199 CVFSFVYLMGVV 210
            VF+ VYL+G +
Sbjct: 199 GVFTVVYLLGAL 210


>gi|91209500|ref|YP_539486.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli UTI89]
 gi|117622690|ref|YP_851603.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli APEC
           O1]
 gi|215485511|ref|YP_002327942.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O127:H6 str. E2348/69]
 gi|218557339|ref|YP_002390252.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli S88]
 gi|237707576|ref|ZP_04538057.1| cytochrome o ubiquinol oxidase subunit III [Escherichia sp.
           3_2_53FAA]
 gi|91071074|gb|ABE05955.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli UTI89]
 gi|115511814|gb|ABI99888.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli APEC
           O1]
 gi|215263583|emb|CAS07913.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O127:H6 str. E2348/69]
 gi|218364108|emb|CAR01773.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli S88]
 gi|222032225|emb|CAP74964.1| Cytochrome o ubiquinol oxidase subunit 3 [Escherichia coli LF82]
 gi|226898786|gb|EEH85045.1| cytochrome o ubiquinol oxidase subunit III [Escherichia sp.
           3_2_53FAA]
 gi|294489594|gb|ADE88350.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           IHE3034]
 gi|312945007|gb|ADR25834.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli O83:H1
           str. NRG 857C]
 gi|315289855|gb|EFU49245.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           110-3]
 gi|323952958|gb|EGB48826.1| cytochrome o ubiquinol oxidase [Escherichia coli H252]
 gi|323958623|gb|EGB54326.1| cytochrome o ubiquinol oxidase [Escherichia coli H263]
          Length = 204

 Score =  138 bits (347), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 101/204 (49%), Positives = 132/204 (64%), Gaps = 2/204 (0%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTY-LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI 66
            +   +       +    D  GT   GFWIYLMSDC++F++ F TYAVL    A GP   
Sbjct: 2   ATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGK 61

Query: 67  DVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEF 126
           D+F++  + V T +LL SS++   A +A   K    + VSWL +T  FG  FI MEIYEF
Sbjct: 62  DIFELPFVLVETFLLLFSSITYGMAAIA-MYKNNKSQVVSWLALTWLFGAGFIGMEIYEF 120

Query: 127 AHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
            HLI     P RS FLS+FFALVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CL
Sbjct: 121 HHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCL 180

Query: 187 SMFWHFLDLIWICVFSFVYLMGVV 210
           S+FWHFLD++WICVF+ VYLMG +
Sbjct: 181 SLFWHFLDVVWICVFTVVYLMGAM 204


>gi|107100770|ref|ZP_01364688.1| hypothetical protein PaerPA_01001798 [Pseudomonas aeruginosa PACS2]
          Length = 204

 Score =  138 bits (347), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 95/193 (49%), Positives = 128/193 (66%), Gaps = 1/193 (0%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            D   +      T  GFW+YLM+DC++FA  F TYAVL  + A GP+  D+F++  + V 
Sbjct: 13  HDHDHAHDSGGNTVFGFWLYLMTDCVLFASVFATYAVLVHHTAGGPSGKDIFELPYVLVE 72

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T +LL+SS +   AML++       + ++WL VT   G  FI MEI EF HLI+    P 
Sbjct: 73  TAILLVSSCTYGLAMLSAHKGA-KGQAIAWLGVTFLLGAAFIGMEINEFHHLIAEGFGPS 131

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
           RSAFLSSFF LVG+HGLHV  GL+W+ VL+ QI  +GL + N  R++CLS+FWHFLD++W
Sbjct: 132 RSAFLSSFFTLVGMHGLHVSAGLLWMLVLMAQIWTRGLTAQNNTRMMCLSLFWHFLDIVW 191

Query: 198 ICVFSFVYLMGVV 210
           ICVF+ VYLMG +
Sbjct: 192 ICVFTVVYLMGAL 204


>gi|15800160|ref|NP_286172.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O157:H7 EDL933]
 gi|15829738|ref|NP_308511.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O157:H7 str. Sakai]
 gi|168749892|ref|ZP_02774914.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4113]
 gi|168756972|ref|ZP_02781979.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4401]
 gi|168761636|ref|ZP_02786643.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4501]
 gi|168768381|ref|ZP_02793388.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4486]
 gi|168776264|ref|ZP_02801271.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4196]
 gi|168783296|ref|ZP_02808303.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4076]
 gi|168786277|ref|ZP_02811284.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC869]
 gi|168800313|ref|ZP_02825320.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC508]
 gi|195938503|ref|ZP_03083885.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O157:H7 str. EC4024]
 gi|208807579|ref|ZP_03249916.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4206]
 gi|208816111|ref|ZP_03257290.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4045]
 gi|208822882|ref|ZP_03263200.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4042]
 gi|209396662|ref|YP_002269076.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4115]
 gi|217325930|ref|ZP_03442014.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. TW14588]
 gi|254791614|ref|YP_003076451.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O157:H7 str. TW14359]
 gi|261223911|ref|ZP_05938192.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261256375|ref|ZP_05948908.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291281337|ref|YP_003498155.1| Cytochrome o ubiquinol oxidase subunit 3 [Escherichia coli O55:H7
           str. CB9615]
 gi|12513289|gb|AAG54780.1|AE005222_5 cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O157:H7 str. EDL933]
 gi|13359941|dbj|BAB33907.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O157:H7 str. Sakai]
 gi|187768299|gb|EDU32143.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4196]
 gi|188015926|gb|EDU54048.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4113]
 gi|188999391|gb|EDU68377.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4076]
 gi|189355966|gb|EDU74385.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4401]
 gi|189362389|gb|EDU80808.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4486]
 gi|189367976|gb|EDU86392.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4501]
 gi|189373539|gb|EDU91955.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC869]
 gi|189377389|gb|EDU95805.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC508]
 gi|208727380|gb|EDZ76981.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4206]
 gi|208732759|gb|EDZ81447.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4045]
 gi|208737075|gb|EDZ84759.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4042]
 gi|209158062|gb|ACI35495.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. EC4115]
 gi|209743924|gb|ACI70269.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli]
 gi|209743926|gb|ACI70270.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli]
 gi|209743928|gb|ACI70271.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli]
 gi|209743930|gb|ACI70272.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli]
 gi|209743932|gb|ACI70273.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli]
 gi|217322151|gb|EEC30575.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           O157:H7 str. TW14588]
 gi|254591014|gb|ACT70375.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O157:H7 str. TW14359]
 gi|290761210|gb|ADD55171.1| Cytochrome o ubiquinol oxidase subunit 3 [Escherichia coli O55:H7
           str. CB9615]
 gi|320638424|gb|EFX08138.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O157:H7 str. G5101]
 gi|320643804|gb|EFX12927.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O157:H- str. 493-89]
 gi|320649155|gb|EFX17733.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O157:H- str. H 2687]
 gi|320656048|gb|EFX23964.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli O55:H7
           str. 3256-97 TW 07815]
 gi|320661198|gb|EFX28629.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli O55:H7
           str. USDA 5905]
 gi|320665174|gb|EFX32267.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli
           O157:H7 str. LSU-61]
          Length = 204

 Score =  138 bits (347), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 101/204 (49%), Positives = 133/204 (65%), Gaps = 2/204 (0%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTY-LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI 66
            +   +   V   +    D  GT   GFWIYLMSDC++F++ F TYAVL    A GP   
Sbjct: 2   ATDTLTHATVHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGK 61

Query: 67  DVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEF 126
           D+F++  + V T +LL SS++   A +A   K    + +SWL +T  FG  FI MEIYEF
Sbjct: 62  DIFELPFVLVETFLLLFSSITYGMAAIA-MYKNNKSQVISWLALTWLFGAGFIGMEIYEF 120

Query: 127 AHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
            HLI     P RS FLS+FFALVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CL
Sbjct: 121 HHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCL 180

Query: 187 SMFWHFLDLIWICVFSFVYLMGVV 210
           S+FWHFLD++WICVF+ VYLMG +
Sbjct: 181 SLFWHFLDVVWICVFTVVYLMGAM 204


>gi|193068624|ref|ZP_03049585.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           E110019]
 gi|192957987|gb|EDV88429.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           E110019]
          Length = 204

 Score =  138 bits (347), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 100/204 (49%), Positives = 133/204 (65%), Gaps = 2/204 (0%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTY-LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI 66
            +   +       +    D  GT   GFWIYLMSDC++F++ F TYAVL    A GP   
Sbjct: 2   ATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGK 61

Query: 67  DVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEF 126
           D+F++  + V T +LL SS++   A +A   K    + +SWL +T  FG  FI MEIYEF
Sbjct: 62  DIFELPFVLVETFLLLFSSITYGMAAIA-MYKNNKSQVISWLALTWLFGAGFIGMEIYEF 120

Query: 127 AHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
            HLI     P+RS FLS+FFALVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CL
Sbjct: 121 HHLIVNGMGPERSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCL 180

Query: 187 SMFWHFLDLIWICVFSFVYLMGVV 210
           S+FWHFLD++WICVF+ VYLMG +
Sbjct: 181 SLFWHFLDVVWICVFTVVYLMGAM 204


>gi|237730407|ref|ZP_04560888.1| cytochrome o ubiquinol oxidase subunit III [Citrobacter sp. 30_2]
 gi|283834251|ref|ZP_06353992.1| cytochrome o ubiquinol oxidase, subunit III [Citrobacter youngae
           ATCC 29220]
 gi|226905946|gb|EEH91864.1| cytochrome o ubiquinol oxidase subunit III [Citrobacter sp. 30_2]
 gi|291069773|gb|EFE07882.1| cytochrome o ubiquinol oxidase, subunit III [Citrobacter youngae
           ATCC 29220]
          Length = 204

 Score =  137 bits (346), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 94/195 (48%), Positives = 128/195 (65%), Gaps = 2/195 (1%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF 75
           +  +             GFW+YLMSDC++F++ F TYAVL    A GP   D+F++  + 
Sbjct: 12  HAHEHGHHDAGQT-KIFGFWVYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVL 70

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           V T +LL SS++   A +A   K    + +SWL +T  FG  FI ME+YEF HLI     
Sbjct: 71  VETFLLLFSSITYGMAAIA-MYKNNKSQVISWLALTFLFGAGFIGMELYEFHHLIVNGMG 129

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           P RS FLS+FFALVG HGLHV  GLIW+ VL++Q+ ++GL S N+ R++CLS+FWHFLD+
Sbjct: 130 PDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQVARRGLTSTNRTRIMCLSLFWHFLDV 189

Query: 196 IWICVFSFVYLMGVV 210
           +WICVF+ VYLMG +
Sbjct: 190 VWICVFTVVYLMGAM 204


>gi|222107118|ref|YP_002547909.1| cytochrome o ubiquinol oxidase subunit III [Agrobacterium vitis S4]
 gi|221738297|gb|ACM39193.1| cytochrome o ubiquinol oxidase subunit III [Agrobacterium vitis S4]
          Length = 205

 Score =  137 bits (346), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 113/196 (57%), Positives = 143/196 (72%), Gaps = 4/196 (2%)

Query: 15  FYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGI 74
           FY+ ++         T LGFW+YLMSDCL+FA+ F TYAVLG+NYAAGPAP D+FD+  +
Sbjct: 13  FYLTEEHHPE---SSTNLGFWLYLMSDCLIFAMLFATYAVLGRNYAAGPAPADLFDLKLV 69

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            ++T +LL SS++  FAML+         T+ WL VT  FG IF+ +E+YEF HLI   A
Sbjct: 70  AINTAMLLFSSITYGFAMLSMEKNN-KAATLIWLGVTGVFGAIFLALELYEFVHLIHEGA 128

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            P RSAFLS+FF LVG HGLHV FG+IWL  L+ Q+ K GLI  N+RRL+CLSMFWHFLD
Sbjct: 129 GPNRSAFLSAFFTLVGTHGLHVTFGIIWLVTLMAQVGKHGLIEANRRRLMCLSMFWHFLD 188

Query: 195 LIWICVFSFVYLMGVV 210
           +IWI VFS+VYL+GV+
Sbjct: 189 VIWIGVFSYVYLLGVI 204


>gi|326389122|ref|ZP_08210702.1| cytochrome c oxidase, subunit III [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326206353|gb|EGD57190.1| cytochrome c oxidase, subunit III [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 212

 Score =  137 bits (346), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 105/190 (55%), Positives = 139/190 (73%), Gaps = 1/190 (0%)

Query: 21  KESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIV 80
           +    +   T LGFWIYLMSD L+FA+ F  +AVLG NYAAGP P D+F++  +  +T +
Sbjct: 23  EHDHPEGGSTQLGFWIYLMSDLLIFAMLFAAFAVLGGNYAAGPGPKDLFELPLVAFNTSM 82

Query: 81  LLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA 140
           LL SS++  FAM+     R +     WL+VTA FG  F+ +E+YEF++LI   A PQRSA
Sbjct: 83  LLFSSITYGFAMIEMQKGR-VGGVQFWLVVTALFGATFLGVELYEFSNLIHEGATPQRSA 141

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICV 200
           FLS+FF LVG HGLHV FGLIWL VL++Q+ ++GL   N+RRL+CLSMFWHFLD++W+ V
Sbjct: 142 FLSAFFTLVGTHGLHVTFGLIWLGVLLVQLSQRGLEEANKRRLLCLSMFWHFLDVVWVGV 201

Query: 201 FSFVYLMGVV 210
           F+FVYLMGV+
Sbjct: 202 FTFVYLMGVL 211


>gi|242240300|ref|YP_002988481.1| cytochrome o ubiquinol oxidase subunit III [Dickeya dadantii
           Ech703]
 gi|242132357|gb|ACS86659.1| cytochrome o ubiquinol oxidase, subunit III [Dickeya dadantii
           Ech703]
          Length = 203

 Score =  137 bits (346), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 94/203 (46%), Positives = 127/203 (62%), Gaps = 1/203 (0%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPID 67
            +          +            GFWIYLMSDC++F + F TYAVL    A GP+  D
Sbjct: 2   ATDTLHRNVAHAEHGHHDTGATKVFGFWIYLMSDCILFGMLFATYAVLVNGTAGGPSGKD 61

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
           +FD+  + V T  LL SS++   AM+A   K    +  +WL +T  FG++FI MEIYEF 
Sbjct: 62  IFDLKFVLVETFALLFSSITYGMAMIA-MNKNSKSQVNTWLALTFLFGLVFIGMEIYEFH 120

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
            LI     P RSAFLS+FFALVG HG+HV  GLIW+ +++ Q+  +GL + N+ RL+CLS
Sbjct: 121 KLIEEGFGPDRSAFLSAFFALVGTHGIHVTSGLIWIAIMMTQVAGRGLTATNRTRLMCLS 180

Query: 188 MFWHFLDLIWICVFSFVYLMGVV 210
           +FWHFLD++WICVF+ VYLMG +
Sbjct: 181 LFWHFLDVVWICVFTVVYLMGAM 203


>gi|145299869|ref|YP_001142710.1| cytochrome o ubiquinol oxidase subunit III [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142852641|gb|ABO90962.1| cytochrome o ubiquinol oxidase subunit III [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 204

 Score =  137 bits (346), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 102/200 (51%), Positives = 129/200 (64%), Gaps = 4/200 (2%)

Query: 14  LFYVKDKKESCVDHD---GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFD 70
           L +  +       HD       GFWIYLMSDC++FA  F TYAVL    A GP+  D+F+
Sbjct: 6   LHHTHEGAHDHGHHDAGANKVFGFWIYLMSDCILFACLFATYAVLVNGTAGGPSGKDIFE 65

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
           +  +F  T++LL SS++  FAMLA   K        WLLVT   G  FI MEIYEF HLI
Sbjct: 66  LPFVFAETMLLLFSSITFGFAMLA-MNKGRAAAVNGWLLVTFVLGAGFIAMEIYEFHHLI 124

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
           +    P RSAFLS+FF LVG HG+HV  GLIWL V+++ + KKGL    + RL+CLS+FW
Sbjct: 125 AEGYGPDRSAFLSAFFTLVGTHGIHVTSGLIWLIVMMVLVAKKGLTDRTRSRLMCLSLFW 184

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD++WICVF+ VYLMG +
Sbjct: 185 HFLDVVWICVFTVVYLMGAM 204


>gi|161504382|ref|YP_001571494.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865729|gb|ABX22352.1| hypothetical protein SARI_02493 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 204

 Score =  137 bits (346), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 96/195 (49%), Positives = 127/195 (65%), Gaps = 2/195 (1%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF 75
           +  +             GFWIYLMSDC++F++ F TYAVL    A GP   D+F++  + 
Sbjct: 12  HAHEHGHHDAGQT-KVFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVL 70

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           V T +LL SS++   A +A        + +SWL +T  FG  FI MEIYEF HLI     
Sbjct: 71  VETFLLLFSSITYGMAAIAMHKNNQS-QVISWLALTFLFGAGFIGMEIYEFHHLIVEGMG 129

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           P RS FLS+FFALVG HGLHV  GLIW+ VL++Q+ ++GL S N+ R++CLS+FWHFLD+
Sbjct: 130 PDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQVARRGLTSTNRTRIMCLSLFWHFLDV 189

Query: 196 IWICVFSFVYLMGVV 210
           IWICVF+ VYLMG +
Sbjct: 190 IWICVFTVVYLMGAM 204


>gi|260596798|ref|YP_003209369.1| cytochrome o ubiquinol oxidase subunit III [Cronobacter turicensis
           z3032]
 gi|260215975|emb|CBA28616.1| Cytochrome o ubiquinol oxidase subunit 3 [Cronobacter turicensis
           z3032]
          Length = 205

 Score =  137 bits (346), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 97/200 (48%), Positives = 128/200 (64%), Gaps = 1/200 (0%)

Query: 11  NFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFD 70
           N  L +   +            GFWIYLMSDC++FA  F TYAVL    A GP   D+F+
Sbjct: 7   NHELAHGSHEHGHHDAGANKVFGFWIYLMSDCILFACLFATYAVLVNGTAGGPTGKDIFE 66

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
           +  + V T +LL SS++   AM+A   K    + +SWL +T  FG  F+ MEIYEF HLI
Sbjct: 67  LPFVLVETFLLLFSSITYGMAMIA-MNKDKQSQVMSWLALTFLFGAGFVAMEIYEFHHLI 125

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
           +    P +S FLS+FF LVG HG+HV  GLIW+ V++I + ++GL   N+ RL+CLSMFW
Sbjct: 126 AEGFGPDKSGFLSAFFTLVGTHGIHVTSGLIWMVVMMIHVSRRGLTHNNRARLMCLSMFW 185

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD++WICVFS VYLMG +
Sbjct: 186 HFLDVVWICVFSVVYLMGAM 205


>gi|306813104|ref|ZP_07447297.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli NC101]
 gi|331656485|ref|ZP_08357447.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           TA206]
 gi|305853867|gb|EFM54306.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli NC101]
 gi|320197132|gb|EFW71749.1| Cytochrome O ubiquinol oxidase subunit III [Escherichia coli
           WV_060327]
 gi|331054733|gb|EGI26742.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli
           TA206]
          Length = 204

 Score =  137 bits (346), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 100/204 (49%), Positives = 132/204 (64%), Gaps = 2/204 (0%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTY-LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI 66
            +   +       +    D  GT   GFWIYLMSDC++F++ F TYAVL    A GP   
Sbjct: 2   ATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGK 61

Query: 67  DVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEF 126
           D+F++  + V T +LL SS++   A +A   K    + VSWL +T  FG  FI ME+YEF
Sbjct: 62  DIFELPFVLVETFLLLFSSITYGMAAIA-MYKNNKSQVVSWLALTWLFGAGFIGMELYEF 120

Query: 127 AHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
            HLI     P RS FLS+FFALVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CL
Sbjct: 121 HHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCL 180

Query: 187 SMFWHFLDLIWICVFSFVYLMGVV 210
           S+FWHFLD++WICVF+ VYLMG +
Sbjct: 181 SLFWHFLDVVWICVFTVVYLMGAM 204


>gi|156935021|ref|YP_001438937.1| cytochrome o ubiquinol oxidase subunit III [Cronobacter sakazakii
           ATCC BAA-894]
 gi|156533275|gb|ABU78101.1| hypothetical protein ESA_02872 [Cronobacter sakazakii ATCC BAA-894]
          Length = 205

 Score =  137 bits (346), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 96/200 (48%), Positives = 127/200 (63%), Gaps = 1/200 (0%)

Query: 11  NFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFD 70
           N  L +   +            GFWIYLMSDC++FA  F TYAVL    A GP   D+F+
Sbjct: 7   NHELAHGSHEHGHHDAGANKVFGFWIYLMSDCILFACLFATYAVLVNGTAGGPTGKDIFE 66

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
           +  + V T +LL SS++   AM+A        + +SWL +T  FG  F+ MEIYEF HLI
Sbjct: 67  LPFVLVETFLLLFSSITYGMAMIA-MNNNKQSQVMSWLALTFLFGAGFVAMEIYEFHHLI 125

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
           +    P +S FLS+FF LVG HG+HV  GLIW+ V++I + ++GL   N+ RL+CLSMFW
Sbjct: 126 AEGFGPDKSGFLSAFFTLVGTHGIHVTSGLIWMVVMMIHVSRRGLTHNNRARLMCLSMFW 185

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD++WICVFS VYLMG +
Sbjct: 186 HFLDVVWICVFSVVYLMGAM 205


>gi|157369331|ref|YP_001477320.1| cytochrome o ubiquinol oxidase subunit III [Serratia proteamaculans
           568]
 gi|157321095|gb|ABV40192.1| Cytochrome o ubiquinol oxidase subunit III [Serratia proteamaculans
           568]
          Length = 205

 Score =  137 bits (346), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 96/194 (49%), Positives = 128/194 (65%), Gaps = 1/194 (0%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
              +       +    GFWIYLMSDC++FA  F TYAVL    A GP+  D+FD+  + V
Sbjct: 12  AHAEHGHHDAGETKVFGFWIYLMSDCILFASLFATYAVLVNGTAGGPSGKDIFDLKFVLV 71

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T +LL SS++   AM+    K  +    +WL +T  FG+ F+ MEIYEF HLI     P
Sbjct: 72  ETFLLLFSSITYGMAMI-GMNKGKVGSVNTWLFLTFLFGLGFVAMEIYEFHHLIVEGYGP 130

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
            RSAFLS FFALV  HGLHV  GL+W+ +++IQ+ K+GL S N+ RL+CLS+FWHFLD++
Sbjct: 131 DRSAFLSGFFALVATHGLHVTTGLVWIVIMMIQVSKRGLTSTNKTRLMCLSLFWHFLDVV 190

Query: 197 WICVFSFVYLMGVV 210
           WICVF+ VYL+GV+
Sbjct: 191 WICVFTVVYLLGVM 204


>gi|295691074|ref|YP_003594767.1| cytochrome o ubiquinol oxidase subunit III [Caulobacter segnis ATCC
           21756]
 gi|295432977|gb|ADG12149.1| cytochrome o ubiquinol oxidase, subunit III [Caulobacter segnis
           ATCC 21756]
          Length = 208

 Score =  137 bits (346), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 113/209 (54%), Positives = 152/209 (72%), Gaps = 4/209 (1%)

Query: 2   SRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAA 61
           S+     + +   FY+  +       +GT LGFWIYLMSDCL+FAV F  YAVLG+NYAA
Sbjct: 3   SQAHALTAADKDRFYMTKEHHPE---NGTLLGFWIYLMSDCLIFAVLFACYAVLGRNYAA 59

Query: 62  GPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIM 121
           GP+  D+FD+  + V+T +LLLSS++  FAM+++  K++    ++WL VT   G+ F+ +
Sbjct: 60  GPSGADLFDLPLVAVNTALLLLSSITYGFAMISAQAKKVKP-VLAWLAVTGLLGLGFLSL 118

Query: 122 EIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQR 181
           E+YEF HLI   A PQRSAFLSSFF LVG HGLHV FG+IWL  L++Q+ ++GL +  +R
Sbjct: 119 ELYEFHHLIHEGAGPQRSAFLSSFFVLVGTHGLHVTFGVIWLVTLMVQVAQRGLGAEMKR 178

Query: 182 RLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RL+CLSMFWHFLD+IWI VFSFVYL+GV+
Sbjct: 179 RLMCLSMFWHFLDVIWIGVFSFVYLLGVL 207


>gi|312961437|ref|ZP_07775940.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas
           fluorescens WH6]
 gi|311284332|gb|EFQ62910.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas
           fluorescens WH6]
          Length = 204

 Score =  137 bits (345), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 92/198 (46%), Positives = 128/198 (64%), Gaps = 2/198 (1%)

Query: 13  SLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
            + +  ++            GFWIYLM+DC++FA  F  YAVL  + A GP+ +D+F++ 
Sbjct: 9   DIAHTHEQGHEDAGSLSL-FGFWIYLMTDCILFATLFAGYAVLRDSVAGGPSSVDIFELP 67

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            +   T++LLLSS++  +AMLA    +  H  + WL +T   G  FI MEI EF HLI  
Sbjct: 68  YVLGETMLLLLSSITYGYAMLAMNRGQQGH-VLRWLGLTFVLGAGFIAMEINEFHHLIEA 126

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
              P RSAFL++FF LVG HG HV  GL+W+ VL+ Q+ ++GL + N  RL CLS+FWHF
Sbjct: 127 GHGPDRSAFLTAFFTLVGTHGAHVLTGLVWMAVLMAQVHQRGLTTTNATRLSCLSLFWHF 186

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD++WICVF+ VYL+GVV
Sbjct: 187 LDVVWICVFTVVYLLGVV 204


>gi|300715584|ref|YP_003740387.1| cytochrome o ubiquinol oxidase subunit III [Erwinia billingiae
           Eb661]
 gi|299061420|emb|CAX58532.1| Cytochrome o ubiquinol oxidase subunit III [Erwinia billingiae
           Eb661]
          Length = 204

 Score =  137 bits (345), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 95/197 (48%), Positives = 127/197 (64%), Gaps = 1/197 (0%)

Query: 14  LFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISG 73
                 +            GFWIYLMSDC++FA  F T+ V+  + A GPA  D+F++  
Sbjct: 9   HHDAHAEHGHHDAGANKVFGFWIYLMSDCIIFATLFATFGVMVNSTAGGPAGKDIFELPF 68

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           +   T +LLLSS++  FA+++   K      +SWL++T  FG  FI MEIYEF HLI   
Sbjct: 69  VLGETALLLLSSITYGFAVIS-MNKGSKGSVISWLMLTFLFGAGFIAMEIYEFHHLIMEG 127

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
             PQRS FLS+FF LVG HGLHV  GLIW+ VL+ Q+ K+GL   N+ R++CLS+FWHFL
Sbjct: 128 FGPQRSGFLSAFFTLVGTHGLHVTSGLIWMAVLMYQVSKRGLTPTNRTRILCLSLFWHFL 187

Query: 194 DLIWICVFSFVYLMGVV 210
           D++WICVF+ VYLMG +
Sbjct: 188 DVVWICVFTIVYLMGAM 204


>gi|92113084|ref|YP_573012.1| cytochrome c oxidase, subunit III [Chromohalobacter salexigens DSM
           3043]
 gi|91796174|gb|ABE58313.1| cytochrome bo3 quinol oxidase subunit 3 [Chromohalobacter
           salexigens DSM 3043]
          Length = 205

 Score =  137 bits (345), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 97/195 (49%), Positives = 128/195 (65%), Gaps = 1/195 (0%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF 75
           +  D  E          GFW+YLMSD ++F   F TYAVL    A GP+  D+F++  I 
Sbjct: 12  HAHDGHEHHDAGGMKVFGFWVYLMSDLVIFGSLFATYAVLMNGTAGGPSGADIFELPLIL 71

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           +ST +LL SS +   A+LA      + +   WL++T F G  FI +EIYEF HLI+    
Sbjct: 72  ISTFLLLFSSFTYGMAVLA-MNADRVSQVRGWLILTFFLGAGFIGLEIYEFHHLIAEGFG 130

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           P RSAFLSSFF LVG HGLHV FGLIW+ V+++Q+  KGL    + R++CLS+FWHFLD+
Sbjct: 131 PDRSAFLSSFFTLVGTHGLHVTFGLIWMLVMIVQLSTKGLNDMTRPRIMCLSLFWHFLDI 190

Query: 196 IWICVFSFVYLMGVV 210
           +WICVF+FVYLMGV+
Sbjct: 191 VWICVFTFVYLMGVL 205


>gi|237808829|ref|YP_002893269.1| cytochrome o ubiquinol oxidase, subunit III [Tolumonas auensis DSM
           9187]
 gi|237501090|gb|ACQ93683.1| cytochrome o ubiquinol oxidase, subunit III [Tolumonas auensis DSM
           9187]
          Length = 204

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 102/191 (53%), Positives = 130/191 (68%), Gaps = 1/191 (0%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTI 79
           + E       +  GFWIYLMSDC++FA  F TYAVL  ++A GP   D+F++  +   T 
Sbjct: 15  EHEHHDSGSNSVFGFWIYLMSDCILFATLFATYAVLSGSFAGGPTGKDIFELPYVLTETF 74

Query: 80  VLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS 139
            LL+SS +   AMLA   +      + WL VT FFG  FI MEI EF+HLIS    P RS
Sbjct: 75  CLLISSFTYGMAMLA-MNRGEQSSVMKWLAVTFFFGAAFIGMEINEFSHLISEGYGPDRS 133

Query: 140 AFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWIC 199
           AFLS FFAL+G HGLHVF GL+W+ VL+IQ+ + GL + NQ RL+CLS+FWHFLD++WIC
Sbjct: 134 AFLSGFFALIGTHGLHVFSGLVWMIVLMIQVAQNGLTTTNQTRLMCLSLFWHFLDIVWIC 193

Query: 200 VFSFVYLMGVV 210
           VF+ VYLMGV+
Sbjct: 194 VFTVVYLMGVL 204


>gi|309794840|ref|ZP_07689261.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           145-7]
 gi|308121493|gb|EFO58755.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           145-7]
          Length = 204

 Score =  137 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 99/204 (48%), Positives = 131/204 (64%), Gaps = 2/204 (0%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTY-LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI 66
            +   +       +    D  GT   GFWIYLMSDC++F++ F TYAVL    A GP   
Sbjct: 2   ATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGK 61

Query: 67  DVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEF 126
           D+F++  + V T +LL SS++   A +A   K    + +SWL +T  FG  FI MEIYEF
Sbjct: 62  DIFELPFVLVETFLLLFSSITYGMAAIA-MYKNNKSQVISWLALTWLFGAGFIGMEIYEF 120

Query: 127 AHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
            HLI     P  S FLS+FFALVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CL
Sbjct: 121 HHLIVNGMGPDHSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCL 180

Query: 187 SMFWHFLDLIWICVFSFVYLMGVV 210
           S+FWHFLD++WICVF+ VYLMG +
Sbjct: 181 SLFWHFLDVVWICVFTVVYLMGAM 204


>gi|110640690|ref|YP_668418.1| cytochrome o ubiquinol oxidase subunit III [Escherichia coli 536]
 gi|191173519|ref|ZP_03035046.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli F11]
 gi|300997383|ref|ZP_07181723.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           200-1]
 gi|110342282|gb|ABG68519.1| cytochrome O ubiquinol oxidase subunit III [Escherichia coli 536]
 gi|190906228|gb|EDV65840.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli F11]
 gi|300304202|gb|EFJ58722.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           200-1]
 gi|324010690|gb|EGB79909.1| cytOchrome o ubiquinol oxidase, subunit III [Escherichia coli MS
           60-1]
          Length = 204

 Score =  137 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 100/204 (49%), Positives = 131/204 (64%), Gaps = 2/204 (0%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTY-LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI 66
            +   +       +    D  GT   GFWIYLMSDC++F++ F TYAVL    A GP   
Sbjct: 2   ATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGK 61

Query: 67  DVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEF 126
           D+F++  + V T  LL SS++   A +A   K    + +SWL +T  FG  FI MEIYEF
Sbjct: 62  DIFELPFVLVETFFLLFSSITYGMAAIA-MYKNNKSQVISWLALTWLFGAGFIGMEIYEF 120

Query: 127 AHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
            HLI     P RS FLS+FFALVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CL
Sbjct: 121 HHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCL 180

Query: 187 SMFWHFLDLIWICVFSFVYLMGVV 210
           S+FWHFLD++WICVF+ VYLMG +
Sbjct: 181 SLFWHFLDVVWICVFTVVYLMGAM 204


>gi|27375262|ref|NP_766791.1| cytochrome O ubiquinol oxidase subunit III [Bradyrhizobium
           japonicum USDA 110]
 gi|27348398|dbj|BAC45416.1| cytochrome O ubiquinol oxidase subunit III [Bradyrhizobium
           japonicum USDA 110]
          Length = 209

 Score =  137 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 110/191 (57%), Positives = 139/191 (72%), Gaps = 1/191 (0%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTI 79
            +    +   T LGFWIYLMSDCL+FA+ F  + VLG NYAAGPAP D+FD+  + V+T 
Sbjct: 19  DEHPHPEGYSTSLGFWIYLMSDCLIFAMLFAAFGVLGANYAAGPAPKDLFDLDLVAVNTS 78

Query: 80  VLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS 139
           +LLLSS++  FAML    +  I +T  WL +T  FG  FI +E+ EFAH+I   A PQRS
Sbjct: 79  MLLLSSITYGFAMLTMQ-QNKIAQTQMWLAITGLFGAAFIGIELTEFAHMIHEGATPQRS 137

Query: 140 AFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWIC 199
           AFLS+FF LVG HGLHV  GLIWL  L++Q+ K GLI  N+RRL+CLSMFWHFLD++WI 
Sbjct: 138 AFLSAFFTLVGTHGLHVSCGLIWLVTLMVQVWKFGLIEANRRRLMCLSMFWHFLDVVWIG 197

Query: 200 VFSFVYLMGVV 210
           VF+FVYL+GV+
Sbjct: 198 VFTFVYLLGVL 208


>gi|262276815|ref|ZP_06054608.1| cytoChrome c oxidase subunit 3 (Cytochrome c oxidasepolypeptide
           III) [alpha proteobacterium HIMB114]
 gi|262223918|gb|EEY74377.1| cytoChrome c oxidase subunit 3 (Cytochrome c oxidasepolypeptide
           III) [alpha proteobacterium HIMB114]
          Length = 262

 Score =  137 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 42/198 (21%), Positives = 84/198 (42%), Gaps = 11/198 (5%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG------KNYAAGPAPIDVFDI 71
            +   + V   G   G  ++++S+ + F  +F  Y                P  I+  D 
Sbjct: 68  HNGDHTPVVQIGMRYGMILFIVSEVMFFVAWFWAYFDASLYPDAVGGSVWPPKGIETLDP 127

Query: 72  S-GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
                ++T++LLLS  + ++A  A             L++T   G IF + + YE+   +
Sbjct: 128 WHIPLINTLILLLSGTTVTWAHHALLEND-RKSLKQGLILTVILGAIFTMFQAYEY---V 183

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                     + ++F+   G HG HV  G ++L V + ++        +       + +W
Sbjct: 184 VAPFNLSSGIYGATFYMATGFHGFHVLVGTLFLLVCLFRVNAGHYKPDHHFGFEAAAWYW 243

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ +F+ VY+ G
Sbjct: 244 HFVDVVWLFLFAAVYIWG 261


>gi|73538717|ref|YP_299084.1| cytochrome ubiquinol oxidase subunit III [Ralstonia eutropha
           JMP134]
 gi|72122054|gb|AAZ64240.1| cytochrome ubiquinol oxidase subunit III [Ralstonia eutropha
           JMP134]
          Length = 229

 Score =  137 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 101/185 (54%), Positives = 131/185 (70%), Gaps = 1/185 (0%)

Query: 26  DHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSS 85
             +GT LGFWIYLMSDCL+FA  F  Y VLG++YA GP   ++FD+  + ++T  LLLSS
Sbjct: 45  VPNGTLLGFWIYLMSDCLIFACLFAAYGVLGRSYAGGPTGAELFDLPLVALNTSFLLLSS 104

Query: 86  LSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSF 145
           ++  FAML    +  +  T  WL +T   G  F+ +EIYEF HL+   A P RS FL+SF
Sbjct: 105 ITYGFAMLQMQ-QGRVGGTQGWLAITGVLGACFLGVEIYEFVHLVGEGAGPWRSGFLTSF 163

Query: 146 FALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVY 205
           F+LV  HGLHV FG+IWL  L++Q+   GLI  N+RRL+CLSMFWHFLD++WI VF+FVY
Sbjct: 164 FSLVSTHGLHVTFGIIWLITLMVQVRLHGLIPENRRRLMCLSMFWHFLDVVWIGVFTFVY 223

Query: 206 LMGVV 210
           LMGV+
Sbjct: 224 LMGVL 228


>gi|320540329|ref|ZP_08039981.1| cytochrome o ubiquinol oxidase subunit III [Serratia symbiotica
           str. Tucson]
 gi|320029649|gb|EFW11676.1| cytochrome o ubiquinol oxidase subunit III [Serratia symbiotica
           str. Tucson]
          Length = 205

 Score =  137 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 98/194 (50%), Positives = 129/194 (66%), Gaps = 1/194 (0%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
              +       +    GFWIYLMSDC++FA  F TYAVL    A GPA  D+F++  + V
Sbjct: 12  AHAEHGHHDAGETKVFGFWIYLMSDCILFACLFATYAVLANGTAGGPAGKDIFELKFVLV 71

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T +LL SS++   AM+A    + +     WL +T  FG+ F+ MEIYEF HLI     P
Sbjct: 72  ETFLLLFSSITYGMAMIAMKKGK-VGGVNIWLFLTFLFGLGFVAMEIYEFHHLIVEGFGP 130

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
            RSAFLSSFFALV  HGLHV  GLIW+ +++IQ+ ++GL S N+ RL+CLS+FWHFLD+I
Sbjct: 131 DRSAFLSSFFALVATHGLHVSIGLIWITIMMIQVSQRGLTSINKTRLMCLSLFWHFLDVI 190

Query: 197 WICVFSFVYLMGVV 210
           WICVF+ VYL+GV+
Sbjct: 191 WICVFTVVYLLGVM 204


>gi|22124926|ref|NP_668349.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis KIM 10]
 gi|45440614|ref|NP_992153.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51595300|ref|YP_069491.1| cytochrome o ubiquinol oxidase subunit III [Yersinia
           pseudotuberculosis IP 32953]
 gi|108808651|ref|YP_652567.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis
           Antiqua]
 gi|108811090|ref|YP_646857.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis
           Nepal516]
 gi|145600060|ref|YP_001164136.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis
           Pestoides F]
 gi|149364988|ref|ZP_01887023.1| cytochrome O ubiquinol oxidase subunit III [Yersinia pestis
           CA88-4125]
 gi|153950151|ref|YP_001402060.1| cytochrome O ubiquinol oxidase subunit III [Yersinia
           pseudotuberculosis IP 31758]
 gi|162418305|ref|YP_001607428.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis Angola]
 gi|165926547|ref|ZP_02222379.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165935983|ref|ZP_02224553.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166010997|ref|ZP_02231895.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166213115|ref|ZP_02239150.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167398830|ref|ZP_02304354.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167421497|ref|ZP_02313250.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167423092|ref|ZP_02314845.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167469783|ref|ZP_02334487.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis FV-1]
 gi|170025460|ref|YP_001721965.1| cytochrome o ubiquinol oxidase subunit III [Yersinia
           pseudotuberculosis YPIII]
 gi|186894317|ref|YP_001871429.1| cytochrome o ubiquinol oxidase subunit III [Yersinia
           pseudotuberculosis PB1/+]
 gi|218930196|ref|YP_002348071.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis CO92]
 gi|229838771|ref|ZP_04458930.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229896075|ref|ZP_04511245.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis
           Pestoides A]
 gi|229899339|ref|ZP_04514482.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229901317|ref|ZP_04516439.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis
           Nepal516]
 gi|270489505|ref|ZP_06206579.1| putative quinol oxidase, subunit 3 [Yersinia pestis KIM D27]
 gi|21957764|gb|AAM84600.1|AE013705_3 cytochrome o ubiquinol oxidase subunit III [Yersinia pestis KIM 10]
 gi|45435471|gb|AAS61030.1| cytochrome O ubiquinol oxidase subunit III [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51588582|emb|CAH20190.1| cytochrome o ubiquinol oxidase subunit III [Yersinia
           pseudotuberculosis IP 32953]
 gi|108774738|gb|ABG17257.1| cytochrome O ubiquinol oxidase subunit III [Yersinia pestis
           Nepal516]
 gi|108780564|gb|ABG14622.1| cytochrome O ubiquinol oxidase subunit III [Yersinia pestis
           Antiqua]
 gi|115348807|emb|CAL21761.1| cytochrome O ubiquinol oxidase subunit III [Yersinia pestis CO92]
 gi|145211756|gb|ABP41163.1| cytochrome O ubiquinol oxidase subunit III [Yersinia pestis
           Pestoides F]
 gi|149291401|gb|EDM41475.1| cytochrome O ubiquinol oxidase subunit III [Yersinia pestis
           CA88-4125]
 gi|152961646|gb|ABS49107.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia
           pseudotuberculosis IP 31758]
 gi|162351120|gb|ABX85068.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis
           Angola]
 gi|165916128|gb|EDR34735.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165921475|gb|EDR38672.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165989997|gb|EDR42298.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166205902|gb|EDR50382.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166960416|gb|EDR56437.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167051334|gb|EDR62742.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167057262|gb|EDR67008.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169751994|gb|ACA69512.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia
           pseudotuberculosis YPIII]
 gi|186697343|gb|ACC87972.1| cytochrome o ubiquinol oxidase, subunit III [Yersinia
           pseudotuberculosis PB1/+]
 gi|229681246|gb|EEO77340.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis
           Nepal516]
 gi|229687741|gb|EEO79814.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229695137|gb|EEO85184.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229700998|gb|EEO89027.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis
           Pestoides A]
 gi|270338009|gb|EFA48786.1| putative quinol oxidase, subunit 3 [Yersinia pestis KIM D27]
 gi|320016353|gb|ADV99924.1| cytochrome o ubiquinol oxidase subunit III [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 204

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 91/195 (46%), Positives = 127/195 (65%), Gaps = 1/195 (0%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF 75
               +            GFW+YLMSDC++FA  F TYAVL    A GP+  ++FD++ + 
Sbjct: 11  VAHAEHGHHDAGATKVFGFWVYLMSDCILFATLFATYAVLVNGTAGGPSGKELFDLNFVL 70

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           V T +LL SS++   AML   +K  + +  +WL  T  FG+ FI ME+YEF  LI     
Sbjct: 71  VETFLLLFSSITYGVAML-GMSKGSVKQVNTWLGFTFLFGLGFIAMELYEFHKLIEEGYG 129

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           P RS FLS++FALVG HGLHV  GL W+ +++IQ+ ++GL S N+ RL+CLS+FWHFLD+
Sbjct: 130 PARSGFLSAYFALVGTHGLHVTAGLAWIIIMMIQVARRGLNSTNRTRLMCLSLFWHFLDV 189

Query: 196 IWICVFSFVYLMGVV 210
           +WICVF+ VYL+G +
Sbjct: 190 VWICVFTVVYLLGAI 204


>gi|28198531|ref|NP_778845.1| cytochrome O ubiquinol oxidase subunit III [Xylella fastidiosa
           Temecula1]
 gi|71897569|ref|ZP_00679814.1| Cytochrome c oxidase, subunit III [Xylella fastidiosa Ann-1]
 gi|182681210|ref|YP_001829370.1| cytochrome o ubiquinol oxidase, subunit III [Xylella fastidiosa
           M23]
 gi|28056615|gb|AAO28494.1| cytochrome O ubiquinol oxidase subunit III [Xylella fastidiosa
           Temecula1]
 gi|71732472|gb|EAO34525.1| Cytochrome c oxidase, subunit III [Xylella fastidiosa Ann-1]
 gi|182631320|gb|ACB92096.1| cytochrome o ubiquinol oxidase, subunit III [Xylella fastidiosa
           M23]
          Length = 202

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 103/195 (52%), Positives = 130/195 (66%), Gaps = 2/195 (1%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF 75
           + +D        D T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + 
Sbjct: 10  HNRDHAHHDT-GDNTVFGFWVYLMSDCLIFAGLFATYAVLVGATVDGPTAKELFDLKFVL 68

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           V T +LL SSL+  FAM+A+  +  I     WL+VTA FG+ F+ ME+YEF HLI   A 
Sbjct: 69  VETFLLLFSSLTFGFAMIAAHKRH-IPALYGWLMVTALFGLGFLGMELYEFHHLIQEGAG 127

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           P RSAFLS+FF LVG HGLHV  GL+W+ +LVIQI+K GL   N  RL CLS+FWHFLD+
Sbjct: 128 PGRSAFLSAFFTLVGTHGLHVASGLLWMLILVIQIVKNGLTPRNSTRLACLSLFWHFLDV 187

Query: 196 IWICVFSFVYLMGVV 210
           IWI VF+ VYL+G +
Sbjct: 188 IWIGVFTIVYLLGAL 202


>gi|146338787|ref|YP_001203835.1| cytochrome o ubiquinol oxidase subunit III [Bradyrhizobium sp.
           ORS278]
 gi|146191593|emb|CAL75598.1| Cytochrome o ubiquinol oxidase subunit III (Ubiquinol oxidase chain
           C) [Bradyrhizobium sp. ORS278]
          Length = 209

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 115/210 (54%), Positives = 148/210 (70%), Gaps = 2/210 (0%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           M+           +FYV D+ +   +   T LGFWIYLMSDCL+FA+ F  Y VLG  YA
Sbjct: 1   MTIAAGTMKAGEPVFYVVDEHDHP-EGSSTQLGFWIYLMSDCLIFAILFAVYGVLGTKYA 59

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
           AGPAP D+FD+S + ++T  LLLSSL+  FAML+   +  +     WL+VT  FG+ F+ 
Sbjct: 60  AGPAPKDLFDLSLVALNTSFLLLSSLTYGFAMLSMQ-QNRVGAMQGWLVVTGLFGLAFLG 118

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           +E+ EFAH+I   A PQRSAFLSSFF LVG HGLHV FGL+WL  L++Q+ + GLI  N+
Sbjct: 119 IELTEFAHMIHEGATPQRSAFLSSFFTLVGTHGLHVTFGLVWLVTLMVQVKRFGLIEANR 178

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RRL+CLSMFWHFLD+IWI VF+FVYLMG++
Sbjct: 179 RRLVCLSMFWHFLDVIWIGVFTFVYLMGML 208


>gi|238920119|ref|YP_002933634.1| cytochrome o ubiquinol oxidase, subunit III, [Edwardsiella ictaluri
           93-146]
 gi|238869688|gb|ACR69399.1| cytochrome o ubiquinol oxidase, subunit III, putative [Edwardsiella
           ictaluri 93-146]
          Length = 205

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 97/194 (50%), Positives = 127/194 (65%), Gaps = 1/194 (0%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
              +       +    GFWIYLMSDC++FA  F TYAVL    A GP   ++FD+  + V
Sbjct: 12  AHAEHGHHDAGETKVFGFWIYLMSDCILFAGLFATYAVLVNGTAGGPTGKEIFDLKFVLV 71

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T +LL SS++   A+ A   K  +     WLL+T  FG+ F+ ME+YEF HLI+    P
Sbjct: 72  ETFLLLFSSITYGMAIGA-MNKGSVGGVNVWLLLTFLFGLGFVSMEVYEFHHLITEGFGP 130

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
            RS FLSSFFALVG HGLHV  GL W+ V++IQI K GL + N+ RL+CLS+FWHFLD+I
Sbjct: 131 DRSGFLSSFFALVGTHGLHVTAGLTWIVVMMIQISKFGLTAANKTRLMCLSLFWHFLDVI 190

Query: 197 WICVFSFVYLMGVV 210
           WIC+F+ VYL+GV+
Sbjct: 191 WICLFTAVYLLGVM 204


>gi|300721999|ref|YP_003711279.1| cytochrome o ubiquinol oxidase subunit III [Xenorhabdus nematophila
           ATCC 19061]
 gi|297628496|emb|CBJ89063.1| cytochrome o ubiquinol oxidase, subunit III [Xenorhabdus
           nematophila ATCC 19061]
          Length = 203

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 99/194 (51%), Positives = 126/194 (64%), Gaps = 1/194 (0%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
             D             GFWIYLMSD ++FA  F TYAVL    A GP   D+F++  + V
Sbjct: 11  AHDTHGHHDAGANKIFGFWIYLMSDLVLFASLFATYAVLVNGTAGGPTGKDIFELDFVLV 70

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T +LL SS++  FAML+   K  + +   WL +T  FG+ FI ME+YEF  LIS    P
Sbjct: 71  ETFLLLFSSITYGFAMLS-MNKGKVAQVNLWLFITFLFGLGFISMEVYEFHKLISEGFGP 129

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
            RSAFLSSFFALV  HGLHV FGLIW+ VL++Q+ ++GL   N+ RL CLS+FWHFLD++
Sbjct: 130 DRSAFLSSFFALVATHGLHVTFGLIWIIVLMVQVSRRGLTEVNRTRLNCLSLFWHFLDVV 189

Query: 197 WICVFSFVYLMGVV 210
           WICVF+ VYLMG +
Sbjct: 190 WICVFTIVYLMGAM 203


>gi|293392552|ref|ZP_06636872.1| quinol oxidase subunit III [Serratia odorifera DSM 4582]
 gi|291424954|gb|EFE98163.1| quinol oxidase subunit III [Serratia odorifera DSM 4582]
          Length = 204

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 97/194 (50%), Positives = 129/194 (66%), Gaps = 1/194 (0%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
              +       +    GFWIYLMSDC++FA  F TYAVL    A GP+  D+FD+  + V
Sbjct: 12  AHAEHGHHDAGETKVFGFWIYLMSDCILFASLFATYAVLVNGTAGGPSGKDIFDLKFVLV 71

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T +LL SS++   AM+    K  +    +WL +T  FG+ F+ MEIYEF HLI+    P
Sbjct: 72  ETFLLLFSSITYGMAMI-GMNKGKVGSVNTWLFLTFLFGLGFVAMEIYEFHHLIAEGFGP 130

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
             SAFLSSFFALVG HGLHV  GL+W+ +++IQ+ K GL S N+ RL+CLS+FWHFLD++
Sbjct: 131 DHSAFLSSFFALVGTHGLHVSAGLVWIIIMMIQVSKHGLTSTNKTRLMCLSLFWHFLDVV 190

Query: 197 WICVFSFVYLMGVV 210
           WICVF+ VYL+GV+
Sbjct: 191 WICVFTVVYLLGVM 204


>gi|77361152|ref|YP_340727.1| cytochrome o ubiquinol oxidase subunit III (ubiquinol oxidase chain
           C) [Pseudoalteromonas haloplanktis TAC125]
 gi|76876063|emb|CAI87285.1| cytochrome o ubiquinol oxidase subunit III (Ubiquinol oxidase chain
           C) [Pseudoalteromonas haloplanktis TAC125]
          Length = 215

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 100/193 (51%), Positives = 132/193 (68%), Gaps = 1/193 (0%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            D          T  GFW+YLM+DCL+FA FF TYAVL  N A G +  D+F++  + V 
Sbjct: 24  HDAHAHHDTSSNTTFGFWLYLMTDCLLFASFFATYAVLFMNTAGGVSGKDIFELDFVAVE 83

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T  LL+SS++  FAM+A+  ++    T+ WL VT   G++FI ME+YEF HLI     PQ
Sbjct: 84  TAALLISSITFGFAMIAAQGQK-KALTLIWLAVTFCLGVVFISMEVYEFNHLIVHGNGPQ 142

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
           +SAFL+SFFALVGLHGLHV  GLIW+ V++I++ K+GL      RL CLS+FWHFLD++W
Sbjct: 143 KSAFLTSFFALVGLHGLHVTAGLIWMSVMMIEVAKRGLGKATVTRLSCLSLFWHFLDIVW 202

Query: 198 ICVFSFVYLMGVV 210
           ICVF+ VYLMG +
Sbjct: 203 ICVFTLVYLMGAM 215


>gi|29570634|ref|NP_818793.1| cytochrome c oxidase subunit III [Apteronotus albifrons]
 gi|29501143|dbj|BAC67500.1| cytochrome oxidase subunit 3 [Apteronotus albifrons]
          Length = 261

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 43/196 (21%), Positives = 77/196 (39%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK------NYAAGPAPIDVFDIS 72
               +     G   G  +++ S+ L FA FF  +                P  I   D  
Sbjct: 68  QGHHTSPVQKGLRFGMILFITSEVLFFAGFFWAFYHSSLAPTPELGTHWPPTGITPLDPF 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +    + +  L +T   G+ F  ++  E+      
Sbjct: 128 EVPLLNTAVLLASGVTVTWCHHSLMEGERKQAIQSLTLTIILGLYFTALQAMEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                  A+ S+FF   G HGLHV  G  +L V +++ +K    S +       + +WHF
Sbjct: 185 PFTIADGAYGSTFFVSTGFHGLHVIIGSSFLAVCLLRQIKHHFTSEHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ +F  +Y  G
Sbjct: 245 VDVVWLFLFVSIYWWG 260


>gi|323184740|gb|EFZ70111.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia coli 1357]
          Length = 199

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 100/195 (51%), Positives = 130/195 (66%), Gaps = 2/195 (1%)

Query: 17  VKDKKESCVDHDGTY-LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF 75
               +    D  GT   GFWIYLMSDC++F++ F TYAVL    A GP   D+F++  + 
Sbjct: 6   AHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVL 65

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           V T +LL SS++   A +A   K    + +SWL +T  FG  FI MEIYEF HLI     
Sbjct: 66  VETFLLLFSSITYGMAAIA-MYKNNKSQVISWLALTWLFGAGFIGMEIYEFHHLIVNGMG 124

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           P RS FLS+FFALVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CLS+FWHFLD+
Sbjct: 125 PDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDV 184

Query: 196 IWICVFSFVYLMGVV 210
           +WICVF+ VYLMG +
Sbjct: 185 VWICVFTVVYLMGAM 199


>gi|288962726|ref|YP_003453020.1| cytochrome o ubiquinol oxidase subunit III [Azospirillum sp. B510]
 gi|288914992|dbj|BAI76476.1| cytochrome o ubiquinol oxidase subunit III [Azospirillum sp. B510]
          Length = 212

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 111/198 (56%), Positives = 144/198 (72%), Gaps = 3/198 (1%)

Query: 13  SLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
            +F+VKD+     +   T LGFWIYLMSDCL+FAV F TY VLG +YA GP P ++FD+ 
Sbjct: 17  PVFHVKDEHAH--EGASTALGFWIYLMSDCLIFAVLFATYGVLGTSYAGGPTPKELFDLK 74

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + ++T +LL SS++  FAMLA    R   +T  WL +T  FG+ F+ +E++EFAHLI  
Sbjct: 75  LVALNTSMLLFSSITYGFAMLAMEKGRT-GQTQGWLFITLLFGLAFLGIELFEFAHLIHE 133

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
            A P RSAFLSSFF LVG HGLHV FG +WL  L+IQ+ ++GLI  N+RRL+CLSMFWHF
Sbjct: 134 GAGPWRSAFLSSFFTLVGTHGLHVTFGSVWLVTLMIQVARRGLIPANRRRLMCLSMFWHF 193

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD+IWI VF++VYLMG +
Sbjct: 194 LDVIWIGVFTYVYLMGAL 211


>gi|117617508|ref|YP_857448.1| cytochrome o ubiquinol oxidase subunit III [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|117558915|gb|ABK35863.1| cytochrome o ubiquinol oxidase, subunit III [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 203

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 100/198 (50%), Positives = 130/198 (65%), Gaps = 4/198 (2%)

Query: 16  YVKDKKESCVDHD---GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
           +          HD       GFWIYLMSDC++FA  F TYAVL    A GP+  D+F++ 
Sbjct: 7   HHTQGAHEDGHHDAGANKVFGFWIYLMSDCILFATLFATYAVLVNGTAGGPSGKDIFELP 66

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            +F  T++LLLSS++  F MLA   K  +    +WL +T  FG  FI MEIYEF HLI+ 
Sbjct: 67  FVFAETMLLLLSSITFGFGMLA-MNKNKVAAVNTWLFITFLFGAGFIAMEIYEFHHLIAE 125

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
              P RS FLS+FF LVG HG+HV  GLIW+ V+++ + KKGL   N+ RL+CLS+FWHF
Sbjct: 126 GYGPDRSGFLSAFFTLVGTHGIHVTSGLIWIIVMMVLVAKKGLTDRNRTRLMCLSLFWHF 185

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD++WICVF+ VYLMGV+
Sbjct: 186 LDVVWICVFTVVYLMGVM 203


>gi|333010887|gb|EGK30313.1| cytochrome o ubiquinol oxidase, subunit III [Shigella flexneri
           K-272]
 gi|333021385|gb|EGK40638.1| cytochrome o ubiquinol oxidase, subunit III [Shigella flexneri
           K-227]
          Length = 204

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 100/204 (49%), Positives = 132/204 (64%), Gaps = 2/204 (0%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTY-LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI 66
            +   +       +    D  GT   GFWIYLMSDC++F++ F TYAVL    A GP   
Sbjct: 2   ATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGK 61

Query: 67  DVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEF 126
           D+F++  + V T +LL SS++   A +A   K    + +SWL +T  FG  FI MEIYEF
Sbjct: 62  DIFELPFVLVETFLLLFSSITYGMAAIA-MYKNNKSQVISWLALTWLFGAGFIGMEIYEF 120

Query: 127 AHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
            HLI     P RS FLS+FFALVG HGLHV  GLIW+ VL++QI ++GL S N+ R++CL
Sbjct: 121 HHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCL 180

Query: 187 SMFWHFLDLIWICVFSFVYLMGVV 210
           S+FWHFLD++WICVF+ VYLMG +
Sbjct: 181 SLFWHFLDMVWICVFTVVYLMGAM 204


>gi|170767661|ref|ZP_02902114.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia albertii
           TW07627]
 gi|170123149|gb|EDS92080.1| cytochrome o ubiquinol oxidase, subunit III [Escherichia albertii
           TW07627]
          Length = 204

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 98/204 (48%), Positives = 132/204 (64%), Gaps = 2/204 (0%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTY-LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI 66
            +   +       +    D  GT   GFWIYLMSDC++F++ F TYAVL    A GP   
Sbjct: 2   ATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGK 61

Query: 67  DVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEF 126
           D+F++  + V T +LL SS++   A +A   K    + +SWL++T  FG  FI ME+YEF
Sbjct: 62  DIFELPFVLVETFLLLFSSITYGMAAIA-MYKNNKSQVISWLMLTWLFGAGFIGMELYEF 120

Query: 127 AHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
            HLI     P RS FLS+FFALVG HGLHV  GLIW+ VL++QI ++GL   N+ R++CL
Sbjct: 121 HHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTGTNRTRIMCL 180

Query: 187 SMFWHFLDLIWICVFSFVYLMGVV 210
           S+FWHFLD++WICVF+ VYLMG +
Sbjct: 181 SLFWHFLDVVWICVFTVVYLMGAM 204


>gi|461800|sp|Q03439|COX3_BACP3 RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome aa3 subunit 3; AltName: Full=Cytochrome
           c oxidase polypeptide III; AltName: Full=Oxidase aa(3)
           subunit 3
 gi|77450|pir||JX0142 cytochrome-c oxidase (EC 1.9.3.1) chain III - thermophilic
           bacterium PS-3
 gi|217151|dbj|BAA03047.1| cytochtome c oxidase subunit 3 [Bacillus sp. PS3]
          Length = 207

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 67/187 (35%), Positives = 108/187 (57%), Gaps = 1/187 (0%)

Query: 24  CVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLL 83
            ++    +LGFW++L  + ++FA  F TY  L      GP+  ++F +  +F++T++LL 
Sbjct: 21  TLEGKNKFLGFWLFLGGETVLFASLFATYLALKDKTNGGPSAEELFQMPVVFMATMLLLT 80

Query: 84  SSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLS 143
           SSL+  +A+          K   W  +T   G  F+ +EIYEF   +        SAF S
Sbjct: 81  SSLTSVYAIYHMKNFDFK-KMQLWFGITVLLGAGFLGLEIYEFNEYVHEGHKFTTSAFAS 139

Query: 144 SFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           +F+ LVG HG HV FGL+W+  L+I+  K+GL   N  +    S++WHF+D++W+ +F+ 
Sbjct: 140 AFYTLVGTHGSHVAFGLLWILTLMIRNAKRGLNLYNAPKFYVASLYWHFIDVVWVFIFTV 199

Query: 204 VYLMGVV 210
           VYLMG+V
Sbjct: 200 VYLMGMV 206


>gi|261346372|ref|ZP_05974016.1| cytochrome o ubiquinol oxidase, subunit III [Providencia
           rustigianii DSM 4541]
 gi|282565689|gb|EFB71224.1| cytochrome o ubiquinol oxidase, subunit III [Providencia
           rustigianii DSM 4541]
          Length = 204

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 87/197 (44%), Positives = 122/197 (61%), Gaps = 3/197 (1%)

Query: 14  LFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISG 73
           L + +              GFW+Y+MSD ++FA  F TY VL    A GP   D+F +  
Sbjct: 11  LAHAEHGHHDAGGTK--VFGFWLYIMSDLILFACLFATYVVLADGTAGGPEGKDIFSLKF 68

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           +   T +LL+SS++  FAM+A    ++ +    WL  T   G+ F+IME+YEF  LI+  
Sbjct: 69  VLGETFLLLVSSITYGFAMIAMHKGKIAY-VNVWLFATFLLGLGFVIMEVYEFHELIAEG 127

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
             P RS FLS FFALV  HGLHV  GL+W+ +++IQI ++GL   N+ RL CLS+FWHFL
Sbjct: 128 FGPDRSGFLSGFFALVATHGLHVSAGLVWIIIMMIQISRRGLTEVNKTRLNCLSLFWHFL 187

Query: 194 DLIWICVFSFVYLMGVV 210
           D++WICVF+ VYL+G +
Sbjct: 188 DVVWICVFTVVYLLGAI 204


>gi|15837989|ref|NP_298677.1| cytochrome O ubiquinol oxidase, subunit III [Xylella fastidiosa
           9a5c]
 gi|9106396|gb|AAF84197.1|AE003970_4 cytochrome O ubiquinol oxidase, subunit III [Xylella fastidiosa
           9a5c]
          Length = 202

 Score =  136 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 101/191 (52%), Positives = 127/191 (66%), Gaps = 1/191 (0%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTI 79
                   D T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + + T 
Sbjct: 13  DHAHHDTGDNTVFGFWVYLMSDCLIFAGLFATYAVLVGATVDGPTAKELFDLKFVLIETF 72

Query: 80  VLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS 139
           +LL SSL+  FAM+A+  +  I     WL+VTA FG+ F+ ME+YEF HLI   A P RS
Sbjct: 73  LLLFSSLTFGFAMIAAHKRH-IPALYGWLMVTALFGLGFLGMELYEFHHLIQEGAGPGRS 131

Query: 140 AFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWIC 199
           AFLS+FF LVG HGLHV  GL+W+ +LVIQI+K GL   N  RL CLS+FWHFLD+IWI 
Sbjct: 132 AFLSAFFTLVGTHGLHVASGLLWMLILVIQIVKNGLTPRNNTRLACLSLFWHFLDVIWIG 191

Query: 200 VFSFVYLMGVV 210
           VF+ VYL+G +
Sbjct: 192 VFTIVYLLGAL 202


>gi|268592044|ref|ZP_06126265.1| cytochrome o ubiquinol oxidase, subunit III [Providencia rettgeri
           DSM 1131]
 gi|291312437|gb|EFE52890.1| cytochrome o ubiquinol oxidase, subunit III [Providencia rettgeri
           DSM 1131]
          Length = 204

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 89/194 (45%), Positives = 120/194 (61%), Gaps = 1/194 (0%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
              +            GFW+Y+MSD ++FA  F TY VL    A GPA  D+F +  +  
Sbjct: 12  AHAEHGHHDAGGTKVFGFWLYIMSDLILFACLFATYVVLADGTAGGPAGKDIFSLKFVLG 71

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T +LL+SS++  FAM+A    + I     WL  T   G+ F+IMEIYEF  LI+    P
Sbjct: 72  ETFLLLVSSITYGFAMIAMHKGK-IAAVNLWLFATFLLGLGFVIMEIYEFHELIAEGFGP 130

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
            RS FLS FFALV  HGLHV  GLIW+ +++IQ+ ++GL   N+ RL CLS+FWHFLD++
Sbjct: 131 DRSGFLSGFFALVATHGLHVTAGLIWIIIMMIQVTRRGLTDVNKTRLNCLSLFWHFLDVV 190

Query: 197 WICVFSFVYLMGVV 210
           WICVF+ VYL+G +
Sbjct: 191 WICVFTVVYLLGAI 204


>gi|152968965|ref|YP_001334074.1| cytochrome o ubiquinol oxidase subunit III [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|206577207|ref|YP_002240091.1| cytochrome o ubiquinol oxidase, subunit III [Klebsiella pneumoniae
           342]
 gi|238893377|ref|YP_002918111.1| cytochrome o ubiquinol oxidase subunit III [Klebsiella pneumoniae
           NTUH-K2044]
 gi|288936841|ref|YP_003440900.1| cytochrome o ubiquinol oxidase subunit III [Klebsiella variicola
           At-22]
 gi|290510103|ref|ZP_06549473.1| cytochrome o ubiquinol oxidase, subunit III [Klebsiella sp. 1_1_55]
 gi|150953814|gb|ABR75844.1| cytochrome o ubiquinol oxidase subunit III [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|206566265|gb|ACI08041.1| cytochrome o ubiquinol oxidase, subunit III [Klebsiella pneumoniae
           342]
 gi|238545693|dbj|BAH62044.1| cytochrome o ubiquinol oxidase subunit III [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
 gi|288891550|gb|ADC59868.1| cytochrome o ubiquinol oxidase, subunit III [Klebsiella variicola
           At-22]
 gi|289776819|gb|EFD84817.1| cytochrome o ubiquinol oxidase, subunit III [Klebsiella sp. 1_1_55]
          Length = 203

 Score =  135 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 99/198 (50%), Positives = 126/198 (63%), Gaps = 2/198 (1%)

Query: 13  SLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
              +  +             GFWIYLMSDC++FA  F TYAVL    A GP   D+F++ 
Sbjct: 8   HTAHAHEHGHHDTGPM-KVFGFWIYLMSDCIIFATLFATYAVLVNGTAGGPTGKDIFELP 66

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + V T +LL SS++   A +A   K    + VSWL +T  FG  FI MEIYEF HLI  
Sbjct: 67  FVLVETALLLFSSITYGMAAIA-MYKNNKSQVVSWLALTWLFGAGFIGMEIYEFHHLIME 125

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
              P RS FLS+FFALVG HGLHV  GLIW+ VL+ Q+ ++GL S N+ R++CLS+FWHF
Sbjct: 126 GFGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMFQVSRRGLTSTNRTRILCLSLFWHF 185

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD++WICVFS VYLMG +
Sbjct: 186 LDVVWICVFSVVYLMGAM 203


>gi|148253543|ref|YP_001238128.1| cytochrome o ubiquinol oxidase subunit III [Bradyrhizobium sp.
           BTAi1]
 gi|146405716|gb|ABQ34222.1| cytochrome bo3 quinol oxidase subunit 3 [Bradyrhizobium sp. BTAi1]
          Length = 209

 Score =  135 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 117/210 (55%), Positives = 147/210 (70%), Gaps = 2/210 (0%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           M+           +FYV D+ E   +   T LGFWIYLMSDCL+FA+ F  Y VLG  YA
Sbjct: 1   MTVAMGSMKAGEPVFYVVDEHEHP-EGSSTMLGFWIYLMSDCLIFAILFAVYGVLGAKYA 59

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
           AGPAP D+FD+S + V+T  LLLSSL+  FAML+   +  +    +WL +T  FG+ F+ 
Sbjct: 60  AGPAPKDLFDLSLVAVNTSFLLLSSLTYGFAMLSMQ-QNRVGAMQAWLAITGLFGLAFLG 118

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           +E+ EFAH+I   A PQRSAFLSSFF LVG HGLHV FGLIWL  L++Q+   GLI  N+
Sbjct: 119 IELTEFAHMIHEGATPQRSAFLSSFFTLVGTHGLHVTFGLIWLVTLMVQVKTYGLIEANR 178

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RRL+CLSMFWHFLD+IWI VF+FVYLMG++
Sbjct: 179 RRLVCLSMFWHFLDVIWIGVFTFVYLMGML 208


>gi|110834896|ref|YP_693755.1| cytochrome o ubiquinol oxidase subunit III [Alcanivorax borkumensis
           SK2]
 gi|110648007|emb|CAL17483.1| cytochrome o ubiquinol oxidase, subunit III [Alcanivorax
           borkumensis SK2]
          Length = 222

 Score =  135 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 107/210 (50%), Positives = 142/210 (67%), Gaps = 4/210 (1%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           M+            F VK         +GT LGFWIYLMSDCL+FA  F TY VL ++YA
Sbjct: 16  MTANANSTHDGQLEFLVKGDHHP---QNGTLLGFWIYLMSDCLIFACLFATYGVLSRSYA 72

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
            GP  +++FD+S I V+T +LL+SS++  FAML     R+   T+ WL VT   G+ F+ 
Sbjct: 73  GGPTGMELFDLSLIAVNTSLLLVSSITYGFAMLQMQANRVK-GTMFWLAVTGLLGLGFLS 131

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           +E+YEF HLI + A PQ S F ++FFALVG HGLHVFFG++WL  L+ Q+ K GLI  N+
Sbjct: 132 LELYEFHHLIHVGAGPQTSGFWTAFFALVGTHGLHVFFGIVWLVTLLFQLKKHGLIQENK 191

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RR+ CLSMFWHFLD++W+ VF++VYLMGV+
Sbjct: 192 RRVFCLSMFWHFLDVVWVGVFTYVYLMGVL 221


>gi|212634273|ref|YP_002310798.1| cytochrome c oxidase subunit III [Shewanella piezotolerans WP3]
 gi|212555757|gb|ACJ28211.1| Cytochrome c oxidase, subunit III [Shewanella piezotolerans WP3]
          Length = 223

 Score =  135 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 97/193 (50%), Positives = 128/193 (66%), Gaps = 2/193 (1%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
               +        T  GFW+YLM+DC++FA  F TYAVL  N   G +  D+F+++ + +
Sbjct: 20  AAHGEHPDSSQ-NTLFGFWLYLMTDCILFASVFATYAVLYMNTDGGVSGKDIFELNFVLI 78

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T+ LLLSS++   A L  A +     TV WLL+T   G +FI MEIYEF HLI     P
Sbjct: 79  ETVALLLSSITFGMA-LIFAKRHNRRATVIWLLITLALGCVFIGMEIYEFHHLIEQGNGP 137

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
           QRSAFLSSFFALVG+HGLHV  GLIW+ +++I++LK GL   +  RL CLS+FWHFLD++
Sbjct: 138 QRSAFLSSFFALVGMHGLHVTAGLIWMVIMMIEVLKTGLNHRSITRLGCLSLFWHFLDIV 197

Query: 197 WICVFSFVYLMGV 209
           WICVF+ VYL+G 
Sbjct: 198 WICVFTVVYLLGA 210


>gi|295399679|ref|ZP_06809660.1| Cytochrome-c oxidase [Geobacillus thermoglucosidasius C56-YS93]
 gi|312111802|ref|YP_003990118.1| cytochrome-c oxidase [Geobacillus sp. Y4.1MC1]
 gi|294978082|gb|EFG53679.1| Cytochrome-c oxidase [Geobacillus thermoglucosidasius C56-YS93]
 gi|311216903|gb|ADP75507.1| Cytochrome-c oxidase [Geobacillus sp. Y4.1MC1]
          Length = 206

 Score =  135 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 69/192 (35%), Positives = 111/192 (57%), Gaps = 1/192 (0%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + + + ++    +LGFW +L  + ++FA  F T+  L    A GP   ++F +  +FVST
Sbjct: 15  EPERATLEGKNKFLGFWFFLGGETVLFASLFATFIALRDKTAGGPTSEELFQMPIVFVST 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           ++LL SSL+  +A+          K   W  +T   G+ F+ +EI+EF   +        
Sbjct: 75  MILLTSSLTSVYAIHHMKNFDFK-KMQLWFGITVLLGLAFLGLEIFEFYEYVHEGFKYST 133

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF S+F+ LVGLHG HV FGL W+  L+I+  K+GL   N  +    S++WHF+D++W+
Sbjct: 134 SAFSSAFYTLVGLHGSHVAFGLSWILTLMIRNAKRGLNLYNAPKFYVASLYWHFIDVVWV 193

Query: 199 CVFSFVYLMGVV 210
            +F+ VYLMG+V
Sbjct: 194 FIFTVVYLMGMV 205


>gi|190895345|ref|YP_001985637.1| cytochrome O ubiquinol oxidase protein, subunit III [Rhizobium etli
           CIAT 652]
 gi|190699290|gb|ACE93374.1| cytochrome O ubiquinol oxidase protein, subunit III [Rhizobium etli
           CIAT 652]
          Length = 206

 Score =  135 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 113/210 (53%), Positives = 143/210 (68%), Gaps = 5/210 (2%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           MS   +  +     FY+ +        + T LGFW+YLMSDCL+FAV F T+ VLG+NYA
Sbjct: 1   MSDHTVDTAEKPE-FYLTEDHHPE---NSTNLGFWLYLMSDCLIFAVLFATHGVLGRNYA 56

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
           AG  P D+FD+  + ++T +LL SS++  FAML         +T+ WL VT  FG  FI 
Sbjct: 57  AGRRPADLFDLPIVALNTSMLLFSSITYGFAMLQMERNA-KAETLFWLAVTGLFGAAFIG 115

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           +E+YEF HLI   A P RSAFLSSFF LVG HGLHV FG+IWL  L++Q+   GLI  N+
Sbjct: 116 LELYEFIHLIHEGAGPTRSAFLSSFFTLVGTHGLHVTFGIIWLITLMVQVSMHGLIEANR 175

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RRL+CLSMFWHFLD++WI VFSFVYL+GVV
Sbjct: 176 RRLMCLSMFWHFLDVVWIGVFSFVYLLGVV 205


>gi|254428757|ref|ZP_05042464.1| cytochrome o ubiquinol oxidase, subunit III [Alcanivorax sp. DG881]
 gi|196194926|gb|EDX89885.1| cytochrome o ubiquinol oxidase, subunit III [Alcanivorax sp. DG881]
          Length = 212

 Score =  135 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 107/210 (50%), Positives = 144/210 (68%), Gaps = 4/210 (1%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           M+            F VK         +GT LGFWIYLMSDCL+FA  F TY VLG++YA
Sbjct: 6   MTADVNSTQDGQLEFLVKGDHHP---QNGTLLGFWIYLMSDCLIFAALFATYGVLGRSYA 62

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
            GP  +++FD+S I ++T +LL+SS++  FAML     ++   T+ WL VT   G+ F+ 
Sbjct: 63  GGPTGMELFDLSLIAINTSLLLVSSITYGFAMLHMQANKVK-GTMFWLAVTGLLGLGFLS 121

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           +E+YEF HLIS+ A PQ S F ++FFALVG HGLHVFFG++WL  L+ Q+ K GLI  N+
Sbjct: 122 LELYEFHHLISVGAGPQTSGFWTAFFALVGTHGLHVFFGIVWLVTLLFQLKKHGLIPENK 181

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           RR+ CLSMFWHFLD++W+ VF++VYLMGV+
Sbjct: 182 RRVFCLSMFWHFLDVVWVGVFTYVYLMGVL 211


>gi|224020977|ref|YP_002608210.1| cytochrome c oxidase subunit 3 [Carica papaya]
 gi|170522389|gb|ACB20499.1| cytochrome c oxidase subunit 3 [Carica papaya]
          Length = 265

 Score =  135 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 44/199 (22%), Positives = 80/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA------AGPAPIDVFDIS 72
           +   + V   G   GF  +++S+ + F   F   +      A        P  I V D  
Sbjct: 71  EGHHTKVVQLGLRYGFIPFIVSEVMFFFALFWASSHSSLAPAVEIGGIWPPKGIGVLDPW 130

Query: 73  -GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++F   +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVLLALVFTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                  S + S+FF   G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APFTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++W+  F  +Y  G +
Sbjct: 247 FVDVVWLFPFVSIYWWGGI 265


>gi|25057836|ref|NP_740068.1| cytochrome c oxidase subunit III [Caranx melampygus]
 gi|25006075|dbj|BAC23689.1| cytochrome c oxidase subunit III [Caranx melampygus]
          Length = 261

 Score =  135 bits (341), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 42/199 (21%), Positives = 81/199 (40%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK---------NYAAGPAPIDVF 69
               +     G   G  +++ S+ L F  FF  +                  G   +D F
Sbjct: 68  QGHHTPPVQKGLRYGMILFITSEVLFFLGFFWAFYHSSLAPTPELGGCWPPTGITALDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  +    +   + +  L +T   G  F  ++  E+   
Sbjct: 128 EVP--LLNTAVLLASGVTVTWAHHSIMEGK-RKQAIQSLALTILLGGYFTCLQAMEY--- 181

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + S+FF   G HGLHV  G  +L V  ++ L+    S +       + +
Sbjct: 182 YEAPFTIADGVYGSTFFVATGFHGLHVIIGSTFLAVCFLRQLRHHFTSDHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYVSIYWWG 260


>gi|170748151|ref|YP_001754411.1| cytochrome o ubiquinol oxidase, subunit III [Methylobacterium
           radiotolerans JCM 2831]
 gi|170654673|gb|ACB23728.1| cytochrome o ubiquinol oxidase, subunit III [Methylobacterium
           radiotolerans JCM 2831]
          Length = 210

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 110/204 (53%), Positives = 140/204 (68%), Gaps = 5/204 (2%)

Query: 7   GKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI 66
             +P F     ++   S      T LGFW+YLMSDCL+FA  F TY VLG++YAAGP P 
Sbjct: 11  AAAPVFYQ-IDEEGHHSEG---STMLGFWLYLMSDCLIFATLFATYGVLGRSYAAGPTPK 66

Query: 67  DVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEF 126
           ++FD+ GI V+T +LL SS++  FAML    +  + +T  WL VT  FG  F+ +EI EF
Sbjct: 67  ELFDLPGIAVNTAMLLFSSITYGFAMLE-MDRDRVKQTQIWLAVTGLFGAAFVALEIREF 125

Query: 127 AHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
            HL    A P RSAFLSSF+ LV  HGLHV  G++WL VL++Q+ K+GLI  N+RRL+CL
Sbjct: 126 VHLFHEGAPPWRSAFLSSFYTLVSTHGLHVSMGILWLVVLMVQVGKRGLIVENKRRLMCL 185

Query: 187 SMFWHFLDLIWICVFSFVYLMGVV 210
           SMFWHFLDLIWI VF+ VYLMGV+
Sbjct: 186 SMFWHFLDLIWIGVFTVVYLMGVL 209


>gi|77020017|ref|YP_337804.1| cytochrome c oxidase subunit III [Lates calcarifer]
 gi|62902008|gb|AAY18955.1| cytochrome c oxidase subunit III [Lates calcarifer]
          Length = 261

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 42/199 (21%), Positives = 82/199 (41%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPIDVF 69
               +     G   G  +++ S+ L F  FF  +                 AG  P+D F
Sbjct: 68  QGHHTPPVQKGLRYGMILFITSEVLFFLGFFWAFNHSSLAPTPELGGNWPPAGITPLDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  A    +   + +  L +T   G  F  ++  E+   
Sbjct: 128 EVP--LLNTAVLLASGVTVTWAHHAIMEGK-RKQAIHALALTILLGSYFTFLQAMEYN-- 182

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      +  +FF   G HGLHV  G  +L + + + ++    S +       + +
Sbjct: 183 -EAPFTIADGVYGCTFFVATGFHGLHVLIGSTFLAICLARQIQHHFTSEHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYISIYWWG 260


>gi|51893236|ref|YP_075927.1| cytochrome C oxidase subunit III [Symbiobacterium thermophilum IAM
           14863]
 gi|51856925|dbj|BAD41083.1| cytochrome C oxidase subunit III [Symbiobacterium thermophilum IAM
           14863]
          Length = 210

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 67/194 (34%), Positives = 99/194 (51%), Gaps = 3/194 (1%)

Query: 16  YVKDKK--ESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISG 73
           +  D    ++    D   LGFW+++ S+ + FA   V Y V    Y  G  P D+F+I  
Sbjct: 14  WAHDAHAHQTNTGIDNRKLGFWLFIASESIFFACLLVGYLVFRGGYQPGVGPRDLFNIEL 73

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
             VST VLL+SSL+   A+ A+           W+LVTA  G+ F+  + YEF H     
Sbjct: 74  TTVSTFVLLMSSLAMVLAVNAAQRNEGR-AARRWVLVTALMGLTFLGFQAYEFTHFYHAG 132

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
                S F ++F+ L G HG HV  G+IWL  L+     KGL       +    ++WHF+
Sbjct: 133 LSLSSSVFGTAFYTLTGFHGAHVAVGVIWLLTLLYHGRGKGLTVDKADDVEVAGLYWHFV 192

Query: 194 DLIWICVFSFVYLM 207
           D++WI +F+ VYL+
Sbjct: 193 DIVWIVLFTVVYLL 206


>gi|138894619|ref|YP_001125072.1| cytochrome caa3-type oxidase III [Geobacillus thermodenitrificans
           NG80-2]
 gi|196247772|ref|ZP_03146474.1| cytochrome c oxidase subunit III [Geobacillus sp. G11MC16]
 gi|1841879|dbj|BAA11113.1| cytochrome c oxidase subunit III [Geobacillus stearothermophilus]
 gi|134266132|gb|ABO66327.1| Cytochrome caa3-type oxidase III [Geobacillus thermodenitrificans
           NG80-2]
 gi|196212556|gb|EDY07313.1| cytochrome c oxidase subunit III [Geobacillus sp. G11MC16]
          Length = 206

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 67/187 (35%), Positives = 108/187 (57%), Gaps = 1/187 (0%)

Query: 24  CVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLL 83
            ++    +LGFW++L  + ++FA  F TY  L      GP+  ++F +  +F++T++LL 
Sbjct: 20  TLEGKNKFLGFWLFLGGETVLFASLFATYLALKDKTNGGPSGEELFQMPIVFMATMLLLT 79

Query: 84  SSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLS 143
           SSL+  +A+          K   W  +T   G  F+ +EIYEF   +        SAF S
Sbjct: 80  SSLTSVYAIYHMKNFDF-QKMQLWFGITVLLGAGFLALEIYEFYEYVHEGHKFTSSAFGS 138

Query: 144 SFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           +F+ LVG HG HV FGL+W+  L+I+  K+GL   N  +    S++WHF+D++W+ +F+ 
Sbjct: 139 AFYTLVGTHGAHVAFGLLWILTLMIRNAKRGLNLYNAPKFYVASLYWHFIDVVWVFIFTV 198

Query: 204 VYLMGVV 210
           VYLMG+V
Sbjct: 199 VYLMGMV 205


>gi|56419619|ref|YP_146937.1| cytochrome c oxidase subunit III [Geobacillus kaustophilus HTA426]
 gi|261419281|ref|YP_003252963.1| cytochrome-c oxidase [Geobacillus sp. Y412MC61]
 gi|297530749|ref|YP_003672024.1| cytochrome-c oxidase [Geobacillus sp. C56-T3]
 gi|319766097|ref|YP_004131598.1| cytochrome-c oxidase [Geobacillus sp. Y412MC52]
 gi|56379461|dbj|BAD75369.1| cytochrome c oxidase subunit III [Geobacillus kaustophilus HTA426]
 gi|261375738|gb|ACX78481.1| Cytochrome-c oxidase [Geobacillus sp. Y412MC61]
 gi|297254001|gb|ADI27447.1| Cytochrome-c oxidase [Geobacillus sp. C56-T3]
 gi|317110963|gb|ADU93455.1| Cytochrome-c oxidase [Geobacillus sp. Y412MC52]
          Length = 206

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 67/187 (35%), Positives = 108/187 (57%), Gaps = 1/187 (0%)

Query: 24  CVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLL 83
            ++    +LGFW++L  + ++FA  F TY  L      GP+  ++F +  +F++T++LL 
Sbjct: 20  TLEGKNKFLGFWLFLGGETVLFASLFATYLALKDKTNGGPSAEELFQMPVVFMATMLLLT 79

Query: 84  SSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLS 143
           SSL+  +A+          K   W  +T   G  F+ +EIYEF   +        SAF S
Sbjct: 80  SSLTSVYAIYHMKNFDFK-KMQLWFGITVLLGAGFLGLEIYEFNEYVHEGHKFTTSAFAS 138

Query: 144 SFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           +F+ LVG HG HV FGL+W+  L+I+  K+GL   N  +    S++WHF+D++W+ +F+ 
Sbjct: 139 AFYTLVGTHGSHVAFGLLWILTLMIRNAKRGLNLYNAPKFYVASLYWHFIDVVWVFIFTV 198

Query: 204 VYLMGVV 210
           VYLMG+V
Sbjct: 199 VYLMGMV 205


>gi|294498140|ref|YP_003561840.1| cytochrome c oxidase subunit III [Bacillus megaterium QM B1551]
 gi|295703491|ref|YP_003596566.1| cytochrome c oxidase subunit III [Bacillus megaterium DSM 319]
 gi|294348077|gb|ADE68406.1| cytochrome c oxidase, subunit III [Bacillus megaterium QM B1551]
 gi|294801150|gb|ADF38216.1| cytochrome c oxidase, subunit III [Bacillus megaterium DSM 319]
          Length = 206

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 75/187 (40%), Positives = 113/187 (60%), Gaps = 1/187 (0%)

Query: 24  CVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLL 83
            ++    + GFW++L  + ++FA  F TY  L  +  +GP P ++FDI  +F +T++LL 
Sbjct: 20  TLEGKNKFTGFWLFLGGETVLFASLFATYLALRNSTMSGPKPEELFDIKLVFAATMILLT 79

Query: 84  SSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLS 143
           SSL+  +AM          K   WL VT   G+ F+ +EIYEF H +        SAF S
Sbjct: 80  SSLTSVYAMYHMKNFEFK-KMQLWLGVTWLLGLAFLGLEIYEFRHYVHEGHTFTSSAFGS 138

Query: 144 SFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           SF+ALVG HG HV FGL+W+  L+I+  K+GL   N  +    S++WHF+D++W+ +F+ 
Sbjct: 139 SFYALVGTHGAHVTFGLLWIGSLMIRNAKRGLNLYNAPKYYVASLYWHFIDVVWVFIFTV 198

Query: 204 VYLMGVV 210
           VYLMG+V
Sbjct: 199 VYLMGMV 205


>gi|251790655|ref|YP_003005376.1| cytochrome o ubiquinol oxidase subunit III [Dickeya zeae Ech1591]
 gi|247539276|gb|ACT07897.1| cytochrome o ubiquinol oxidase, subunit III [Dickeya zeae Ech1591]
          Length = 204

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 99/194 (51%), Positives = 129/194 (66%), Gaps = 1/194 (0%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
              +            GFWIYLMSDC++F + F TYAVL    A GP   ++FD+  + V
Sbjct: 12  AHAEHGHHDTGATKVFGFWIYLMSDCILFGMLFATYAVLVNGTAGGPTGKELFDLKFVLV 71

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T  LL SS++   AM+A   K    +  +WL +T  FG++FI MEIYEF HLI+  A P
Sbjct: 72  ETFALLFSSITYGMAMIA-MNKGNKSQVNAWLGLTFLFGLVFIGMEIYEFHHLIAEGAGP 130

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
            RSAFLS+FFALVG HG+HV  GLIW+ V++IQ+ K GL S N+ RL+CLS+FWHFLD++
Sbjct: 131 DRSAFLSAFFALVGTHGIHVTSGLIWIAVMMIQVSKFGLTSTNKTRLMCLSLFWHFLDVV 190

Query: 197 WICVFSFVYLMGVV 210
           WICVF+ VYLMG +
Sbjct: 191 WICVFTVVYLMGAM 204


>gi|183601052|ref|ZP_02962545.1| hypothetical protein PROSTU_04674 [Providencia stuartii ATCC 25827]
 gi|188019391|gb|EDU57431.1| hypothetical protein PROSTU_04674 [Providencia stuartii ATCC 25827]
          Length = 204

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 89/197 (45%), Positives = 121/197 (61%), Gaps = 3/197 (1%)

Query: 14  LFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISG 73
           L + +              GFW+Y+MSD ++FA  F TY VL    A GP   D+F +S 
Sbjct: 11  LAHAEHGHHDAGGTK--VFGFWLYIMSDLILFACLFATYVVLADGTAGGPEGKDIFSLSF 68

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           +   T +LL SS++  FAMLA    + I     WL VT   G+ F+IME+YEF  LI+  
Sbjct: 69  VLGETFLLLFSSITYGFAMLAMHKGK-IASVNLWLFVTFLLGLGFVIMEVYEFHELIAEG 127

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
             P RS FLS FF LV  HG+HV  GL+W+ +++IQ+ ++GL   NQ RL CLS+FWHFL
Sbjct: 128 YGPDRSGFLSGFFTLVATHGIHVTCGLVWIIIMIIQVSRRGLTEVNQTRLNCLSLFWHFL 187

Query: 194 DLIWICVFSFVYLMGVV 210
           D++WICVF+ VYL+G +
Sbjct: 188 DVVWICVFTVVYLLGAI 204


>gi|327192584|gb|EGE59532.1| cytochrome c oxidase protein, subunit III [Rhizobium etli CNPAF512]
          Length = 292

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 43/206 (20%), Positives = 83/206 (40%), Gaps = 17/206 (8%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA--------------VLGKNYAAG 62
             +   + V       G  +++ S+ + F  +F  Y               +        
Sbjct: 81  AHEGAHTRVVSLHLRYGMIMFIASEVMFFVAWFWAYFDASLFPNEAIQASRMAYTGGVWP 140

Query: 63  PAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIME 122
           P  I+V D   + +   V+LL S +       +         +  L +T   G++F  ++
Sbjct: 141 PKGIEVLDPWHLPIYNTVILLLSGTTVTWAHHALLHNDRKGLIQGLTLTVLLGILFSSVQ 200

Query: 123 IYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRR 182
            YE+AH        + S + ++FF   G HG HV  G I+L V +++ L+          
Sbjct: 201 AYEYAH---APFDFKNSIYGATFFMATGFHGFHVLVGTIFLLVCLLRALRGDFTPKQHFG 257

Query: 183 LICLSMFWHFLDLIWICVFSFVYLMG 208
               + +WHF+D++W+ +F  +Y+ G
Sbjct: 258 FEAAAWYWHFVDVVWLFLFFCIYVWG 283


>gi|14602392|ref|NP_148770.1| cytochrome c oxidase subunit III [Trachurus japonicus]
 gi|14588626|dbj|BAB61817.1| cytochrome c oxidase subunit III [Trachurus japonicus]
 gi|14588640|dbj|BAB61830.1| cytochrome c oxidase subunit III [Trachurus japonicus]
          Length = 261

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 42/199 (21%), Positives = 82/199 (41%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK---------NYAAGPAPIDVF 69
               +     G   G  +++ S+ L F  FF  +                 AG   +D F
Sbjct: 68  QGHHTPPVQKGLRYGMILFITSEVLFFLGFFWAFYHSSLAPTPELGGCWPPAGITALDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  +    +   + +  L +T   G  F  ++  E+   
Sbjct: 128 EVP--LLNTAVLLASGVTVTWAHHSIMEGK-RKQAIQSLGLTILLGGYFTCLQAMEY--- 181

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + S+FF   G HGLHV  G  +L V  ++ ++    S +       + +
Sbjct: 182 YEAPFTIADGVYGSTFFVATGFHGLHVIIGSTFLAVCFLRQVRHHFTSDHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYVSIYWWG 260


>gi|317097350|ref|YP_004123550.1| cytochrome c oxidase subunit III [Cynoglossus abbreviatus]
 gi|254763719|gb|ACT80249.1| cytochrome c oxidase subunit III [Cynoglossus abbreviatus]
          Length = 261

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 84/199 (42%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK---------NYAAGPAPIDVF 69
               +     G   G  ++++S+ L FA FF  +                 AG  P++ F
Sbjct: 68  QGHHTGPVQKGLRYGMILFIISEILFFAGFFWAFYHSSLAPTPELGGIWPPAGITPLNPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  +          +  L +T   G+ F +++  E+   
Sbjct: 128 EVP--LLNTAVLLASGVTVTWAHHSIMAGYRKPA-IHALFLTISLGLYFTLLQALEY--- 181

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + S+FF   G HGLHV  G  +L + +++ +       +       + +
Sbjct: 182 YEAPFTIADGVYGSTFFVATGFHGLHVIIGSTFLLICLLRQINYHFTPTHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYVSIYWWG 260


>gi|209548213|ref|YP_002280130.1| cytochrome-c oxidase [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209533969|gb|ACI53904.1| Cytochrome-c oxidase [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 292

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 45/206 (21%), Positives = 83/206 (40%), Gaps = 17/206 (8%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA--------------VLGKNYAAG 62
             +   + V       G  +++ S+ + F  +F  Y               +L       
Sbjct: 81  AHEGAHTRVVSLHLRYGMIMFIASEVMFFVAWFWAYFDASLYPNEAIQASRLLYTGGTWP 140

Query: 63  PAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIME 122
           P  I+V D   + +   V+LL S +       +         +  L +T   G+ F  ++
Sbjct: 141 PKGIEVLDPWHLPIYNTVILLLSGTTVTWAHHALLHNDRKGLIQGLTLTVLLGIFFSSVQ 200

Query: 123 IYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRR 182
            YE+AH        + S + ++FF   G HG HV  G I+L V +I+ L+          
Sbjct: 201 AYEYAH---APFAFKNSIYGATFFMATGFHGFHVLIGTIFLLVCLIRSLRGDFTPKQHFG 257

Query: 183 LICLSMFWHFLDLIWICVFSFVYLMG 208
               + +WHF+D++W+ +F  +Y+ G
Sbjct: 258 FEAAAWYWHFVDVVWLFLFFCIYVWG 283


>gi|58372104|ref|YP_194930.1| cytochrome c oxidase subunit III [Trachurus trachurus]
 gi|38603501|dbj|BAD02884.1| cytochrome c oxidase subunit III [Trachurus trachurus]
          Length = 261

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 42/199 (21%), Positives = 82/199 (41%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK---------NYAAGPAPIDVF 69
               +     G   G  +++ S+ L F  FF  +                 AG   +D F
Sbjct: 68  QGHHTPPVQKGLRYGMILFITSEVLFFLGFFWAFYHSSLAPTPELGGCWPPAGITALDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  +    +   + +  L +T   G  F  ++  E+   
Sbjct: 128 EVP--LLNTAVLLASGVTVTWAHHSIMEGK-RKQAIQSLALTILLGGYFTCLQAMEY--- 181

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + S+FF   G HGLHV  G  +L V  ++ ++    S +       + +
Sbjct: 182 YEAPFTIADGVYGSTFFVATGFHGLHVIIGSTFLAVCFLRQVRHHFTSDHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYVSIYWWG 260


>gi|240266445|ref|YP_002970797.1| cytochrome c oxidase subunit III [Cynoglossus semilaevis]
 gi|164519771|gb|ABY59940.1| cytochrome c oxidase subunit 3 [Cynoglossus semilaevis]
 gi|254763705|gb|ACT80236.1| cytochrome c oxidase subunit III [Cynoglossus semilaevis]
          Length = 261

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 43/199 (21%), Positives = 84/199 (42%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK---------NYAAGPAPIDVF 69
               +     G   G  ++++S+ L FA FF  +                 AG  P++ F
Sbjct: 68  QGHHTGPVQKGLRYGMILFIISEVLFFAGFFWAFYHSSLAPTPELGGIWPPAGITPLNPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  +    R     +  L +T   G  F +++  E+   
Sbjct: 128 EVP--LLNTAVLLASGVTVTWAHHSIMAGRRKPA-IHALFLTISLGFYFTLLQALEY--- 181

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + S+FF   G HGLHV  G  +L V +++ +       +       + +
Sbjct: 182 YEAPFTIADGVYGSTFFVATGFHGLHVIIGSTFLLVCLLRQINYHFTPTHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYVSIYWWG 260


>gi|71082838|ref|YP_265557.1| cytochrome-c oxidase [Candidatus Pelagibacter ubique HTCC1062]
 gi|71061951|gb|AAZ20954.1| cytochrome-c oxidase [Candidatus Pelagibacter ubique HTCC1062]
          Length = 262

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 42/197 (21%), Positives = 81/197 (41%), Gaps = 9/197 (4%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA------VLGKNYAAGPAPIDVFDI 71
                + V       G  +++ S+ + F  +F  Y        L       P  I  FD 
Sbjct: 68  HQGHHTPVVQIHHRYGMTLFIASEVMFFVAWFWAYFDASLFPSLAIGGIWPPKDIVTFDP 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
             I +   ++LL S +       +  +      +  L++T   G  F ++++YE+ H   
Sbjct: 128 WDIPLINTLILLLSGTTVTWSHHALLEGDRKSFIQGLVLTVILGFSFSLLQVYEYQH--- 184

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                  + + S F+   G HG HV  G I+L V +++  K      +       + +WH
Sbjct: 185 ATFDFAGNIYGSVFYMATGFHGFHVIIGTIFLAVCLMRARKGHFTEKHHFGFEAAAWYWH 244

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ +F+ +Y+ G
Sbjct: 245 FVDVVWLFLFAAIYIWG 261


>gi|38707485|ref|NP_944639.1| cytochrome c oxidase subunit III [Eschrichtius robustus]
 gi|38602452|emb|CAD87916.1| cytochrome c oxidase polypeptide III [Eschrichtius robustus]
          Length = 261

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 80/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA------AGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPPPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MLQALFITIALGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +K    S +       + +WH
Sbjct: 184 APFTISDGIYGSTFFVATGFHGLHVIIGTTFLIVCFLRQMKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|114052891|ref|YP_740286.1| cytochrome c oxidase subunit III [Lacerta viridis viridis]
 gi|113926823|emb|CAJ45052.1| cytochrome oxidase subunit III [Lacerta viridis viridis]
          Length = 261

 Score =  135 bits (340), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 42/199 (21%), Positives = 82/199 (41%), Gaps = 11/199 (5%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
               + +     G   G  +++ S+ L F  FF  +                P  ++  +
Sbjct: 66  TYQGQHTTPVQKGLRYGMILFITSEVLFFVGFFWAFYHSSLAPTPELGNQWPPTGVEPLN 125

Query: 71  -ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
                 ++T VLL S ++ ++A  A    +     +  L +T   G+ F I++  E+   
Sbjct: 126 AFEVPLLNTAVLLASGVTVTWAHHALMEGKRKD-MIQALTLTILLGLYFTILQATEYH-- 182

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                    S + ++FF   G HGLHV  G  +L V +I+ L     + +       + +
Sbjct: 183 -EAPFTISDSVYGATFFVATGFHGLHVIIGSTFLLVCLIRQLLHHFTTKHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYVSIYWWG 260


>gi|91762739|ref|ZP_01264704.1| cytochrome-c oxidase [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718541|gb|EAS85191.1| cytochrome-c oxidase [Candidatus Pelagibacter ubique HTCC1002]
          Length = 262

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 42/197 (21%), Positives = 81/197 (41%), Gaps = 9/197 (4%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA------VLGKNYAAGPAPIDVFDI 71
                + V       G  +++ S+ + F  +F  Y        L       P  I  FD 
Sbjct: 68  HQGHHTPVVQIHHRYGMTLFIASEVMFFVAWFWAYFDASLFPSLAIGGIWPPKDIVTFDP 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
             I +   ++LL S +       +  +      +  L++T   G  F ++++YE+ H   
Sbjct: 128 WDIPLINTLILLLSGTTVTWSHHALLEGDRKSFIQGLVLTVILGFSFSLLQVYEYQH--- 184

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                  + + S F+   G HG HV  G I+L V +++  K      +       + +WH
Sbjct: 185 ATFDFAGNIYGSVFYMATGFHGFHVIIGTIFLAVCLMRARKGHFTEEHHFGFEAAAWYWH 244

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ +F+ +Y+ G
Sbjct: 245 FVDVVWLFLFAAIYIWG 261


>gi|322834053|ref|YP_004214080.1| cytochrome o ubiquinol oxidase, subunit III [Rahnella sp. Y9602]
 gi|321169254|gb|ADW74953.1| cytochrome o ubiquinol oxidase, subunit III [Rahnella sp. Y9602]
          Length = 204

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 95/194 (48%), Positives = 123/194 (63%), Gaps = 1/194 (0%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
              +            GFWIYLMSDC++FA  F TYAVL    A GP+  D+F++  + V
Sbjct: 12  AHAEHGHHDAGATKVFGFWIYLMSDCILFASLFATYAVLVNGTAGGPSGKDIFELPFVLV 71

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T  LL SS++  FAML    K        WL +T  FG+ FI ME+YEF HLI+    P
Sbjct: 72  ETFCLLFSSITYGFAML-GMNKGNKAAVNGWLFLTFLFGLGFIGMELYEFHHLIAEGYGP 130

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
           QRS FLS FFALV  HGLHV  GLIW+  +++Q+ ++GL   N+ RL+CLS+FWHFLD++
Sbjct: 131 QRSGFLSGFFALVATHGLHVTCGLIWILTMMVQVSRRGLTEVNKTRLMCLSLFWHFLDVV 190

Query: 197 WICVFSFVYLMGVV 210
           WICVF+ VYLMG +
Sbjct: 191 WICVFTVVYLMGAM 204


>gi|190890673|ref|YP_001977215.1| cytochrome c oxidase, subunit III [Rhizobium etli CIAT 652]
 gi|190695952|gb|ACE90037.1| cytochrome c oxidase protein, subunit III [Rhizobium etli CIAT 652]
          Length = 292

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 43/206 (20%), Positives = 83/206 (40%), Gaps = 17/206 (8%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA--------------VLGKNYAAG 62
             +   + V       G  +++ S+ + F  +F  Y               +        
Sbjct: 81  AHEGAHTRVVSLHLRYGMIMFIASEVMFFVAWFWAYFDASLFPNEAIQASRLAYTGGVWP 140

Query: 63  PAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIME 122
           P  I+V D   + +   V+LL S +       +         +  L +T   G++F  ++
Sbjct: 141 PKGIEVLDPWHLPIYNTVILLLSGTTVTWAHHALLHNDRKGLIQGLTLTVLLGILFSSVQ 200

Query: 123 IYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRR 182
            YE+AH        + S + ++FF   G HG HV  G I+L V +++ L+          
Sbjct: 201 AYEYAH---APFDFKNSIYGATFFMATGFHGFHVLVGTIFLAVCLLRALRGDFTPKQHFG 257

Query: 183 LICLSMFWHFLDLIWICVFSFVYLMG 208
               + +WHF+D++W+ +F  +Y+ G
Sbjct: 258 FEAAAWYWHFVDVVWLFLFFCIYVWG 283


>gi|25057822|ref|NP_740055.1| cytochrome c oxidase subunit III [Carangoides armatus]
 gi|25006061|dbj|BAC23676.1| cytochrome c oxidase subunit III [Carangoides armatus]
          Length = 261

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 81/199 (40%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK---------NYAAGPAPIDVF 69
               +     G   G  +++ S+ L F  FF  +                  G   +D F
Sbjct: 68  QGHHTPPVQKGLRYGMILFITSEVLFFLGFFWAFYHSSLAPTPELGGCWPPTGITALDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  +    +   + +  L +T   G  F  ++  E+   
Sbjct: 128 EVP--LLNTAVLLASGVTVTWAHHSIMEGK-RKQAIQSLALTILLGGYFTCLQAMEY--- 181

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + S+FF   G HGLHV  G  +L V  ++ ++    S +       + +
Sbjct: 182 YEAPFTIADGVYGSTFFVATGFHGLHVIIGSTFLAVCFLRQVRHHFTSDHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYVSIYWWG 260


>gi|297593526|gb|ADI47480.1| cytochrome oxidase subunit III [Xiphias gladius]
          Length = 261

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 40/199 (20%), Positives = 82/199 (41%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPIDVF 69
               +     G   G  +++ S+ L F  FF  +                  G   +D F
Sbjct: 68  QGHHTPPVQKGLRYGMILFITSEVLFFLGFFWAFYHSSLAPTPELGGHWPPTGITALDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  +    +   + +  L +T   G  F  ++  E+   
Sbjct: 128 EVP--LLNTAVLLASGVTVTWAHHSIMEAK-RKQAIQSLALTILLGAYFTFLQAMEYN-- 182

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + ++FF   G HGLHV  G  +L V +++ ++    S +       + +
Sbjct: 183 -EAPFTIADGVYGATFFVATGFHGLHVLIGSTFLAVCLLRQVRHHFTSNHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYISIYWWG 260


>gi|86356602|ref|YP_468494.1| cytochrome-c oxidase, subunit III protein [Rhizobium etli CFN 42]
 gi|86280704|gb|ABC89767.1| cytochrome-c oxidase, subunit III protein [Rhizobium etli CFN 42]
          Length = 292

 Score =  135 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 44/206 (21%), Positives = 83/206 (40%), Gaps = 17/206 (8%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA--------------VLGKNYAAG 62
             +   + V       G  +++ S+ + F  +F  Y               +        
Sbjct: 81  AHEGSHTRVVSLHLRYGMIMFIASEVMFFVAWFWAYFDASLFPNEAIQASRMAYTGGVWP 140

Query: 63  PAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIME 122
           P  I+V D   + +   V+LL S +       +         V  L +T   G++F  ++
Sbjct: 141 PKGIEVLDPWHLPIYNTVILLLSGTTVTWAHHALLHNDRKGLVQGLTLTVLLGILFSSVQ 200

Query: 123 IYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRR 182
            YE+AH        + S + ++FF   G HG HV  G I+L V +++ L+          
Sbjct: 201 AYEYAH---APFDFKNSIYGATFFMATGFHGFHVLVGTIFLLVCLLRALRGDFTPKQHFG 257

Query: 183 LICLSMFWHFLDLIWICVFSFVYLMG 208
               + +WHF+D++W+ +F  +Y+ G
Sbjct: 258 FEAAAWYWHFVDVVWLFLFFCIYVWG 283


>gi|229490418|ref|ZP_04384259.1| cytochrome c oxidase subunit 3 [Rhodococcus erythropolis SK121]
 gi|229322708|gb|EEN88488.1| cytochrome c oxidase subunit 3 [Rhodococcus erythropolis SK121]
          Length = 298

 Score =  135 bits (339), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 47/177 (26%), Positives = 78/177 (44%), Gaps = 2/177 (1%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAA-GPAPIDVFDISGIFVSTIVLLLSSLSCSF 90
           +G  ++L S+ + FA  F  Y V         P      ++      T+VL+ SS +C  
Sbjct: 122 VGTIVWLSSELMFFAGLFAMYFVARAQANGNWPPEPTELNLYLAVPVTLVLIASSFTCQM 181

Query: 91  AMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVG 150
            + A+     +     W  +T   G  F+  + YE+ HL+        S + S F+   G
Sbjct: 182 GVFAAERGD-VFGLRRWYTITLVMGAFFVAGQGYEYYHLVHEGTTISSSVYGSVFYMTTG 240

Query: 151 LHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
            HGLHV  GLI    L+ +              I +S +WHF+D++WI +F+ +Y +
Sbjct: 241 FHGLHVIGGLIAFVFLIARTRVSKFTPAQATAAIVVSYYWHFVDIVWIALFATIYFI 297


>gi|241203394|ref|YP_002974490.1| cytochrome-c oxidase [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240857284|gb|ACS54951.1| Cytochrome-c oxidase [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 292

 Score =  135 bits (339), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 45/206 (21%), Positives = 83/206 (40%), Gaps = 17/206 (8%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA--------------VLGKNYAAG 62
             +   + V       G  +++ S+ + F  +F  Y               +L       
Sbjct: 81  AHEGAHTRVVSLHLRYGMIMFIASEVMFFVAWFWAYFDASLYPNEAIQASRLLYTGGTWP 140

Query: 63  PAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIME 122
           P  I+V D   + +   V+LL S +       +         +  L +T   G+ F  ++
Sbjct: 141 PKGIEVLDPWHLPIYNTVILLLSGTTVTWAHHALLHNDRKGLIQGLTLTVLLGIFFSSVQ 200

Query: 123 IYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRR 182
            YE+AH        + S + ++FF   G HG HV  G I+L V +I+ L+          
Sbjct: 201 AYEYAH---APFAFKNSIYGATFFMATGFHGFHVLVGTIFLAVCLIRALRGDFTPKQHFG 257

Query: 183 LICLSMFWHFLDLIWICVFSFVYLMG 208
               + +WHF+D++W+ +F  +Y+ G
Sbjct: 258 FEAAAWYWHFVDVVWLFLFFCIYVWG 283


>gi|238866869|ref|YP_002929341.1| cytochrome c oxidase subunit III [Perodicticus potto]
 gi|238809404|dbj|BAH69227.1| cytochrome c oxidase subunit III [Perodicticus potto]
          Length = 261

 Score =  135 bits (339), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 83/197 (42%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L FA FF ++                P  I+  +  
Sbjct: 68  QGHHTPTVQKGLRYGMVLFIISEVLFFAGFFWSFYHSSLAPTPELGGCWPPTGINPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H T   L +T   G+ F +++  E+   + 
Sbjct: 128 EVPLLNTAVLLASGVSITWAHHSLMENNRKHMT-QALSITIALGLYFTLLQASEY---LE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V +++ L       +       + +WH
Sbjct: 184 TSFTISDGVYGSTFFMATGFHGLHVIIGSTFLTVCLLRQLNFHFTPNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|170724798|ref|YP_001758824.1| cytochrome o ubiquinol oxidase subunit III [Shewanella woodyi ATCC
           51908]
 gi|169810145|gb|ACA84729.1| cytochrome o ubiquinol oxidase, subunit III [Shewanella woodyi ATCC
           51908]
          Length = 215

 Score =  135 bits (339), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 93/195 (47%), Positives = 130/195 (66%), Gaps = 1/195 (0%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF 75
           +     E     + T  GFW+YLM+DC++FA  F TYAVL  N   G +  D+F+++ + 
Sbjct: 22  HATSHDEHHDTSENTLFGFWLYLMTDCILFASVFATYAVLYMNTDGGVSGKDIFELNFVL 81

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           + T  LL+SS++  FA++ +   +    T+ WLL+T   G  FI MEIYEF HLI     
Sbjct: 82  IETAALLVSSITFGFALICAK-HQKKAATLGWLLITFALGCAFIGMEIYEFHHLIEHGNG 140

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           PQRSAFLSSFFALVG+HGLHV  GL+W+ +++ ++LK GL   +  RL CLS+FWHFLD+
Sbjct: 141 PQRSAFLSSFFALVGMHGLHVTAGLVWMAIMMFEVLKTGLNKRSITRLGCLSLFWHFLDI 200

Query: 196 IWICVFSFVYLMGVV 210
           +WICVF+ VYL+G +
Sbjct: 201 VWICVFTVVYLLGAM 215


>gi|32894346|gb|AAP90927.1| cytochrome c oxidase subunit III [Homo sapiens]
 gi|32894360|gb|AAP90940.1| cytochrome c oxidase subunit III [Homo sapiens]
 gi|309754543|gb|ACR38958.2| cytochrome c oxidase subunit III [Homo sapiens]
          Length = 261

 Score =  135 bits (339), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 44/201 (21%), Positives = 84/201 (41%), Gaps = 15/201 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPID 67
                 +     G   G  +++ S+ L FA FF  +                  G  P++
Sbjct: 66  TYQGHHTPPVQKGLRYGMILFITSEVLFFAGFFWAFYHSSLAPTPQLGGHWPPTGITPLN 125

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
             ++    ++T VLL S +S ++A  +       ++ +  LL+T   G+ F +++  E+ 
Sbjct: 126 PLEVP--LLNTSVLLASGVSITWAHHSLMENN-RNQMIQALLITILLGLYFTLLQASEY- 181

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
                        + S+FF   G HGLHV  G  +L +  I+ L     S +       +
Sbjct: 182 --FESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKHHFGFEAAA 239

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ ++  +Y  G
Sbjct: 240 WYWHFVDVVWLFLYVSIYWWG 260


>gi|71010008|dbj|BAE12272.1| cytochrome oxydase subunit III [Homo sapiens]
 gi|71015167|dbj|BAE14027.1| cytochrome oxydase subunit III [Homo sapiens]
 gi|171452878|dbj|BAG14841.1| cytochrome oxydase subunit III [Homo sapiens]
 gi|189179177|dbj|BAG38999.1| cytochrome c oxidase subunit III [Homo sapiens]
 gi|229503553|gb|ACQ75913.1| cytochrome c oxidase subunit III [Homo sapiens]
 gi|309756277|gb|ACF10369.2| cytochrome c oxidase subunit III [Homo sapiens]
          Length = 261

 Score =  135 bits (339), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 42/201 (20%), Positives = 82/201 (40%), Gaps = 15/201 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPID 67
                 +     G   G  +++ S+   FA  F  +                  G  P++
Sbjct: 66  TYQGHHTPPVQKGLRYGMILFITSEVFFFAGLFWAFYHSSLAPTPQLGGHWPPTGITPLN 125

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
             ++    ++T VLL S +S ++A  +       ++ +  LL+T   G+ F +++  E+ 
Sbjct: 126 PLEVP--LLNTSVLLASGVSITWAHHSLMENN-RNQMIQALLITILLGLYFTLLQASEY- 181

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
                        + S+FF   G HGLHV  G  +L +  I+ L     S +       +
Sbjct: 182 --FESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKHHFGFEAAA 239

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ ++  +Y  G
Sbjct: 240 WYWHFVDVVWLFLYVSIYWWG 260


>gi|145315463|gb|ABP63021.1| cytochrome c oxidase subunit III [Sus scrofa]
          Length = 261

 Score =  134 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 45/197 (22%), Positives = 83/197 (42%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               + V   G   G  ++++S+ L FA FF  +                P  I   +  
Sbjct: 68  QGHHTSVVQKGLRYGMILFIISEVLFFAGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +LL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSILLASGVSITWAHHSLMEGDRKH-MIQALSITIALGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V +++ LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|229918866|ref|YP_002887526.1| cytochrome c oxidase subunit III [Xiphias gladius]
 gi|229619873|dbj|BAH58233.1| cytochrome c oxidase subunit III [Xiphias gladius]
          Length = 261

 Score =  134 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 40/199 (20%), Positives = 82/199 (41%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPIDVF 69
               +     G   G  +++ S+ L F  FF  +                  G   +D F
Sbjct: 68  QGHHTPPVQKGLRYGMILFITSEVLFFLGFFWAFYHSSLAPTPELGGHWPPTGITALDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  +    +   + +  L +T   G  F  ++  E+   
Sbjct: 128 EVP--LLNTAVLLASGVTVTWAHHSIMEAK-RKQAIQSLALTILLGAYFTFLQAMEYN-- 182

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + ++FF   G HGLHV  G  +L V +++ ++    S +       + +
Sbjct: 183 -EAPFTIADGVYGATFFVATGFHGLHVLIGSTFLAVCLLRQVRHHFTSNHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYISIYWWG 260


>gi|297593524|gb|ADI47479.1| cytochrome oxidase subunit III [Istiophorus albicans]
          Length = 261

 Score =  134 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 84/199 (42%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPIDVF 69
               +     G   G  +++ S+ L F  FF  +                  G   +D F
Sbjct: 68  QGHHTPPVQKGLRYGMILFITSEVLFFLGFFWAFYHSSLAPTPELGGHWPPTGITALDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  +    +   + +  L +T   G  F  ++  E++  
Sbjct: 128 EVP--LLNTAVLLASGVTVTWAHHSIMEAK-RKQAIQSLALTILLGAYFTFLQAVEYS-- 182

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + ++FF   G HGLHV  G  +L V +++ ++    S +   L   + +
Sbjct: 183 -EAPFTIADGVYGATFFVATGFHGLHVLIGSTFLAVCLLRQIRHHFTSSHHFGLEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYISIYWWG 260


>gi|5835073|ref|NP_008154.1|COX3_10512 cytochrome c oxidase subunit III [Petromyzon marinus]
 gi|3121908|sp|Q35539|COX3_PETMA RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|515492|gb|AAB08744.1| cytochrome oxidase subunit III [Petromyzon marinus]
          Length = 261

 Score =  134 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 43/195 (22%), Positives = 82/195 (42%), Gaps = 9/195 (4%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYA----AGPAPIDVFDISG 73
              +     G   G  ++++S+   FA FF  +  A L           P  I+  +   
Sbjct: 69  GHHTSPVQQGLRYGMILFIISEVCFFAGFFWAFYHASLAPTPELGLTWPPTGINPLNPFE 128

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           + +    +LL+S         S T++   +T   L +T   G+ F  ++I E+       
Sbjct: 129 VPLLNTAVLLASGVSVTWAHHSITEKNRTETTQALTLTVLLGLYFTALQIMEY---YETP 185

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
                  + S+FF   G HGLHV  G ++L   +++ L+    S +       + +WHF+
Sbjct: 186 FTMADGVYGSTFFVATGFHGLHVIIGSLFLLTCLLRHLQYHFTSKHHFGFEAAAWYWHFV 245

Query: 194 DLIWICVFSFVYLMG 208
           D++W+ ++  +Y  G
Sbjct: 246 DVVWLFLYISIYWWG 260


>gi|189182383|gb|ACD81901.1| cytochrome c oxidase subunit III [Ophisaurus attenuatus]
          Length = 261

 Score =  134 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 81/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPID-----VFDI 71
               +     G   G  ++++S+ L F  FF  +  + L      G          +   
Sbjct: 68  QGHHTPPVQTGLRYGMLLFIVSEVLFFIGFFWAFYHSSLAPTPELGGQWPPNGISALSPF 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S ++ ++A  +         T   LL+T   G+ F  ++  E+     
Sbjct: 128 EVPLLNTAVLLASGVTVTWAHHSIMEGHQKEAT-QALLLTITLGLYFTALQAMEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V +I+ +K    + +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVMIGSSFLLVCLIRQIKHHFTTQHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|222052785|dbj|BAH16249.1| cytochrome oxydase subunit III [Homo sapiens]
          Length = 262

 Score =  134 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 42/201 (20%), Positives = 82/201 (40%), Gaps = 15/201 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPID 67
                 +     G   G  +++ S+   FA  F  +                  G  P++
Sbjct: 66  TYQGHHTPPVQKGLRYGMILFITSEVFFFAGLFWAFYHSSLAPTPQLGGHWPPTGITPLN 125

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
             ++    ++T VLL S +S ++A  +       ++ +  LL+T   G+ F +++  E+ 
Sbjct: 126 PLEVP--LLNTSVLLASGVSITWAHHSLMENN-RNQMIQALLITILLGLYFTLLQASEY- 181

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
                        + S+FF   G HGLHV  G  +L +  I+ L     S +       +
Sbjct: 182 --FESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKHHFGFEAAA 239

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ ++  +Y  G
Sbjct: 240 WYWHFVDVVWLFLYVSIYWWG 260


>gi|229919622|ref|YP_002887539.1| cytochrome c oxidase subunit III [Tetrapturus audax]
 gi|229922366|ref|YP_002887552.1| cytochrome c oxidase subunit III [Tetrapturus angustirostris]
 gi|229619887|dbj|BAH58246.1| cytochrome c oxidase subunit III [Tetrapturus audax]
 gi|229619901|dbj|BAH58259.1| cytochrome c oxidase subunit III [Tetrapturus angustirostris]
 gi|297593518|gb|ADI47476.1| cytochrome oxidase subunit III [Tetrapturus audax]
 gi|297593522|gb|ADI47478.1| cytochrome oxidase subunit III [Tetrapturus albidus]
          Length = 261

 Score =  134 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 40/199 (20%), Positives = 83/199 (41%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPIDVF 69
               +     G   G  +++ S+ L F  FF  +                  G   +D F
Sbjct: 68  QGHHTPPVQKGLRYGMILFITSEVLFFLGFFWAFYHSSLAPTPELGGHWPPTGITALDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  +    +   + +  L +T   G  F  ++  E++  
Sbjct: 128 EVP--LLNTAVLLASGVTVTWAHHSIMEAK-RKQAIQSLALTILLGAYFTFLQALEYS-- 182

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + ++FF   G HGLHV  G  +L V +++ ++    S +       + +
Sbjct: 183 -EAPFTIADGVYGATFFVATGFHGLHVLIGSTFLAVCLLRQIRHHFTSSHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYISIYWWG 260


>gi|197284018|ref|YP_002149890.1| cytochrome O ubiquinol oxidase subunit III [Proteus mirabilis
           HI4320]
 gi|227358112|ref|ZP_03842453.1| cytochrome O ubiquinol oxidase subunit III [Proteus mirabilis ATCC
           29906]
 gi|194681505|emb|CAR40377.1| cytochrome O ubiquinol oxidase subunit III [Proteus mirabilis
           HI4320]
 gi|227161448|gb|EEI46485.1| cytochrome O ubiquinol oxidase subunit III [Proteus mirabilis ATCC
           29906]
          Length = 203

 Score =  134 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 92/194 (47%), Positives = 126/194 (64%), Gaps = 1/194 (0%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
             +             GFWIYLMSD ++FA  F TYAVL    A GP+  ++F +  + V
Sbjct: 11  AHEHHGHHDAGATKVFGFWIYLMSDLILFASLFATYAVLVNGIADGPSGKEIFSLPFVLV 70

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T +LL SS++  FAML+   K  + +   WL VT  FG+ F++ME+YEF  LI+    P
Sbjct: 71  ETFLLLFSSITFGFAMLS-MNKGSVSQVNLWLFVTFLFGLGFVVMEVYEFHELIAEGYGP 129

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
            RSAFLS+FFALV  HGLHV  GL+W+ +++IQ+ ++GL   N+ RL CLS+FWHFLD++
Sbjct: 130 DRSAFLSAFFALVSTHGLHVTAGLVWIIIMMIQVSRRGLTDVNRTRLSCLSLFWHFLDVV 189

Query: 197 WICVFSFVYLMGVV 210
           WICVF+ VYLMG +
Sbjct: 190 WICVFTVVYLMGAM 203


>gi|229918838|ref|YP_002887500.1| cytochrome c oxidase subunit III [Makaira indica]
 gi|229918852|ref|YP_002887513.1| cytochrome c oxidase subunit III [Istiophorus platypterus]
 gi|229924019|ref|YP_002887565.1| cytochrome c oxidase subunit III [Makaira mazara]
 gi|229619802|dbj|BAH58285.1| cytochrome c oxidase subunit III [Makaira indica]
 gi|229619816|dbj|BAH58298.1| cytochrome c oxidase subunit III [Istiophorus platypterus]
 gi|229619915|dbj|BAH58272.1| cytochrome c oxidase subunit III [Makaira mazara]
          Length = 261

 Score =  134 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 40/199 (20%), Positives = 83/199 (41%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPIDVF 69
               +     G   G  +++ S+ L F  FF  +                  G   +D F
Sbjct: 68  QGHHTPPVQKGLRYGMILFITSEVLFFLGFFWAFYHSSLAPTPELGGHWPPTGITALDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  +    +   + +  L +T   G  F  ++  E++  
Sbjct: 128 EVP--LLNTAVLLASGVTVTWAHHSIMEAK-RKQAIQSLALTILLGAYFTFLQAVEYS-- 182

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + ++FF   G HGLHV  G  +L V +++ ++    S +       + +
Sbjct: 183 -EAPFTIADGVYGATFFVATGFHGLHVLIGSTFLAVCLLRQIRHHFTSSHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYISIYWWG 260


>gi|297593514|gb|ADI47474.1| cytochrome oxidase subunit III [Tetrapturus pfluegeri]
          Length = 261

 Score =  134 bits (338), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 38/199 (19%), Positives = 81/199 (40%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPIDVF 69
               +     G   G  +++ S+ L F  FF  +                  G   +D F
Sbjct: 68  QGHHTPPVQKGLRYGMILFITSEVLFFLGFFWAFYHSSLAPTPELGGHWPPTGITALDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VL  S ++ ++A  +    +   + +  L +T   G  F  ++  E++  
Sbjct: 128 EVP--LLNTAVLPASGVTVTWAYHSIMEAK-RKQAIQSLALTILLGAYFTFLQALEYS-- 182

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + ++F    G HGLHV  G  +L V +++ ++    S +       + +
Sbjct: 183 -EAPFTIADGVYGATFSVATGFHGLHVLIGSTFLAVCLLRQIRHHFTSSHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYISIYWWG 260


>gi|254234441|ref|ZP_04927764.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas aeruginosa
           C3719]
 gi|126166372|gb|EAZ51883.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas aeruginosa
           C3719]
          Length = 209

 Score =  134 bits (338), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 94/193 (48%), Positives = 128/193 (66%), Gaps = 1/193 (0%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            D   +      T  GFW+YLM+DC++FA  F TYAVL  + A GP+  D+F++  + V 
Sbjct: 18  HDHDHAHDSGGNTVFGFWLYLMTDCVLFASVFATYAVLVHHTAGGPSGKDIFELPYVLVE 77

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T +LL+SS +   AML++       + ++WL VT   G  FI MEI EF HLI+    P 
Sbjct: 78  TAILLVSSCTYGLAMLSAHKGA-KGQAIAWLGVTFLLGAAFIGMEINEFHHLIAEGFGPS 136

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
           RSAFLSSFF LVG+HGLHV  GL+W+ VL+ QI  +GL + N  R++CLS+FWHFLD++W
Sbjct: 137 RSAFLSSFFTLVGMHGLHVSAGLLWMLVLMAQIWTRGLTAQNNTRMMCLSLFWHFLDMVW 196

Query: 198 ICVFSFVYLMGVV 210
           ICVF+ VY+MG +
Sbjct: 197 ICVFTVVYMMGAL 209


>gi|11055636|gb|AAG28183.1|AF304200_7 COIII [Sus scrofa]
 gi|11055664|gb|AAG28209.1|AF304202_7 COIII [Sus scrofa]
 gi|33320690|gb|AAQ05986.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|33320704|gb|AAQ05999.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|33320718|gb|AAQ06012.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|33320746|gb|AAQ06038.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|33320760|gb|AAQ06051.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|33320774|gb|AAQ06064.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|33320788|gb|AAQ06077.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|33320802|gb|AAQ06090.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|33320816|gb|AAQ06103.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|33320830|gb|AAQ06116.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|33320858|gb|AAQ06142.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|33320872|gb|AAQ06155.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|33320900|gb|AAQ06181.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|33320914|gb|AAQ06194.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|33320928|gb|AAQ06207.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|33320942|gb|AAQ06220.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|33320956|gb|AAQ06233.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|157144252|dbj|BAF80077.1| cytochrome oxidase subunit III [Sus scrofa]
          Length = 278

 Score =  134 bits (338), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 82/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               + V   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTSVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +LL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSILLASGVSITWAHHSLMEGDRKH-MIQALSITIALGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V +++ LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|297593512|gb|ADI47473.1| cytochrome oxidase subunit III [Tetrapturus angustirostris]
          Length = 261

 Score =  134 bits (337), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 40/199 (20%), Positives = 83/199 (41%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPIDVF 69
               +     G   G  +++ S+ L F  FF  +                  G   +D F
Sbjct: 68  QGHHTPPVQKGLRYGMILFITSEVLFFLGFFWAFYHSSLAPTPELGGHWPPTGITALDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  +    +   + +  L +T   G  F  ++  E++  
Sbjct: 128 EVP--LLNTAVLLASGVTVTWAHHSIMEAK-RKQAIQSLALTILLGAYFTFLQALEYS-- 182

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + ++FF   G HGLHV  G  +L V +++ ++    S +       + +
Sbjct: 183 -EAPFTIADGVYGATFFVATGFHGLHVLIGSTFLAVCLLRQIRHHFTSSHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYISIYWWG 260


>gi|5836037|ref|NP_008796.1|COX3_15103 cytochrome c oxidase subunit III [Hippopotamus amphibius]
 gi|6647505|sp|Q9ZZY5|COX3_HIPAM RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|4127870|emb|CAA09434.1| COIII [Hippopotamus amphibius]
          Length = 261

 Score =  134 bits (337), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 41/196 (20%), Positives = 78/196 (39%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               + V   G   G  ++++S+ L F  FF  +                P  I+  +  
Sbjct: 68  QGHHTPVVQKGLRYGMVLFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGINPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +    + +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKQMLQALFITIALGVYFTLLQASEYH---EA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V  ++ LK    S +       + +WHF
Sbjct: 185 SFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFLRQLKFHFTSDHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|5835589|ref|NP_008438.1|COX3_13974 cytochrome c oxidase subunit III [Pelomedusa subrufa]
 gi|5921878|sp|O79676|COX3_PELSU RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|3599983|gb|AAD05056.1| cytochrome oxidase subunit III [Pelomedusa subrufa]
          Length = 261

 Score =  134 bits (337), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 46/199 (23%), Positives = 85/199 (42%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK---------NYAAGPAPIDVF 69
               +    +    G  +++ S+ L F  FF  +                  G  P++ F
Sbjct: 68  QGHHTPSVQNNLRYGMILFITSEILFFTGFFWAFYHSSLSPTAELGNIWPPTGITPLNPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  +        +T+  L +T   G  F I++  E+   
Sbjct: 128 EVP--LLNTAVLLASGVTITWAHHSLMEGN-RPQTLQALTLTIILGTYFTILQAMEY--- 181

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                    S + S+FF   G HGLHV  G  +L V +++ LK    S +       + +
Sbjct: 182 FEASFTIADSIYGSTFFVATGFHGLHVIIGSTFLIVCLMRQLKYHFTSHHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D+IW+ ++  +Y  G
Sbjct: 242 WHFVDVIWLFLYLSIYWWG 260


>gi|297593520|gb|ADI47477.1| cytochrome oxidase subunit III [Makaira nigricans]
          Length = 261

 Score =  134 bits (337), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 40/199 (20%), Positives = 83/199 (41%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPIDVF 69
               +     G   G  +++ S+ L F  FF  +                  G   +D F
Sbjct: 68  QGHHTPPVQKGLRYGMILFITSEVLFFLGFFWAFYHSSLAPTPELGGHWPPTGITALDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  +    +   + +  L +T   G  F  ++  E++  
Sbjct: 128 EVPP--LNTAVLLASGVTVTWAHHSIMEAK-RKQAIQSLALTILLGAYFTFLQALEYS-- 182

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + ++FF   G HGLHV  G  +L V +++ ++    S +       + +
Sbjct: 183 -EAPFTIADGVYGATFFVATGFHGLHVLIGSTFLAVCLLRQIRHHFTSSHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYISIYWWG 260


>gi|223972324|dbj|BAH23360.1| cytochrome oxidase subunit III [Hippopotamus amphibius]
          Length = 261

 Score =  134 bits (337), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 41/196 (20%), Positives = 78/196 (39%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               + V   G   G  ++++S+ L F  FF  +                P  I+  +  
Sbjct: 68  QGHHTPVVQKGLRYGMVLFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGINPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +    + +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKQMLQALFITIALGVYFTLLQASEYH---EA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V  ++ LK    S +       + +WHF
Sbjct: 185 SFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFLRQLKFHFTSDHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|307579656|gb|ADN63625.1| cytochrome O ubiquinol oxidase subunit III [Xylella fastidiosa
           subsp. fastidiosa GB514]
          Length = 194

 Score =  134 bits (337), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 103/195 (52%), Positives = 130/195 (66%), Gaps = 2/195 (1%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF 75
           + +D        D T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + 
Sbjct: 2   HNRDHAHHDT-GDNTVFGFWVYLMSDCLIFAGLFATYAVLVGATVDGPTAKELFDLKFVL 60

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           V T +LL SSL+  FAM+A+  +  I     WL+VTA FG+ F+ ME+YEF HLI   A 
Sbjct: 61  VETFLLLFSSLTFGFAMIAAHKRH-IPALYGWLMVTALFGLGFLGMELYEFHHLIQEGAG 119

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           P RSAFLS+FF LVG HGLHV  GL+W+ +LVIQI+K GL   N  RL CLS+FWHFLD+
Sbjct: 120 PGRSAFLSAFFTLVGTHGLHVASGLLWMLILVIQIVKNGLTPRNSTRLACLSLFWHFLDV 179

Query: 196 IWICVFSFVYLMGVV 210
           IWI VF+ VYL+G +
Sbjct: 180 IWIGVFTIVYLLGAL 194


>gi|116250799|ref|YP_766637.1| cytochrome c oxidase polypeptide III (cytochrome aa3 subunit 3)
           [Rhizobium leguminosarum bv. viciae 3841]
 gi|115255447|emb|CAK06523.1| putative cytochrome c oxidase polypeptide III (cytochrome aa3
           subunit 3) [Rhizobium leguminosarum bv. viciae 3841]
          Length = 292

 Score =  134 bits (337), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 46/206 (22%), Positives = 83/206 (40%), Gaps = 17/206 (8%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA--------------VLGKNYAAG 62
             +   + V       G  +++ S+ + F  +F  Y               +L       
Sbjct: 81  AHEGAHTRVVSLHLRYGMIMFIASEVMFFVAWFWAYFDASLYPNEAIQASRLLYTGGTWP 140

Query: 63  PAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIME 122
           P  I+V D   + +   V+LL S +       +         +  L +T   GM F  ++
Sbjct: 141 PKGIEVLDPWHLPIYNTVILLLSGTTVTWAHHALLHNDRKGLIQGLTLTVLLGMFFSAVQ 200

Query: 123 IYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRR 182
            YE+AH        + S + ++FF   G HG HV  G I+L V +I+ L+          
Sbjct: 201 AYEYAH---APFAFKSSIYGATFFMATGFHGFHVLVGTIFLAVCLIRALRGDFTPKQHFG 257

Query: 183 LICLSMFWHFLDLIWICVFSFVYLMG 208
               + +WHF+D++W+ +F  +Y+ G
Sbjct: 258 FEAAAWYWHFVDVVWLFLFFCIYVWG 283


>gi|307545743|ref|YP_003898222.1| cytochrome O ubiquinol oxidase subunit III [Halomonas elongata DSM
           2581]
 gi|307217767|emb|CBV43037.1| cytochrome o ubiquinol oxidase subunit III [Halomonas elongata DSM
           2581]
          Length = 204

 Score =  134 bits (337), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 95/198 (47%), Positives = 125/198 (63%), Gaps = 2/198 (1%)

Query: 13  SLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
              +  +             GFW+YLMSD ++F   F TYAVL +  A GP P +VF++ 
Sbjct: 9   HEGHAHEHDHHDTAGT-KVFGFWVYLMSDLVIFGSLFATYAVLLRGTAGGPTPGEVFELP 67

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            I V T +LL SS +   A+LA      + +  +WL +T   G  F+ ME+YEF HLI  
Sbjct: 68  FILVETFLLLFSSFTYGMAVLA-MNANRVGQIKAWLAITFLLGAAFVGMEVYEFQHLIHE 126

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
              P RSAFLS+FF LVG HGLHV FGLIW+ V++IQ+  KGL    + R++CLS+FWHF
Sbjct: 127 GFGPDRSAFLSAFFTLVGTHGLHVTFGLIWILVMLIQLQTKGLTDMTRPRIMCLSLFWHF 186

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD++WICVFSFVYLMGV+
Sbjct: 187 LDIVWICVFSFVYLMGVL 204


>gi|163857710|ref|YP_001632008.1| cytochrome o ubiquinol oxidase subunit III [Bordetella petrii DSM
           12804]
 gi|163261438|emb|CAP43740.1| cytochrome o ubiquinol oxidase subunit III [Bordetella petrii]
          Length = 208

 Score =  134 bits (337), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 108/197 (54%), Positives = 141/197 (71%), Gaps = 4/197 (2%)

Query: 14  LFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISG 73
            FY+ ++       +GT LGFW+Y+MSDCL+FA  F TY VLG+NY  GP   D+F++  
Sbjct: 15  QFYLTEEHH---VKNGTLLGFWVYVMSDCLIFACLFATYGVLGRNYDGGPTGADLFELPL 71

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           + ++T +LLLSS++  FA+L     R +   + WL VT   G  F+ +EIYEFAHLI+  
Sbjct: 72  VALNTSLLLLSSITYGFALLQGRKGR-VGSLLGWLAVTGLLGAGFLGLEIYEFAHLIAEG 130

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
           A PQRSAFLS+FF LVG HGLHV FGL+WL VL++QI   GLI  N+RRL+CLSMFWHFL
Sbjct: 131 AGPQRSAFLSAFFTLVGTHGLHVTFGLVWLVVLMVQIGMHGLIIPNKRRLMCLSMFWHFL 190

Query: 194 DLIWICVFSFVYLMGVV 210
           D++WI VF+ VYLMGV+
Sbjct: 191 DVVWIGVFTVVYLMGVL 207


>gi|57013984|ref|YP_173456.1| cytochrome oxidase subunit 3 [Nicotiana tabacum]
          Length = 265

 Score =  134 bits (337), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 44/199 (22%), Positives = 84/199 (42%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFF--VTYAVLGKNYAAG----PAPIDVFDIS 72
           +   + V   G   GF ++++S+ + F   F   +++ L      G    P  I V D  
Sbjct: 71  EGHHTKVVQLGPRYGFILFIVSEVMFFFALFRASSHSSLAPTVEIGGIWPPKGIAVLDPW 130

Query: 73  -GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T++ L S  + ++A  A    +   + V  L+ T    ++F   +  E+     
Sbjct: 131 EIPFLNTLIPLSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVFTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                  S + S+FF   G HG HV  G I+  +  I+     L   +       + +WH
Sbjct: 187 APFTISDSIYGSTFFLATGFHGFHVIIGTIFSIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ + +F  +Y  G +
Sbjct: 247 FVDVVRLFLFVSIYWWGGI 265


>gi|16357353|ref|NP_443664.1| cytochrome c oxidase subunit III [Mastacembelus favus]
 gi|16267261|dbj|BAB70384.1| cytochrome c oxidase subunit III [Mastacembelus favus]
          Length = 261

 Score =  134 bits (337), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 84/199 (42%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPIDVF 69
               +     G   G  +++ S+ L F  FF  +                  G  P++ F
Sbjct: 68  QGHHTPPVQKGLRYGMILFITSEVLFFLGFFWAFYHSSLAPTPELGGSWPPTGITPLNPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  +   +    + +  L +T   G  F +++  E+   
Sbjct: 128 EVP--LLNTAVLLASGVTVTWAHHSIMERE-RKQAIQALTLTILLGFYFTLLQAMEY--- 181

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + S+FF   G HGLHV  G  +L V +++ ++    S +       + +
Sbjct: 182 YEAPFTIADGVYGSTFFVATGFHGLHVIIGSTFLTVCLLRQIRYHFTSEHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYISIYWWG 260


>gi|145315505|gb|ABP63060.1| cytochrome c oxidase subunit III [Sus scrofa]
          Length = 261

 Score =  133 bits (336), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 82/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               + V   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTSVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +LL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSILLASGVSITWAHHSLMEGDRKH-MIQALSITIALGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V +++ LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|45826204|gb|AAS77723.1| cytochrome c oxidase subunit 3 [Sus scrofa]
          Length = 261

 Score =  133 bits (336), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 82/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               + V   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTSVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +LL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSILLASGVSITWAHHSLMEGDRKH-MIQALSITIALGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V +++ LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|317097276|ref|YP_004123471.1| cytochrome c oxidase subunit III [Procapra przewalskii]
 gi|284176543|gb|ADB81009.1| cytochrome c oxidase subunit 3 [Procapra przewalskii]
          Length = 261

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 77/196 (39%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I+  +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGINPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   ++ +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNQMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|251799268|ref|YP_003013999.1| cytochrome-c oxidase [Paenibacillus sp. JDR-2]
 gi|247546894|gb|ACT03913.1| Cytochrome-c oxidase [Paenibacillus sp. JDR-2]
          Length = 205

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 67/193 (34%), Positives = 115/193 (59%), Gaps = 1/193 (0%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            + +++ ++     LGFW++L ++ ++F   F  +  L      GP   ++F++  + ++
Sbjct: 13  HEPEKATLEGRNKILGFWLFLGAETVLFGTLFSAFLALRDQVLDGPKSQELFELPLVALA 72

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T +LL SSL+  FA  A   +++    V WL+VT   G+ F+ +EIYEF++ +       
Sbjct: 73  TGLLLTSSLTSVFATQALHQQKVK-AMVWWLVVTVILGLGFLGLEIYEFSNYVHEGHGFT 131

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
            SAF SSF+ LVG HG HV FG++W+ +L+ Q+LKKGL      +     ++WHF+D++W
Sbjct: 132 TSAFSSSFYTLVGFHGAHVAFGIVWISLLIGQLLKKGLTVTTAPKAYVAGIYWHFIDVVW 191

Query: 198 ICVFSFVYLMGVV 210
           + +F+ VYLMG V
Sbjct: 192 VFIFTVVYLMGKV 204


>gi|94314710|ref|YP_587919.1| cytochrome o ubiquinol oxidase subunit III [Cupriavidus
           metallidurans CH34]
 gi|93358562|gb|ABF12650.1| cytochrome o ubiquinol oxidase subunit III [Cupriavidus
           metallidurans CH34]
          Length = 226

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 94/192 (48%), Positives = 124/192 (64%), Gaps = 1/192 (0%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF 75
           +  D  +  V    T LGFW+YLMSDCL+FAV F T+ VL  N A GP   ++FD+  + 
Sbjct: 31  HGHDGHDDHVVQSRTTLGFWLYLMSDCLIFAVLFATFGVLVNNTAGGPGGRELFDLRFVL 90

Query: 76  VSTIVLLLSSLSCSFAMLASATKR-LIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
             T++LL SSL+   AM+     +   ++ + W+++T   G  F+ MEI+EF  LI   A
Sbjct: 91  GETMLLLTSSLTFGVAMIKLEDGKANPNQVIRWIVLTFALGAAFVGMEIFEFMELIHEGA 150

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
            P RSA+LS+FF LVG HGLHV  GL+W+ V+V QI   GL    +RRL CLS+FWHFLD
Sbjct: 151 GPGRSAYLSAFFMLVGTHGLHVTAGLLWIIVMVHQIQVFGLDGIVRRRLACLSLFWHFLD 210

Query: 195 LIWICVFSFVYL 206
           L+WICVFS VYL
Sbjct: 211 LVWICVFSIVYL 222


>gi|38707555|ref|NP_944665.1| cytochrome c oxidase subunit III [Kogia breviceps]
 gi|38602480|emb|CAD87942.1| cytochrome c oxidase polypeptide III [Kogia breviceps]
          Length = 261

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/196 (20%), Positives = 77/196 (39%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMVLFILSEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPF 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +      +  LLVT   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMQGDRKHMLQALLVTILLGLYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V +++ +K    S +       + +WHF
Sbjct: 185 PFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCLLRQMKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|83779138|gb|ABC47382.1| cytochrome c oxidase subunit 3 [Sus scrofa]
          Length = 261

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 82/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               + V   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTSVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +LL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSILLASGVSITWAHHSLMEGDRKH-MIQALSITIALGVCFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V +++ LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVTIGSTFLAVCLLRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|11055678|gb|AAG28222.1|AF304203_7 COIII [Sus scrofa]
 gi|3928504|emb|CAA05235.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|33320732|gb|AAQ06025.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|33320844|gb|AAQ06129.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|157056432|gb|ABV02134.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|209166107|gb|ACI41486.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|209166121|gb|ACI41499.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|209166135|gb|ACI41512.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|209166149|gb|ACI41525.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|209166163|gb|ACI41538.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|209166177|gb|ACI41551.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|209166191|gb|ACI41564.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|209166205|gb|ACI41577.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|209166219|gb|ACI41590.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|209166233|gb|ACI41603.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|209166247|gb|ACI41616.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|209166261|gb|ACI41629.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|209166275|gb|ACI41642.1| cytochrome oxidase subunit III [Sus scrofa]
          Length = 267

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 82/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               + V   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTSVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +LL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSILLASGVSITWAHHSLMEGDRKH-MIQALSITIALGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V +++ LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|45826190|gb|AAS77710.1| cytochrome c oxidase subunit 3 [Sus scrofa]
          Length = 261

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 82/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               + V   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTSVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +LL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTTILLASGVSITWAHHSLMEGDRKH-MIQALSITIALGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V +++ LK    S +       + +WH
Sbjct: 184 APLTISDGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|29570648|ref|NP_818910.1| cytochrome c oxidase subunit III [Eigenmannia sp. CBM-ZF-10620]
 gi|29501129|dbj|BAC67487.1| cytochrome oxidase subunit 3 [Eigenmannia sp. CBM-ZF-10620]
          Length = 261

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 40/197 (20%), Positives = 81/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD-I 71
               +     G   G  +++ S+ L FA FF  +                P  I   + +
Sbjct: 68  QGHHTLPVQKGLRYGMILFITSEVLFFAGFFWAFYHSSLAPTPELGGCWPPTGITPLNPM 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S ++ ++A  +        + +  L++T   G  F  ++  E+     
Sbjct: 128 EVPLLNTAVLLASGVTVTWAHHSLMEGE-RKQAIQALILTILLGFYFTALQAMEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L + +++ ++    S +       + +WH
Sbjct: 184 APFTIADGIYGSTFFVATGFHGLHVIIGSSFLAICLLRQIQYHFTSEHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|109897617|ref|YP_660872.1| cytochrome c oxidase, subunit III [Pseudoalteromonas atlantica T6c]
 gi|109699898|gb|ABG39818.1| cytochrome bo3 quinol oxidase subunit 3 [Pseudoalteromonas
           atlantica T6c]
          Length = 214

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 96/193 (49%), Positives = 132/193 (68%), Gaps = 3/193 (1%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            D+         T  GFW+YLM+DC++FA  F TYAVL  N   G +  D+FD++ + V 
Sbjct: 25  HDEHHDTGG--NTLFGFWLYLMTDCILFASVFATYAVLYMNTDGGVSGKDIFDLNFVLVE 82

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T  LL+SS++  FA+L +  ++    T+ WLLVT   G +FI ME+YEF HLI     P 
Sbjct: 83  TAALLVSSITYGFALLCAHKQQ-RAGTLLWLLVTMALGCVFIAMEVYEFHHLIVEGNGPD 141

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
           RSAFLSSFFALVG+HGLHV  GL+W+ V+V+++LK+GL +    RL CLS+FWHFLD++W
Sbjct: 142 RSAFLSSFFALVGMHGLHVTAGLVWMLVMVLEVLKRGLGAQTVTRLGCLSLFWHFLDIVW 201

Query: 198 ICVFSFVYLMGVV 210
           +CVF+ VYL+G +
Sbjct: 202 VCVFTVVYLLGAM 214


>gi|145315617|gb|ABP63164.1| cytochrome c oxidase subunit III [Sus scrofa]
 gi|162423274|gb|ABX89415.1| cytochrome c oxidase subunit 3 [Sus scrofa]
          Length = 261

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 45/197 (22%), Positives = 83/197 (42%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               + V   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTSVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +LL S +S ++A  +       H T+  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSILLASGVSITWAHHSLMEGDRKH-TIQALSITIALGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V +++ LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|62086643|dbj|BAD91739.1| cytochrome c oxidase subunit III [Eschrichtius robustus]
          Length = 261

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 80/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MLQALFITIALGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +K    S +       + +WH
Sbjct: 184 APFTISDGIYGSTFFVATGFHGLHVIIGTTFLIVCFLRQMKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|225427|prf||1303229B cytochrome oxidase III
          Length = 265

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 43/199 (21%), Positives = 83/199 (41%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDIS 72
           +   + V   G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKVVQLGLRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPW 130

Query: 73  -GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +LL S  + ++A  A    +   + V  L+ T    ++F   +  E+     
Sbjct: 131 EIPFLNTPILLSSEAAATWAHHAILAGKEK-RAVYALVATVSLAIVFTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                  S + S+F+   G HG HV  G ++  +  I+     L   +       + +WH
Sbjct: 187 APPTISDSIYGSTFYLATGFHGTHVIIGTLFSIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++W+ +F  +Y  G +
Sbjct: 247 FVDVVWLFLFLSIYWWGGI 265


>gi|190576213|ref|YP_001974058.1| putative cytochrome o ubiquinol oxidase subunit III
           [Stenotrophomonas maltophilia K279a]
 gi|190014135|emb|CAQ47774.1| putative cytochrome o ubiquinol oxidase subunit III
           [Stenotrophomonas maltophilia K279a]
          Length = 211

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 88/178 (49%), Positives = 116/178 (65%), Gaps = 1/178 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
            G W+YLMSD ++F   F +YAVL   YA GP   ++F +  +   T +LL+SS++   A
Sbjct: 34  FGMWVYLMSDLVLFGSLFASYAVLSTAYAGGPTGKELFSLPFVMAETFLLLVSSITYGQA 93

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +LA          + WL VT   G  FI MEIYEF+HLI   A P  SA+LS+FFALV  
Sbjct: 94  VLAMHRHDTS-AVLRWLGVTFVLGASFIGMEIYEFSHLIHEGAGPSTSAYLSAFFALVAT 152

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           HGLHV  GLIW+ V++ Q+ ++GL   N  R+ CLS+FWHFLDL+WICVF+FVYL+G 
Sbjct: 153 HGLHVASGLIWMAVVMHQVYRRGLTPTNITRVSCLSLFWHFLDLVWICVFTFVYLIGA 210


>gi|218661747|ref|ZP_03517677.1| cytochrome c oxidase protein, subunit III [Rhizobium etli IE4771]
          Length = 292

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 43/206 (20%), Positives = 82/206 (39%), Gaps = 17/206 (8%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA--------------VLGKNYAAG 62
             +   + V       G  +++ S+ + F  +F  Y               +        
Sbjct: 81  AHEGAHTRVVSLHLRYGMIMFIASEVMFFVAWFWAYFDASLYPNEAIQASRLAYTGGVWP 140

Query: 63  PAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIME 122
           P  I+V D   + +   V+LL S +       +         +  L +T   G+ F  ++
Sbjct: 141 PKGIEVLDPWHLPIYNTVILLLSGTTVTWAHHALLHNDRKGLIQGLTLTVLLGIFFSTVQ 200

Query: 123 IYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRR 182
            YE+AH        + S + ++FF   G HG HV  G I+L V +++ L+          
Sbjct: 201 AYEYAH---APFAFKNSIYGATFFMATGFHGFHVLVGTIFLLVCLLRALRGDFTPKQHFG 257

Query: 183 LICLSMFWHFLDLIWICVFSFVYLMG 208
               + +WHF+D++W+ +F  +Y+ G
Sbjct: 258 FEAAAWYWHFVDVVWLFLFFCIYVWG 283


>gi|38707591|ref|NP_944730.1| cytochrome c oxidase subunit III [Pontoporia blainvillei]
 gi|38602550|emb|CAD88007.1| cytochrome c oxidase polypeptide III [Pontoporia blainvillei]
          Length = 261

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/197 (20%), Positives = 82/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               +     G   G  ++++S+ L F  FF  +  + L      G +   V        
Sbjct: 68  QGHHTPTVQKGLRYGMILFILSEVLFFTGFFWAFYHSSLAPTPELGGSWPPVGIQPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S ++ ++A  +        + +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVTITWAHHSLMEGN-RKQMLQALSITIALGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L +  ++ +K    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGTTFLIICFMRQMKFHFTSTHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|322422413|ref|YP_004221841.1| cytochrome c oxidase subunit III [Brachyhypopomus pinnicaudatus]
 gi|317176614|dbj|BAJ54421.1| cytochrome c oxidase subunit III [Brachyhypopomus pinnicaudatus]
          Length = 261

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 43/199 (21%), Positives = 84/199 (42%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK---------NYAAGPAPIDVF 69
               +     G   G  +++ S+ L FA FF  +                  G  P+D F
Sbjct: 68  QGHHTLPVQKGLRYGMILFITSEVLFFAGFFWAFYHSSLAPTPELGGCWPPTGIIPLDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  +    +   + +  L +T   G  F  ++  E+   
Sbjct: 128 EVP--LLNTAVLLASGVTVTWAHHSLMEGQ-RKQAIHALTLTILLGFYFTALQAMEY--- 181

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + S+FF   G HGLHV  G  +L V +++ ++    S +       + +
Sbjct: 182 YEAPFTIADGIYGSTFFVATGFHGLHVIIGSTFLLVCLLRQIQYHFTSEHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYVSIYWWG 260


>gi|116733692|gb|ABK19903.1| cytochrome oxidase subunit 3 [Ichthyomyzon unicuspis]
 gi|116733694|gb|ABK19904.1| cytochrome oxidase subunit 3 [Ichthyomyzon unicuspis]
 gi|116733696|gb|ABK19905.1| cytochrome oxidase subunit 3 [Ichthyomyzon fossor]
 gi|116733698|gb|ABK19906.1| cytochrome oxidase subunit 3 [Ichthyomyzon fossor]
 gi|116733700|gb|ABK19907.1| cytochrome oxidase subunit 3 [Ichthyomyzon fossor]
          Length = 261

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 43/195 (22%), Positives = 85/195 (43%), Gaps = 9/195 (4%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYA----AGPAPIDVFDISG 73
              +     G   G  ++++S+   FA FF  +  A L   +       P  I+  +   
Sbjct: 69  GHHTSPVQQGLRYGMILFIVSEVCFFAGFFWAFYHASLAPTHELGLTWPPTGINPLNPFE 128

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           + +    +LL+S         S T++   +T   L++T   G+ F  ++I E+       
Sbjct: 129 VPLLNTAVLLASGVSVTWAHHSITEKNRMETTQALIMTILLGLYFTALQIMEYH---ETP 185

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
                S + S+FF   G HGLHV  G ++L   +++ ++    S +       + +WHF+
Sbjct: 186 FTMADSVYGSTFFVATGFHGLHVIIGSMFLLTCLMRHMQYHFTSKHHFGFEAAAWYWHFV 245

Query: 194 DLIWICVFSFVYLMG 208
           D++W+ ++  +Y  G
Sbjct: 246 DVVWLFLYISIYWWG 260


>gi|124358983|ref|YP_001023769.1| cytochrome c oxidase subunit III [Phacochoerus africanus]
 gi|88766367|gb|ABD49699.1| cytochrome c oxidase subunit III [Phacochoerus africanus]
          Length = 261

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 45/197 (22%), Positives = 81/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               + V   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTSVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRKH-MLQALGITIALGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLAVCFLRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|84386635|ref|ZP_00989661.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio splendidus
           12B01]
 gi|84378441|gb|EAP95298.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio splendidus
           12B01]
          Length = 205

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 96/204 (47%), Positives = 124/204 (60%), Gaps = 1/204 (0%)

Query: 7   GKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI 66
             +P+ +                   GFW+YLMSDC++FA  F TYAVL     AGP   
Sbjct: 3   ANTPSHTYDLAHSHDHHHEAAGNKLFGFWVYLMSDCVLFATLFATYAVLESGSIAGPTGK 62

Query: 67  DVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEF 126
           D+F++  +FV T++LL SS++  F M+A   K  +     W+ VT   G+ FI ME+YEF
Sbjct: 63  DIFELPFVFVETMMLLFSSITFGFGMIAMKRKD-VTGLKRWIKVTFALGLAFICMEVYEF 121

Query: 127 AHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
            HLI+    PQ SAFLS+FF LVG HGLHV FGLIW+ V   Q+  KGL      R  CL
Sbjct: 122 HHLIAEGYGPQESAFLSAFFTLVGTHGLHVTFGLIWMAVAYHQLSTKGLNDNMSMRFQCL 181

Query: 187 SMFWHFLDLIWICVFSFVYLMGVV 210
           S+FWHFLD++WICVF+ VYLMGV+
Sbjct: 182 SLFWHFLDIVWICVFTIVYLMGVM 205


>gi|304407876|ref|ZP_07389527.1| cytochrome o ubiquinol oxidase, subunit III [Paenibacillus
           curdlanolyticus YK9]
 gi|304343359|gb|EFM09202.1| cytochrome o ubiquinol oxidase, subunit III [Paenibacillus
           curdlanolyticus YK9]
          Length = 206

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 78/180 (43%), Positives = 115/180 (63%), Gaps = 2/180 (1%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+LM+D ++F   F  Y VL  N A GP   ++F + G+   T +LL SS +   A
Sbjct: 28  LGFWIFLMTDVIIFGCLFAVYVVLRNNTAGGPTAEELFKMPGVIAETFILLTSSFTSGLA 87

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA-VPQRSAFLSSFFALVG 150
           +LA    +  ++ ++WL VTA  G  FI +E+YEF  +++ E      S FLS FF LVG
Sbjct: 88  VLAMHAGK-KNQLITWLGVTAALGAAFIFLEVYEFVDMVNHEGATIATSGFLSGFFTLVG 146

Query: 151 LHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
            HGLHV  GL+W+  L++Q+ K+G+    +R++  LS++WHFLD++WI V + VYLMGV+
Sbjct: 147 THGLHVSIGLVWMIGLMLQLRKRGITPVTKRKVEVLSLYWHFLDVVWIFVLTVVYLMGVM 206


>gi|215399147|ref|YP_002332277.1| cytochrome c oxidase subunit III [Podarcis muralis]
 gi|62900864|gb|AAY18753.1| cytochrome c oxidase subunit III [Podarcis muralis]
 gi|213983295|gb|ACJ54978.1| cytochrome c oxidase subunit III [Podarcis muralis]
          Length = 261

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 42/199 (21%), Positives = 82/199 (41%), Gaps = 11/199 (5%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +     G   G  +++ S+ L FA FF  +                P  ++  +
Sbjct: 66  TYQGHHTMPVQKGLRYGMILFITSEVLFFAGFFWAFYHSSLAPTPELGGQWPPTGVNPLN 125

Query: 71  -ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
                 ++T VLL S ++ ++A  A    +    T+  L +T   G+ F I++  E+   
Sbjct: 126 AFEVPLLNTAVLLASGVTVTWAHHALMEGK-RTDTIQALSLTILLGIYFTILQASEYH-- 182

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                    S + ++FF   G HGLHV  G  +L + +I+       + +       + +
Sbjct: 183 -ETSFTISDSVYGATFFVATGFHGLHVIIGSTFLMICLIRQSLFHFTTNHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYVSIYWWG 260


>gi|5835869|ref|NP_008640.1|COX3_15069 cytochrome c oxidase subunit III [Sus scrofa]
 gi|223976085|ref|YP_002600783.1| cytochrome c oxidase subunit III [Sus scrofa domesticus]
 gi|6166025|sp|Q35916|COX3_PIG RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|4958958|gb|AAD34191.1|AF034253_7 cytochrome c oxidase subunit III [Sus scrofa]
 gi|37962875|gb|AAR05788.1| cytochrome c oxidase subunit 3 [Sus scrofa]
 gi|223972366|dbj|BAH23399.1| cytochrome oxidase subunit III [Sus scrofa domestica]
          Length = 261

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 82/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               + V   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTSVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +LL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSILLASGVSITWAHHSLMEGDRKH-MIQALSITIALGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V +++ LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|283099324|ref|YP_003359491.1| cytochrome c oxidase subunit III [Acheilognathus macropterus]
 gi|146142421|gb|ABQ01679.1| cytochrome c oxidase subunit III [Acheilognathus macropterus]
          Length = 261

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 39/196 (19%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  +++ S+ L F  FF  +                P  I   D  
Sbjct: 68  QGHHTPPVQKGLRYGMILFITSEVLFFLGFFWAFYHSSLAPTPELGGCWPPTGIITLDPF 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +    + +  L +T   G+ F  ++  E+      
Sbjct: 128 EVPLLNTAVLLASGVTVTWAHHSIMEGERKQAIQSLALTILLGLYFTALQAMEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V +++ ++    S +       + +WHF
Sbjct: 185 PFTIADGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQIQYHFTSEHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|33320886|gb|AAQ06168.1| cytochrome oxidase subunit III [Sus scrofa]
          Length = 278

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 82/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               + V   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTSVVQKGLRYGMILFIISEALFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +LL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSILLASGVSITWAHHSLMEGDRKH-MIQALSITIALGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V +++ LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|207559805|gb|ACI24412.1| cytochrome c oxidase subunit 3 [Hemitragus jayakari]
          Length = 261

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 76/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I+  +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGINPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRNHMLQALFITITLGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|62184361|ref|YP_220712.1| cytochrome c oxidase subunit III [Balaenoptera bonaerensis]
 gi|62086573|dbj|BAD91674.1| cytochrome c oxidase subunit III [Balaenoptera bonaerensis]
          Length = 261

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 80/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIVSEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIRPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MLQALFITIALGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +K    S +       + +WH
Sbjct: 184 APFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFLRQVKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|62184319|ref|YP_220751.1| cytochrome c oxidase subunit III [Balaenoptera borealis]
 gi|62086629|dbj|BAD91726.1| cytochrome c oxidase subunit III [Balaenoptera borealis]
 gi|289474201|gb|ADC97750.1| cytochrome c oxidase subunit III [Megaptera novaeangliae]
 gi|289474203|gb|ADC97751.1| cytochrome c oxidase subunit III [Megaptera novaeangliae]
          Length = 261

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 80/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIVSEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MLQALFITIALGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +K    S +       + +WH
Sbjct: 184 APFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFLRQVKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|38707499|ref|NP_944652.1| cytochrome c oxidase subunit III [Balaenoptera acutorostrata]
 gi|38602466|emb|CAD87929.1| cytochrome c oxidase polypeptide III [Balaenoptera acutorostrata]
 gi|62086601|dbj|BAD91700.1| cytochrome c oxidase subunit III [Balaenoptera acutorostrata]
 gi|90265655|dbj|BAE91872.1| cytochrome c oxidase subunit III [Balaenoptera brydei]
          Length = 261

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 80/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIVSEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIRPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MLQALFITIALGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +K    S +       + +WH
Sbjct: 184 APFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFLRQVKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|326536083|ref|YP_004300514.1| cytochrome c oxidase subunit III [Odocoileus virginianus]
 gi|309399259|gb|ADO78894.1| cytochrome c oxidase subunit III [Odocoileus virginianus]
          Length = 261

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNPMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKYHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|116733702|gb|ABK19908.1| cytochrome oxidase subunit 3 [Ichthyomyzon castaneus]
          Length = 261

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 43/195 (22%), Positives = 83/195 (42%), Gaps = 9/195 (4%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYA----AGPAPIDVFDISG 73
              +     G   G  ++++S+   FA FF  +  A L   +       P  I+  +   
Sbjct: 69  GHHTSPVQQGLRYGMILFIISEVCFFAGFFWAFYHASLAPTHELGLTWPPTGINPLNPFE 128

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           + +    +LL+S         S T++   +T   L +T   G+ F  ++I E+       
Sbjct: 129 VPLLNTAVLLASGVSVTWAHHSITEKNRMETTQALTMTILLGLYFTALQIMEYH---ETP 185

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
                S + S+FF   G HGLHV  G ++L   +++  +    S +       + +WHF+
Sbjct: 186 FTMADSVYGSTFFVATGFHGLHVIIGSMFLLTCLMRHTQYHFTSKHHFGFEAAAWYWHFV 245

Query: 194 DLIWICVFSFVYLMG 208
           D++W+ ++  +Y  G
Sbjct: 246 DVVWLFLYISIYWWG 260


>gi|315500562|ref|YP_004089364.1| cytochrome o ubiquinol oxidase, subunit III [Asticcacaulis
           excentricus CB 48]
 gi|315418574|gb|ADU15213.1| cytochrome o ubiquinol oxidase, subunit III [Asticcacaulis
           excentricus CB 48]
          Length = 225

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 93/178 (52%), Positives = 122/178 (68%), Gaps = 1/178 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWIYLMSDCL+FA  F TYAVL    A GP   ++FD+  + + T +LLLSSL+   +
Sbjct: 48  LGFWIYLMSDCLIFATLFATYAVLKDATAGGPNGRELFDLGFVAIETSLLLLSSLTFGLS 107

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           M++      ++  + WL VT   G+ F+ ME+YEF HLI   A P RSAFLS+FF LVG 
Sbjct: 108 MISMQ-NNKLNGVLGWLAVTGLLGLGFMGMELYEFNHLIHEGAGPDRSAFLSAFFTLVGT 166

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           HGLHV  GLIW+ V+ + + ++GL   N+ R++ LS+FWHFLD+IWI VFS VYLMG 
Sbjct: 167 HGLHVTSGLIWMGVMFVHLFRRGLTPANRIRMMELSLFWHFLDIIWIGVFSIVYLMGA 224


>gi|295096782|emb|CBK85872.1| cytochrome bo3 quinol oxidase subunit 3 [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 204

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 99/179 (55%), Positives = 123/179 (68%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
            GFWIYLMSDC++F   F TYAVL    A GP   D+F++  + V T +LL SS++   A
Sbjct: 27  FGFWIYLMSDCILFCCLFATYAVLVNGTAGGPTGKDIFELPFVLVETALLLFSSITYGMA 86

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
            +A   K    + VSWL +T  FG  FI MEIYEF HLI     P RS FLS+FFALVG 
Sbjct: 87  AIA-MYKNNKSQVVSWLALTWLFGAGFIGMEIYEFHHLIMEGFGPDRSGFLSAFFALVGT 145

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HGLHV  GLIW+ VL+ QI ++GL S N+ R++CLS+FWHFLD++WICVFS VYLMG +
Sbjct: 146 HGLHVTSGLIWMAVLMFQISRRGLTSTNRTRIMCLSLFWHFLDVVWICVFSVVYLMGAM 204


>gi|283850556|ref|ZP_06367844.1| cytochrome o ubiquinol oxidase, subunit III [Desulfovibrio sp.
           FW1012B]
 gi|283574127|gb|EFC22099.1| cytochrome o ubiquinol oxidase, subunit III [Desulfovibrio sp.
           FW1012B]
          Length = 205

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 86/179 (48%), Positives = 113/179 (63%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
            GFW+YLMSD ++F+  F TY VL  NYA GP   ++F + G  + TI+LL SS +   A
Sbjct: 27  FGFWLYLMSDLILFSGLFATYVVLSHNYAGGPTGKELFHLPGALLETILLLCSSAAYGLA 86

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
            +A    R     ++ L  T   G+ F+ ME  EF  +I   A PQRS FLS+FF LVG 
Sbjct: 87  TVAMHKGR-KDLLLAGLGATFLLGLGFLAMEAAEFRQMILDGAGPQRSGFLSAFFTLVGT 145

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  GL+WL V++ Q+  KGL +  Q RL+ L MFWHFLD++WI +FS VYLMGV+
Sbjct: 146 HGAHVACGLVWLVVMMGQVAAKGLTTPVQGRLMRLGMFWHFLDIVWIGLFSVVYLMGVM 204


>gi|37719399|gb|AAR01786.1| cytochrome c oxidase subunit III [Sus scrofa]
          Length = 261

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 82/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               + V   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTSVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +LL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EAPLLNTSILLASGVSITWAHHSLMEGDRKH-MIQALSITIALGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V +++ LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVTIGSTFLAVCLLRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|71009449|dbj|BAE11843.1| cytochrome oxydase subunit III [Homo sapiens]
 gi|298367942|gb|ADI80101.1| cytochrome c oxidase subunit III [Homo sapiens]
 gi|302377328|gb|ADL31577.1| cytochrome c oxidase subunit III [Homo sapiens]
          Length = 261

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 42/201 (20%), Positives = 82/201 (40%), Gaps = 15/201 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPID 67
                 +     G   G  +++ S+   FA F   +                  G  P++
Sbjct: 66  TYQGHHTPPVQKGLRYGMILFITSEVFFFAGFLWAFYHSSLAPTPQLGGHWPPTGITPLN 125

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
             ++    ++T VLL S +S ++A  +       ++ +  LL+T   G+ F +++  E+ 
Sbjct: 126 PLEVP--LLNTSVLLASGVSITWAHHSLMENN-RNQMIQALLITILLGLYFTLLQASEY- 181

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
                        + S+FF   G HGLHV  G  +L +  I+ L     S +       +
Sbjct: 182 --FESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKHHFGFEAAA 239

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ ++  +Y  G
Sbjct: 240 WYWHFVDVVWLFLYVSIYWWG 260


>gi|9653266|ref|NP_062473.1| cytochrome c oxidase subunit III [Physeter catodon]
 gi|9368969|emb|CAB98276.1| cytochrome oxidase subunit III [Physeter catodon]
          Length = 261

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/196 (19%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   D  
Sbjct: 68  QGHHTPTVQKGLRYGMVLFILSEILFFTGFFWAFYHSSLAPTPELGGCWPPTGICPLDPF 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +    + +  L +T   G+ F +++  E+      
Sbjct: 128 KVPLLNTSVLLASGVSITWAHHSLMQGDRKQMLQALFITIALGLYFTLLQASEY---YET 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V  ++ +K      +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLTVCFLRQMKFHFTPNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|299825754|ref|YP_003734683.1| cytochrome c oxidase subunit III [Lethenteron reissneri]
 gi|298103879|dbj|BAJ09376.1| cytochrome oxidase subunit III [Lethenteron reissneri]
          Length = 261

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 44/198 (22%), Positives = 85/198 (42%), Gaps = 15/198 (7%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPIDVFD 70
              +     G   G  ++++S+   FA FF  +                  G  P++ F+
Sbjct: 69  GHHTSPVQQGLRYGMILFIISEVCFFAGFFWAFYHASLAPTLELGLTWPPTGITPLNPFE 128

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
           +    ++T VLL S +S ++A  +   K     T   L +T   G+ F  ++  E+    
Sbjct: 129 VP--LLNTAVLLASGVSVTWAHHSITEKNRTEAT-QALALTVLLGLYFTALQAMEY---Y 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S+FF   G HGLHV  G ++L   +++ ++    S +       + +W
Sbjct: 183 ETPFTMADSVYGSTFFVATGFHGLHVIIGSLFLLTCLMRHMQYHFTSKHHFGFEAAAWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  +Y  G
Sbjct: 243 HFVDVVWLFLYISIYWWG 260


>gi|62184487|ref|YP_220738.1| cytochrome c oxidase subunit III [Balaenoptera brydei]
 gi|62086615|dbj|BAD91713.1| cytochrome c oxidase subunit III [Balaenoptera brydei]
          Length = 261

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 80/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIRPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MLQALFITIALGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +K    S +       + +WH
Sbjct: 184 APFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFLRQVKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|145315603|gb|ABP63151.1| cytochrome c oxidase subunit III [Sus scrofa]
          Length = 261

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 82/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               + V   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTSVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIRPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +LL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSILLASGVSITWAHHSLMEGDRKH-MIQALSITIALGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V +++ LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|239826488|ref|YP_002949112.1| cytochrome C oxidase subunit III [Geobacillus sp. WCH70]
 gi|239806781|gb|ACS23846.1| cytochrome c oxidase subunit III [Geobacillus sp. WCH70]
          Length = 206

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 68/187 (36%), Positives = 109/187 (58%), Gaps = 1/187 (0%)

Query: 24  CVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLL 83
            ++    +LG W++L  + ++FA  F T+  L    A GP   ++F +  +FV+T++LL 
Sbjct: 20  TIEGKNKFLGLWVFLGGETVLFASLFGTFIALRDKTAGGPTSQELFHLPLVFVATMLLLT 79

Query: 84  SSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLS 143
           SSL+  +A+          K + W  +T   G+ F+ +EIYEF   +        SAF S
Sbjct: 80  SSLTSVYAIYHMKNFDFK-KMMLWFGITVLLGLCFLGLEIYEFYEYVHKGLKFSTSAFSS 138

Query: 144 SFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           +F+ LVGLHG HV FGL W+  L+I+  K+GL   N  +    S++WHF+D++W+ +F+ 
Sbjct: 139 AFYTLVGLHGSHVAFGLSWILTLMIRNAKRGLNLYNAPKFYVASLYWHFIDVVWVFIFTV 198

Query: 204 VYLMGVV 210
           VYLMG+V
Sbjct: 199 VYLMGMV 205


>gi|251829656|gb|ACT21209.1| cytochrome c oxidase subunit III [Sus scrofa]
          Length = 261

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 82/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               + V   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTSVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +LL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSILLASGVSITWAHHSLMEGDRKH-MIQALSITIALGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V +++ LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|312233370|ref|YP_004021581.1| cytochrome c oxidase subunit III [Sus scrofa taiwanensis]
 gi|45826218|gb|AAS77736.1| cytochrome c oxidase subunit 3 [Sus scrofa]
 gi|76262528|gb|ABA41416.1| cytochrome c oxidase subunit 3 [Sus scrofa]
 gi|76262556|gb|ABA41442.1| cytochrome c oxidase subunit 3 [Sus scrofa]
 gi|78499541|gb|ABB45794.1| cytochrome c oxidase subunit 3 [Sus scrofa]
 gi|95116711|gb|ABF56566.1| cytochrome c oxidase subunit III [Sus scrofa]
 gi|118135680|gb|ABK62691.1| cytochrome oxidase subunit III [Sus scrofa]
 gi|125213069|dbj|BAF46409.1| cytochrome c oxidase subunit III [Sus scrofa]
 gi|145315435|gb|ABP62995.1| cytochrome c oxidase subunit III [Sus scrofa]
 gi|145315449|gb|ABP63008.1| cytochrome c oxidase subunit III [Sus scrofa]
 gi|145315477|gb|ABP63034.1| cytochrome c oxidase subunit III [Sus scrofa]
 gi|145315491|gb|ABP63047.1| cytochrome c oxidase subunit III [Sus scrofa]
 gi|145315519|gb|ABP63073.1| cytochrome c oxidase subunit III [Sus scrofa]
 gi|145315533|gb|ABP63086.1| cytochrome c oxidase subunit III [Sus scrofa]
 gi|145315547|gb|ABP63099.1| cytochrome c oxidase subunit III [Sus scrofa]
 gi|145315561|gb|ABP63112.1| cytochrome c oxidase subunit III [Sus scrofa]
 gi|145315575|gb|ABP63125.1| cytochrome c oxidase subunit III [Sus scrofa]
 gi|145315589|gb|ABP63138.1| cytochrome c oxidase subunit III [Sus scrofa]
 gi|145315631|gb|ABP63177.1| cytochrome c oxidase subunit III [Sus scrofa]
 gi|145315645|gb|ABP63190.1| cytochrome c oxidase subunit III [Sus scrofa]
 gi|145315659|gb|ABP63203.1| cytochrome c oxidase subunit III [Sus scrofa]
 gi|145315673|gb|ABP63216.1| cytochrome c oxidase subunit III [Sus scrofa]
 gi|145315687|gb|ABP63229.1| cytochrome c oxidase subunit III [Sus scrofa]
 gi|145315701|gb|ABP63242.1| cytochrome c oxidase subunit III [Sus scrofa]
 gi|145315715|gb|ABP63255.1| cytochrome c oxidase subunit III [Sus scrofa]
 gi|145315729|gb|ABP63268.1| cytochrome c oxidase subunit III [Sus scrofa]
 gi|145315743|gb|ABP63281.1| cytochrome c oxidase subunit III [Sus scrofa]
 gi|145315757|gb|ABP63294.1| cytochrome c oxidase subunit III [Sus scrofa]
 gi|145315771|gb|ABP63307.1| cytochrome c oxidase subunit III [Sus scrofa]
 gi|145315783|gb|ABP63318.1| cytochrome c oxidase subunit III [Sus scrofa]
 gi|145315797|gb|ABP63331.1| cytochrome c oxidase subunit III [Sus scrofa]
 gi|157056542|gb|ABV02173.1| cytochrome c oxidase subunit 3 [Sus scrofa]
 gi|159162013|gb|ABM92887.2| cytochrome c oxidase subunit III [Sus scrofa]
 gi|225580660|gb|ABE02595.2| cytochrome c oxidase subunit III [Sus scrofa]
 gi|238625889|gb|ACR48215.1| cytochrome c oxidase subunit III [Sus scrofa]
 gi|269812091|gb|ACZ44403.1| cytochrome c oxidase subunit III [Sus scrofa taiwanensis]
          Length = 261

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 82/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               + V   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTSVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +LL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSILLASGVSITWAHHSLMEGDRKH-MIQALSITIALGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V +++ LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|207559861|gb|ACI24464.1| cytochrome c oxidase subunit 3 [Capra nubiana]
          Length = 261

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 74/196 (37%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G  F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRNHMLQALFITITLGXYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|12667712|ref|NP_075401.1| cytochrome c oxidase subunit III [Thryonomys swinderianus]
 gi|12657503|emb|CAC27805.1| cytochrome oxidase subunit III [Thryonomys swinderianus]
          Length = 261

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 45/197 (22%), Positives = 84/197 (42%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               + +   G   G  ++++S+ L F+ FF  +  + L      G              
Sbjct: 68  QGHHTSIVQKGLRYGMILFIISEVLFFSGFFWAFYHSSLAPTPELGGHWPPTGINPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  LL+T   G+ F I+++ E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MIQALLITIILGIYFTILQMSEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V +++ L     S +       + +WH
Sbjct: 184 SSFTISDGIYGSTFFVATGFHGLHVIIGTTFLTVCLLRQLYYHFTSSHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|319784696|ref|YP_004144172.1| cytochrome C oxidase subunit III [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170584|gb|ADV14122.1| cytochrome c oxidase subunit III [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 293

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 45/208 (21%), Positives = 87/208 (41%), Gaps = 17/208 (8%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA-----------VLGKNY---AAG 62
             +   + V       G  +++ S+ + F  +F  Y                 +      
Sbjct: 82  AHEGHHTRVVSLHLRYGMIMFIASEVMFFVAWFWAYFDASLFAGEAQNYARATFTGGVWP 141

Query: 63  PAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIME 122
           P  ++V D   + +   V+LL S +       S         ++ L++T   GM+F +++
Sbjct: 142 PKGMEVLDPFHLPLYNTVILLLSGTTVTWAHHSLLHGDRKGLINGLVLTVGLGMLFTMVQ 201

Query: 123 IYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRR 182
            YE+ H        + S + ++FF   G HG HV  G I+L V +I+ +K          
Sbjct: 202 AYEYMH---APFAFKDSIYGATFFMATGFHGFHVIIGTIFLLVCLIRAMKGDFTPKQHFG 258

Query: 183 LICLSMFWHFLDLIWICVFSFVYLMGVV 210
               + +WHF+D++W+ +F+ +Y+ G V
Sbjct: 259 FEAAAWYWHFVDVVWLFLFASIYVWGSV 286


>gi|76262542|gb|ABA41429.1| cytochrome c oxidase subunit 3 [Sus scrofa]
          Length = 261

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 82/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               + V   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTSVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +LL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSILLASGVSITWAHHSLMEGDRKH-MIQALSITIALGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V +++ LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|80972999|gb|ABB53230.1| cytochrome c oxidase subunit 3 [Sus scrofa]
 gi|83779152|gb|ABC47395.1| cytochrome c oxidase subunit 3 [Sus scrofa]
          Length = 261

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 82/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               + V   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTSVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +LL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSILLASGVSITWAHHSLMEGDRKH-MIQALSITIALGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V +++ LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVTIGSTFLAVCLLRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|5921881|sp|O47697|COX3_RAPME RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2731902|gb|AAB93601.1| cytochrome oxidase subunit III [Raphicerus melanotis]
          Length = 261

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRYPMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|215399174|ref|YP_002332302.1| cytochrome c oxidase subunit III [Podarcis siculus]
 gi|62900874|gb|AAY18762.1| cytochrome c oxidase subunit III [Podarcis siculus]
 gi|213983309|gb|ACJ54991.1| cytochrome c oxidase subunit III [Podarcis siculus]
          Length = 261

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 42/199 (21%), Positives = 80/199 (40%), Gaps = 11/199 (5%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG- 73
                 +     G   G  +++ S+ L FA FF  +  + L      G            
Sbjct: 66  TYQGHHTMPVQKGLRYGMILFITSEVLFFAGFFWAFYHSSLAPTPELGGQWPPTGIFPLN 125

Query: 74  ----IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
                 ++T VLL S ++ ++A  A    +    T+  L +T   G+ F  ++  E+   
Sbjct: 126 AFEVPLLNTAVLLASGVTVTWAHHALMEGK-RTDTIQALSLTILLGLYFTFLQATEYH-- 182

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                    S + ++FF   G HGLHV  G  +L + +I+       + +       + +
Sbjct: 183 -ETSFTISDSVYGATFFVATGFHGLHVIIGSTFLAICLIRQSLFHFTTNHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYVSIYWWG 260


>gi|5921869|sp|O47705|COX3_GAZRU RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2731922|gb|AAB93611.1| cytochrome oxidase subunit III [Eudorcas rufifrons]
          Length = 261

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPNVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|158423724|ref|YP_001525016.1| cytochrome o ubiquinol oxidase subunit III [Azorhizobium
           caulinodans ORS 571]
 gi|158330613|dbj|BAF88098.1| cytochrome o ubiquinol oxidase subunit III [Azorhizobium
           caulinodans ORS 571]
          Length = 208

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 108/191 (56%), Positives = 142/191 (74%), Gaps = 1/191 (0%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTI 79
            + +  +   T LGFWIYLMSDCL+FA+ F T+ VLG NYAAGP P D+FD+  + V+T 
Sbjct: 18  DEHAHPEGHSTALGFWIYLMSDCLIFAMLFATFGVLGGNYAAGPGPKDLFDLKLVAVNTA 77

Query: 80  VLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS 139
           +LL SS++  FAMLA    R   +   WL +TA FG+ F+ +E+YEF H+I   A PQRS
Sbjct: 78  MLLFSSITYGFAMLAMEKGRQS-QVQLWLAITALFGLAFLSIELYEFHHMIHEGAGPQRS 136

Query: 140 AFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWIC 199
           AFLS+FF LVG HG+HV FGLIWL  +++Q+ + GLI+ N+RRL+CLSMFWHFLD+IWI 
Sbjct: 137 AFLSAFFTLVGTHGVHVTFGLIWLVTMMVQVGRFGLITANRRRLMCLSMFWHFLDVIWIG 196

Query: 200 VFSFVYLMGVV 210
           VF+FVYLMG++
Sbjct: 197 VFTFVYLMGML 207


>gi|84488601|ref|YP_448939.1| cytochrome c oxidase subunit III [Rangifer tarandus]
 gi|84095024|dbj|BAE66693.1| cytochrome c oxidase subunit 3 [Rangifer tarandus]
          Length = 261

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNPMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKYHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|38707513|ref|NP_944613.1| cytochrome c oxidase subunit III [Balaena mysticetus]
 gi|38602424|emb|CAD87890.1| cytochrome c oxidase polypeptide III [Balaena mysticetus]
 gi|62086657|dbj|BAD91752.1| cytochrome c oxidase subunit III [Balaena mysticetus]
          Length = 261

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 80/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MLQALFITIALGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +K    S +       + +WH
Sbjct: 184 APFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFLRQMKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|5921880|sp|O47696|COX3_RAPCA RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2731900|gb|AAB93600.1| cytochrome oxidase subunit III [Raphicerus campestris]
          Length = 261

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRYPMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|121582442|ref|YP_980171.1| cytochrome c oxidase subunit III [Takydromus tachydromoides]
 gi|121309340|dbj|BAF43959.1| cytochrome oxidase subunit 3 [Takydromus tachydromoides]
          Length = 261

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 43/199 (21%), Positives = 82/199 (41%), Gaps = 11/199 (5%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG- 73
                 +     G  LG  +++ S+ L F  FF  +  + L      G     +      
Sbjct: 66  TYQGHHTLSVQKGLRLGMILFITSEILFFMGFFWAFYHSSLAPTPELGSQWPPMGIQPLN 125

Query: 74  ----IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
                 ++T VLL S ++ ++A  A    +    T+  L +T F G+ F  ++  E+   
Sbjct: 126 AFEVPLLNTAVLLASGVTVTWAHHALMEGQ-RKATIQALTLTIFLGLYFTALQATEY--- 181

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                    S + ++FF   G HGLHV  G  +L + +I+       + +       + +
Sbjct: 182 YETSFSISDSVYGATFFVATGFHGLHVIIGSTFLLICLIRQALYHFTTNHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYVSIYWWG 260


>gi|294012086|ref|YP_003545546.1| cytochrome o ubiquinol oxidase subunit III [Sphingobium japonicum
           UT26S]
 gi|292675416|dbj|BAI96934.1| cytochrome o ubiquinol oxidase subunit III [Sphingobium japonicum
           UT26S]
          Length = 200

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 114/195 (58%), Positives = 140/195 (71%), Gaps = 1/195 (0%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF 75
           Y   ++    +   T LGFW+YLMSDCL+FA+ F TYAVLG +YA GP P D+FD+  I 
Sbjct: 6   YHLAEEPHLHEGHSTMLGFWMYLMSDCLIFAILFATYAVLGGSYAGGPGPKDLFDLPLIA 65

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           ++T +LL SS++  FAMLA    R +  T  WL VT  FG  F+ +E+YEF+HLI   A 
Sbjct: 66  LNTAMLLFSSITYGFAMLAMEKNR-VSATQGWLFVTLLFGGAFLFIELYEFSHLIHEGAG 124

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           P RSAFLSSFF LVG HGLHV FG IWL  L+ Q+ KKGLI  N+RRL+CLSMFWHFLD+
Sbjct: 125 PWRSAFLSSFFTLVGTHGLHVTFGSIWLVTLMAQVAKKGLIPANKRRLLCLSMFWHFLDV 184

Query: 196 IWICVFSFVYLMGVV 210
           IWI VF+FVYLMGV+
Sbjct: 185 IWIGVFTFVYLMGVL 199


>gi|219524208|ref|YP_002456352.1| cytochrome coxidase subunit III [Hydropotes inermis]
 gi|161824385|gb|ABX79760.1| cytochrome coxidase subunit III [Hydropotes inermis]
          Length = 261

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSKHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|11055650|gb|AAG28196.1|AF304201_7 COIII [Sus scrofa]
          Length = 267

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 82/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               + V   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTLVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +LL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSILLASGVSITWAHHSLMEGDRKH-MIQALSITIALGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V +++ LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|164421063|ref|YP_001648429.1| cytochrome c oxidase subunit III [Odontobutis platycephala]
 gi|62902038|gb|AAY18977.1| cytochrome c oxidase subunit III [Odontobutis platycephala]
          Length = 261

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 77/196 (39%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  +++ S+  +F  FF  +                PA I   D  
Sbjct: 68  QGHHTPPVQKGLRYGMILFITSEVFLFVGFFWAFYHSSLAPSPELGGCWPPAGILALDPF 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
           G+ +    +LL+S         S  +    + +  L +T   G  F +++  E+      
Sbjct: 128 GVPLLNTAVLLASGVTVTWAHHSIMENERKQAIHSLTLTILLGFYFTLLQAMEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V +++ ++    S +       + +WHF
Sbjct: 185 PFTIADGVYGSTFFVATGFHGLHVIIGSTFLSVCLLRQIRYHFTSEHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYISIYWWG 260


>gi|62184417|ref|YP_220764.1| cytochrome c oxidase subunit III [Eubalaena australis]
 gi|62184543|ref|YP_220777.1| cytochrome c oxidase subunit III [Eubalaena japonica]
 gi|62086671|dbj|BAD91765.1| cytochrome c oxidase subunit III [Eubalaena australis]
 gi|62086685|dbj|BAD91778.1| cytochrome c oxidase subunit III [Eubalaena japonica]
          Length = 261

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 80/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MLQALFITITLGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +K    S +       + +WH
Sbjct: 184 APFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFLRQMKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|45826176|gb|AAS77697.1| cytochrome c oxidase subunit 3 [Sus scrofa]
          Length = 261

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 82/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               + V   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTSVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +LL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSILLASGVSITWAHHSLMEGDRKH-MIQALSITIALGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V +++ LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|94309895|ref|YP_583105.1| cytochrome c oxidase subunit III [Cupriavidus metallidurans CH34]
 gi|93353747|gb|ABF07836.1| cytochrome o ubiquinol oxidase subunit III [Cupriavidus
           metallidurans CH34]
          Length = 214

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 92/183 (50%), Positives = 122/183 (66%), Gaps = 1/183 (0%)

Query: 28  DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
           + T  GFW+YLMSDC++FA  F  +AVL    A GP+  ++F+++ + V T +LL SS++
Sbjct: 33  ENTVFGFWLYLMSDCILFACLFAAFAVLRGEVAGGPSGKEIFELNYVLVETAILLFSSIT 92

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
             FA + S       + + WL VT   G  F+ MEI EFAHLI   A P RSAFLSSFF 
Sbjct: 93  YGFA-MVSMQNHQKGRVMFWLGVTFLLGAAFMGMEINEFAHLIHEGAGPSRSAFLSSFFT 151

Query: 148 LVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           LVG HGLHV  G++W+ VL+ Q+ KKGL     +RL CLS+FWHFLD++WI VF+ VYLM
Sbjct: 152 LVGTHGLHVASGMLWMLVLMWQLSKKGLTPVVAKRLNCLSLFWHFLDVVWIGVFTVVYLM 211

Query: 208 GVV 210
           G +
Sbjct: 212 GAM 214


>gi|5921884|sp|O47690|COX3_SYNCA RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2707253|gb|AAB92241.1| cytochrome oxidase subunit III [Syncerus caffer]
          Length = 261

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 41/196 (20%), Positives = 76/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               + V   G   G  ++++S+ L F  FF  +                P  I+  +  
Sbjct: 68  QGHHTPVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGINPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +      +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRSHMLQALFITITLGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|294143096|ref|YP_003559074.1| cytochrome o ubiquinol oxidase subunit III [Shewanella violacea
           DSS12]
 gi|7657997|dbj|BAA94866.1| quinol oxidase sybunit IV [Shewanella violacea]
 gi|293329565|dbj|BAJ04296.1| cytochrome o ubiquinol oxidase, subunit III [Shewanella violacea
           DSS12]
          Length = 207

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 92/207 (44%), Positives = 136/207 (65%), Gaps = 2/207 (0%)

Query: 5   KIGKSPNFSLFYVKDKKESCVDHDG-TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGP 63
            I    +  +    +  +   D  G T  GFW+YLM+DC++FA  F TYAVL  N   G 
Sbjct: 2   SIAIRADLEVVQADEHHDEHHDTSGNTLFGFWLYLMTDCILFASVFATYAVLYMNTDGGV 61

Query: 64  APIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEI 123
           +  D+F+++ + + T VLL+SS++  FA++ +   +    T+ WLL+T   G  FI ME+
Sbjct: 62  SGKDIFELNFVAIETAVLLISSITFGFALICAK-HQKRTATLIWLLITFALGCGFISMEV 120

Query: 124 YEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRL 183
           YEF HLI     PQRSAFL++FF LVG+HGLHV  GLIW+ ++++++ K GL + +  RL
Sbjct: 121 YEFYHLIEQGNGPQRSAFLTAFFTLVGMHGLHVTAGLIWMAIMMLEVTKSGLNNRSITRL 180

Query: 184 ICLSMFWHFLDLIWICVFSFVYLMGVV 210
            CLS+FWHFLD++WICVF+ VYL+G++
Sbjct: 181 GCLSLFWHFLDVVWICVFTLVYLLGML 207


>gi|5921871|sp|O48316|COX3_GAZSU RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2731932|gb|AAB93616.1| cytochrome oxidase subunit III [Gazella subgutturosa]
 gi|2731934|gb|AAB93617.1| cytochrome oxidase subunit III [Gazella subgutturosa]
          Length = 261

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 76/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I+  +  
Sbjct: 68  QGHHTPNVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGINPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|5921868|sp|O47709|COX3_GAZLE RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2731930|gb|AAB93615.1| cytochrome oxidase subunit III [Gazella leptoceros]
          Length = 261

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 76/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I+  +  
Sbjct: 68  QGHHTPNVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGINPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|260460300|ref|ZP_05808552.1| Cytochrome-c oxidase [Mesorhizobium opportunistum WSM2075]
 gi|259033945|gb|EEW35204.1| Cytochrome-c oxidase [Mesorhizobium opportunistum WSM2075]
          Length = 292

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 45/208 (21%), Positives = 86/208 (41%), Gaps = 17/208 (8%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG--------------KNYAAG 62
             +   + V       G  +++ S+ + F  +F  Y                        
Sbjct: 81  AHEGHHTRVVSLHLRYGMIMFIASEVMFFVAWFWAYFDASLFAGEAQNYARHAFTGGVWP 140

Query: 63  PAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIME 122
           P  ++V D   + +   V+LL S +       S         ++ L++T   GM+F +++
Sbjct: 141 PKGMEVLDPFHLPLYNTVILLLSGTTVTWAHHSLIHGDRKGLINGLVLTVGLGMLFTMVQ 200

Query: 123 IYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRR 182
            YE+ H        + S + ++FF   G HG HV  G I+L V +I+ +K          
Sbjct: 201 AYEYMH---APFGFKDSIYGATFFMATGFHGFHVIIGTIFLLVCLIRAMKGDFTPKQHFG 257

Query: 183 LICLSMFWHFLDLIWICVFSFVYLMGVV 210
               + +WHF+D++W+ +F+ +Y+ G V
Sbjct: 258 FEAAAWYWHFVDVVWLFLFASIYVWGSV 285


>gi|33334126|gb|AAQ12184.1| cytochrome c oxidase subunit III [Bubalus bubalis]
 gi|44894102|gb|AAS48604.1| cytochrome c oxidase subunit III [Bubalus bubalis]
          Length = 260

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 76/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I+  +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGINPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITITLGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|9801577|ref|NP_063907.1| cytochrome c oxidase subunit III [Lama pacos]
 gi|9558350|emb|CAC00508.1| COIII [Lama pacos]
          Length = 261

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 41/196 (20%), Positives = 77/196 (39%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F+ FF  +                P  I   +  
Sbjct: 68  QGHHTPSVQKGLRYGMVLFIVSEVLFFSGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +      +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRTHMLQALFITIALGLYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                 S + S+FF   G HGLHV  G  +L V  ++ LK    S +       + +WHF
Sbjct: 185 PFTIPDSVYGSTFFVATGFHGLHVIIGSTFLAVCFLRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|2707237|gb|AAB92233.1| cytochrome oxidase subunit III [Tragelaphus angasii]
          Length = 261

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIVSEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|213023463|ref|ZP_03337910.1| cytochrome o ubiquinol oxidase subunit III [Salmonella enterica
           subsp. enterica serovar Typhi str. 404ty]
          Length = 186

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 95/186 (51%), Positives = 125/186 (67%), Gaps = 1/186 (0%)

Query: 25  VDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLS 84
                   GFW+YLMSDC++F++ F TYAVL    A GP   D+F++  + V T +LL S
Sbjct: 2   TQARNKIFGFWVYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFS 61

Query: 85  SLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSS 144
           S++   A +A        + +SWL +T  FG  FI MEIYEF HLI     P RS FLS+
Sbjct: 62  SITYGMAAIAMHKNN-KSQVISWLALTFLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSA 120

Query: 145 FFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFV 204
           FFALVG HGLHV  GLIW+ VL++Q+ ++GL S N+ R++CLS+FWHFLD+IWICVF+ V
Sbjct: 121 FFALVGTHGLHVTSGLIWMAVLMVQVARRGLTSTNRTRIMCLSLFWHFLDVIWICVFTVV 180

Query: 205 YLMGVV 210
           YLMG +
Sbjct: 181 YLMGAM 186


>gi|90265627|dbj|BAE91846.1| cytochrome c oxidase subunit III [Balaenoptera omurai]
          Length = 261

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 80/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIVSEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MLQALFITIALGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +K    S +       + +WH
Sbjct: 184 APFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFLRQVKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|6691429|ref|NP_033644.1|COX3_15157 cytochrome c oxidase subunit III [Lampetra fluviatilis]
 gi|6523336|emb|CAB62220.1| cytochrome oxidase subunit III [Lampetra fluviatilis]
          Length = 261

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 44/198 (22%), Positives = 85/198 (42%), Gaps = 15/198 (7%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPIDVFD 70
              +     G   G  ++++S+   FA FF  +                  G  P++ F+
Sbjct: 69  GHHTSPVQQGLRYGMILFIISEVCFFAGFFWAFYHASLAPTLELGLMWPPTGITPLNPFE 128

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
           +    ++T VLL S +S ++A  +   K     T   L +T   G+ F  ++  E+    
Sbjct: 129 VP--LLNTAVLLASGVSVTWAHHSITEKNRTEAT-QALALTVLLGLYFTALQAMEY---Y 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S+FF   G HGLHV  G ++L   +++ ++    S +       + +W
Sbjct: 183 ETPFTMADSVYGSTFFVATGFHGLHVIIGSLFLLTCLVRHMQYHFTSKHHFGFEAAAWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  +Y  G
Sbjct: 243 HFVDVVWLFLYISIYWWG 260


>gi|326386654|ref|ZP_08208276.1| cytochrome c oxidase, subunit III [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326208969|gb|EGD59764.1| cytochrome c oxidase, subunit III [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 274

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 39/204 (19%), Positives = 81/204 (39%), Gaps = 16/204 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA------------VLGKNYAAGPA 64
             +   + V       G  +++ S+ + F  +F  +             V+G  +     
Sbjct: 68  AHEGHHTPVVQLHQRYGMILFIASEVMFFVGWFWAFFDFSLFPSKIATDVIGGQWPPKAI 127

Query: 65  PIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIY 124
              +       ++T++LL S  + ++A  A             L  T   GM+F  ++ Y
Sbjct: 128 EAVMNTFDLPLLNTLILLCSGTTLTWAHHALI-HDNRKDLKRGLWATILLGMMFSSIQAY 186

Query: 125 EFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLI 184
           E+   +       ++ + S F+   G HG HV  G I+L V +++  +            
Sbjct: 187 EY---VHAPFAFGQNTYGSVFYMATGFHGFHVIVGTIFLIVCLVRAYRNDFTPRQHFGFE 243

Query: 185 CLSMFWHFLDLIWICVFSFVYLMG 208
             + +WHF+D++W+ +F  +Y+ G
Sbjct: 244 AAAWYWHFVDVVWLFLFVSIYVWG 267


>gi|254524322|ref|ZP_05136377.1| cytochrome o ubiquinol oxidase, subunit III [Stenotrophomonas sp.
           SKA14]
 gi|219721913|gb|EED40438.1| cytochrome o ubiquinol oxidase, subunit III [Stenotrophomonas sp.
           SKA14]
          Length = 211

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 90/185 (48%), Positives = 118/185 (63%), Gaps = 2/185 (1%)

Query: 26  DHDGTY-LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLS 84
           +  G    G W+YLMSD ++F   F +YAVL   YA GP   D+F +  +   T +LL+S
Sbjct: 27  EQGGMKVFGMWVYLMSDLVLFGSLFASYAVLSTAYAGGPTGKDLFSLPFVMAETFLLLVS 86

Query: 85  SLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSS 144
           S++   A+LA          + WL VT   G  FI MEIYEF+HLI   A P  SA+LS+
Sbjct: 87  SITYGQAVLAMHRHDAS-AVLRWLGVTFVLGASFIGMEIYEFSHLIHEGAGPSTSAYLSA 145

Query: 145 FFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFV 204
           FFALV  HGLHV  GLIW+ V++ Q+ ++GL   N  R+ CLS+FWHFLDL+WICVF+FV
Sbjct: 146 FFALVATHGLHVASGLIWMAVVMHQVYRRGLTPTNITRVSCLSLFWHFLDLVWICVFTFV 205

Query: 205 YLMGV 209
           YL+G 
Sbjct: 206 YLIGA 210


>gi|51339437|gb|AAU00479.1| cytochrome c oxidase subunit III [Mephitis mephitis]
          Length = 261

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 45/197 (22%), Positives = 82/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               + V   G   G  ++++S+ L FA FF  +  + L      G        +     
Sbjct: 68  QGHHTPVVQKGLRYGMILFILSEVLFFAGFFWAFYHSSLAPTPELGGCWPPTGIMPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  LL+T   G+ F  ++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MLQALLITISLGLYFTALQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L +  ++ L     S +       + +WH
Sbjct: 184 TSFTISDGIYGSTFFMATGFHGLHVIIGSTFLIICFLRQLNFHFTSSHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|5921885|sp|O47685|COX3_TRAIM RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2707243|gb|AAB92236.1| cytochrome oxidase subunit III [Tragelaphus imberbis]
          Length = 261

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRNHMLQALFITIALGIYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|91176195|ref|YP_537151.1| cytochrome c oxidase subunit III [Balaenoptera edeni]
 gi|90265641|dbj|BAE91859.1| cytochrome c oxidase subunit III [Balaenoptera edeni]
          Length = 261

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 80/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIVSEVLFFTGFFWAFYHSSLVPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MLQALFITIALGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +K    S +       + +WH
Sbjct: 184 APFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFLRQVKFHFTSSHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|38707527|ref|NP_944626.1| cytochrome c oxidase subunit III [Caperea marginata]
 gi|38602438|emb|CAD87903.1| cytochrome c oxidase polypeptide III [Caperea marginata]
 gi|62086699|dbj|BAD91791.1| cytochrome c oxidase subunit III [Caperea marginata]
          Length = 261

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 80/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MLQALFITIALGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +K    S +       + +WH
Sbjct: 184 APFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFMRQMKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|5921864|sp|O47693|COX3_CEPNA RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2731894|gb|AAB93597.1| cytochrome oxidase subunit III [Cephalophus natalensis]
          Length = 261

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|260426790|ref|ZP_05780769.1| cytOchrome o ubiquinol oxidase, subunit III [Citreicella sp. SE45]
 gi|260421282|gb|EEX14533.1| cytOchrome o ubiquinol oxidase, subunit III [Citreicella sp. SE45]
          Length = 219

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 110/202 (54%), Positives = 130/202 (64%), Gaps = 1/202 (0%)

Query: 6   IGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAP 65
           +   P           ++      T +GFWIYLMSDC++F   F TYAVLG NYA GPAP
Sbjct: 16  LADEPMHHARNNDAHHDAHAHSSPTPIGFWIYLMSDCIIFGALFATYAVLGGNYAGGPAP 75

Query: 66  IDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYE 125
            D+F+   + + T +LL SS++   AML +  K      + WL VTA FG  FI MEIYE
Sbjct: 76  KDLFEPGFVAIETALLLFSSITFGLAMLRA-DKDDRDGVLKWLAVTAVFGAGFIAMEIYE 134

Query: 126 FAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLIC 185
           F HLI + A P RSAFLSSFFALVG HGLHV  GLIWL  L++QI   GLI  N RRL  
Sbjct: 135 FNHLIHIGAGPDRSAFLSSFFALVGTHGLHVTGGLIWLVTLMVQIRMHGLIGENMRRLGT 194

Query: 186 LSMFWHFLDLIWICVFSFVYLM 207
           LSMFWHFLDL+WI VFSFVYL+
Sbjct: 195 LSMFWHFLDLVWIGVFSFVYLV 216


>gi|146310558|ref|YP_001175632.1| cytochrome o ubiquinol oxidase subunit III [Enterobacter sp. 638]
 gi|145317434|gb|ABP59581.1| cytochrome bo3 quinol oxidase subunit 3 [Enterobacter sp. 638]
          Length = 204

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 96/179 (53%), Positives = 124/179 (69%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
            GFWIYLMSDC++F   F TYAVL    A GP   D+F++  + V T +LL SS++   A
Sbjct: 27  FGFWIYLMSDCILFCCLFATYAVLVNGTAGGPTGKDIFELPFVLVETGLLLFSSITYGMA 86

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
            +A   K    + +SWL +T  FG  FI MEIYEF HLI+    P RS FLS+FFALVG 
Sbjct: 87  AIA-MYKNNKSQVISWLALTWLFGAGFIGMEIYEFHHLIAEGFGPDRSGFLSAFFALVGT 145

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HGLHV  GLIW+ VL+ Q+ ++GL + N+ R++CLS+FWHFLD++WICVFS VYLMG +
Sbjct: 146 HGLHVTSGLIWMAVLMFQVYRRGLTNTNRTRIMCLSLFWHFLDVVWICVFSVVYLMGAM 204


>gi|5835002|ref|NP_007062.1|COX3_10457 cytochrome c oxidase subunit III [Balaenoptera musculus]
 gi|729192|sp|P41295|COX3_BALMU RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|414133|emb|CAA51001.1| cytochrome oxidase subunit III [Balaenoptera musculus]
          Length = 261

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 80/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIVSEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MLQALFITIALGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +K    S +       + +WH
Sbjct: 184 APFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFLRQVKFHFTSNHHFGFERAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|5819108|ref|NP_006895.1|COX3_10014 cytochrome c oxidase subunit III [Balaenoptera physalus]
 gi|117054|sp|P24989|COX3_BALPH RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|12785|emb|CAA43453.1| cytochrome c oxidase subunit III [Balaenoptera physalus]
          Length = 261

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 80/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIVSEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIRPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MLQALFITIALGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +K    S +       + +WH
Sbjct: 184 APFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFLRQVKFHFTSNHHFGFERAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|49616781|ref|YP_044758.1| cytochrome c oxidase subunit III [Rena humilis]
 gi|49256937|dbj|BAD24743.1| cytochrome oxidase subunit 3 [Rena humilis]
          Length = 259

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 42/193 (21%), Positives = 78/193 (40%), Gaps = 9/193 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA------AGPAPIDVFDIS 72
               +         G  ++++S+ + F  FF     +    A        P  I   + +
Sbjct: 68  QGHHTPPVQKNLRYGMALFIISEVMFFTGFFWALFYVSVLPAPEIGGHWPPTGITPINPT 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
           G+ +    +LLSS +       +       +T   LL+T   G+ F  +++ E+      
Sbjct: 128 GVPLLNTAILLSSGATITWAHHAMKLGQKKETQMALLLTITLGLYFSFIQLSEYK---EA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S FF   G HGLHV  G  +L   +++I K  L + +       + +WHF
Sbjct: 185 PFTISDCIYGSVFFVATGFHGLHVIIGTTFLITCLLRIYKNHLTTKHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVY 205
           +D++W+ +F  VY
Sbjct: 245 VDVVWLFLFISVY 257


>gi|212709188|ref|ZP_03317316.1| hypothetical protein PROVALCAL_00221 [Providencia alcalifaciens DSM
           30120]
 gi|212688100|gb|EEB47628.1| hypothetical protein PROVALCAL_00221 [Providencia alcalifaciens DSM
           30120]
          Length = 204

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 87/195 (44%), Positives = 123/195 (63%), Gaps = 1/195 (0%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF 75
               +            GFWIYLMSD ++FA  F TY VL    A GPA  D+F +  + 
Sbjct: 11  VAHAEHGHHDAGATKVFGFWIYLMSDLILFASLFATYVVLSDGTAGGPAGRDIFSLQFVL 70

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
             T +LL SS++  FAM+A   ++ +     WL +T  FG+ F++ME+YEF  LI+    
Sbjct: 71  GETFLLLFSSITYGFAMIAMHKEK-VAAVNLWLFITFLFGLGFVVMEVYEFHELIAEGYG 129

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           P RS FLS+FFALV  HG+HV  GL+W+ +++IQ  ++GL + N+ RL CLS+FWHFLD+
Sbjct: 130 PDRSGFLSAFFALVATHGIHVTCGLVWIILMIIQNCRRGLTAVNKTRLNCLSLFWHFLDV 189

Query: 196 IWICVFSFVYLMGVV 210
           +WICVF+ VYL+G +
Sbjct: 190 VWICVFTVVYLLGAI 204


>gi|28867224|ref|NP_789854.1| cytochrome c oxidase subunit III [Muntiacus crinifrons]
 gi|28569624|gb|AAO43644.1| cytochrome c oxidase subunit III [Muntiacus crinifrons]
          Length = 261

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 74/196 (37%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +     LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSDLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|62184333|ref|YP_220725.1| cytochrome c oxidase subunit III [Megaptera novaeangliae]
 gi|62086587|dbj|BAD91687.1| cytochrome c oxidase subunit III [Megaptera novaeangliae]
 gi|219560180|gb|ACL27307.1| cytochrome c oxidase subunit III [Megaptera novaeangliae]
 gi|289474199|gb|ADC97749.1| cytochrome c oxidase subunit III [Megaptera novaeangliae]
          Length = 261

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 80/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMVLFIVSEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MLQALFITIALGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +K    S +       + +WH
Sbjct: 184 APFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFLRQVKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|261341031|ref|ZP_05968889.1| cytochrome o ubiquinol oxidase, subunit III [Enterobacter
           cancerogenus ATCC 35316]
 gi|288316896|gb|EFC55834.1| cytochrome o ubiquinol oxidase, subunit III [Enterobacter
           cancerogenus ATCC 35316]
          Length = 204

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 98/179 (54%), Positives = 123/179 (68%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
            GFWIYLMSDC++F   F TYAVL    A GP   D+F++  + V T +LL SS++   A
Sbjct: 27  FGFWIYLMSDCILFCCLFATYAVLVNGTAGGPTGKDIFELPFVLVETALLLFSSITYGMA 86

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
            +A   K    + VSWL +T  FG  FI MEIYEF HLI     P RS FLS+FFALVG 
Sbjct: 87  AIA-MYKNNKSQVVSWLALTWLFGAGFIGMEIYEFHHLIMEGFGPDRSGFLSAFFALVGT 145

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HGLHV  GLIW+ VL+ Q+ ++GL S N+ R++CLS+FWHFLD++WICVFS VYLMG +
Sbjct: 146 HGLHVTSGLIWMAVLMFQVSRRGLTSTNRTRIMCLSLFWHFLDVVWICVFSVVYLMGAM 204


>gi|200004010|ref|YP_002221519.1| cytochrome c oxidase subunit III [Rachycentron canadum]
 gi|197941139|gb|ACH78274.1| cytochrome c oxidase subunit III [Rachycentron canadum]
          Length = 261

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 38/199 (19%), Positives = 84/199 (42%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPIDVF 69
               +     G   G  +++ S+ L F  FF  +                  G   +D F
Sbjct: 68  QGHHTFPVQKGLRYGMILFITSEVLFFLGFFWAFYHSSLAPTPELGGHWPPTGITALDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T +LL S ++ ++A  +   ++   + +  L +T   G+ F  ++  E+   
Sbjct: 128 EVP--LLNTAILLASGVTVTWAHHSIMEEK-RKQAIQALTLTIILGVYFTALQAMEYN-- 182

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + ++FF   G HGLHV  G  +L + +++ ++    S +       + +
Sbjct: 183 -EAPFTIADGVYGATFFVATGFHGLHVIIGTTFLAICLLRQVQYHFTSNHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYVSIYWWG 260


>gi|37496440|emb|CAD21979.1| cytochrome oxidase subunit III [Procavia capensis]
          Length = 261

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 83/197 (42%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD-I 71
               +     G   G  ++++S+ L F  FF  +                P  ++  D +
Sbjct: 68  QGHHTPNVQKGLRYGMVLFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGVNPLDPM 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S ++ ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVTITWAHHSLMEGNRKH-MIQALSMTIALGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V +++ LK    S +       + +WH
Sbjct: 184 TPFSISDGVYGSTFFVATGFHGLHVIIGSTFLMVCLLRQLKFHFTSDHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|330813657|ref|YP_004357896.1| cytochrome c oxidase polypeptide III [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486752|gb|AEA81157.1| cytochrome c oxidase polypeptide III [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 263

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/197 (20%), Positives = 76/197 (38%), Gaps = 9/197 (4%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA------AGPAPIDVFDI 71
                + V       G  +++ S+ + F  +F  Y                P  I   D 
Sbjct: 69  HKGDHTPVVQISHRYGMVLFIASEVMFFVAWFWAYFDASLFPDQAIGGVWPPKDIQTLDP 128

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
             I +   ++LL S +       +  +      V  L++T   G IF + + YE+     
Sbjct: 129 WHIPLINTLILLLSGTTVTWAHHAMLENDRKSLVQGLVLTVILGAIFTMFQAYEYM---V 185

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+F+   G HG HV  G I+L V + +  +      +       + +WH
Sbjct: 186 ASFTMSSGIYGSTFYMATGFHGFHVLIGTIFLAVCLFRAKRGHYTPDHHFGFEAAAWYWH 245

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ +F+ +Y+ G
Sbjct: 246 FVDVVWLFLFASIYIWG 262


>gi|32402532|ref|NP_861482.1| cytochrome c oxidase subunit III [Procavia capensis]
 gi|32187987|dbj|BAC78405.1| cytochrome oxidase subunit 3 [Procavia capensis]
          Length = 261

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 83/197 (42%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD-I 71
               +     G   G  ++++S+ L F  FF  +                P  ++  D +
Sbjct: 68  QGHHTPNVQKGLRYGMVLFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGVNPLDPM 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S ++ ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVTITWAHHSLMEGNRKH-MIQALSMTIALGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V +++ LK    S +       + +WH
Sbjct: 184 TPFSISDGVYGSTFFMATGFHGLHVIIGSTFLMVCLLRQLKFHFTSDHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|295065502|ref|YP_003587272.1| cytochrome c oxidase subunit III [Bison bonasus]
 gi|294679584|gb|ADF29590.1| cytochrome c oxidase subunit III [Bison bonasus]
 gi|311788320|gb|ADQ12698.1| cytochrome c oxidase subunit III [Bison bonasus]
          Length = 260

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 79/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRKH-MLQALFITITLGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V   + LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|261420866|ref|YP_003254548.1| cytochrome aa3 quinol oxidase subunit III [Geobacillus sp.
           Y412MC61]
 gi|297531651|ref|YP_003672926.1| cytochrome aa3 quinol oxidase subunit III [Geobacillus sp. C56-T3]
 gi|319768537|ref|YP_004134038.1| cytochrome aa3 quinol oxidase subunit III [Geobacillus sp.
           Y412MC52]
 gi|261377323|gb|ACX80066.1| cytochrome aa3 quinol oxidase, subunit III [Geobacillus sp.
           Y412MC61]
 gi|297254903|gb|ADI28349.1| cytochrome aa3 quinol oxidase, subunit III [Geobacillus sp. C56-T3]
 gi|317113403|gb|ADU95895.1| cytochrome aa3 quinol oxidase, subunit III [Geobacillus sp.
           Y412MC52]
          Length = 204

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 75/179 (41%), Positives = 114/179 (63%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++  +FA  F TY VL +   +GP   ++F++  + + T++LL SS +C  A
Sbjct: 26  LGFWIFLGAEVALFATLFATYLVLFQRTGSGPTAGELFEVKDVLIETLLLLTSSFTCGLA 85

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +      R+    ++WLLVT   G  FI  EI EF H +   A  Q SAFLSSFF LVG 
Sbjct: 86  IFEMRRGRIS-GLIAWLLVTLLLGAGFITFEIREFIHYVHEGATMQTSAFLSSFFVLVGT 144

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+ W+ +++IQ+L++G      R++  +S++WHFLD++WI +F+ VYL+G+V
Sbjct: 145 HGAHVSLGIGWMILIIIQLLQRGFTPKTARKVFIVSLYWHFLDVVWIFIFTLVYLLGMV 203


>gi|94981327|gb|ABF49555.1| cytochrome c oxidase subunit III [Sus scrofa]
          Length = 261

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 82/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               + V   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTSVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +LL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSILLASGVSITWAHHSLMEGDRKH-MIQALSITIALGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V +++ LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQLKFHFTSNHHFGYEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|219524222|ref|YP_002456365.1| cytochrome c oxidase subunit III [Lama guanicoe]
 gi|223976141|ref|YP_002601078.1| cytochrome c oxidase subunit III [Lama glama]
 gi|270267357|ref|YP_003331061.1| cytochrome c oxidase subunit III [Vicugna vicugna]
 gi|38602634|emb|CAD98819.1| COIII protein [Lama pacos]
 gi|108794611|gb|ABG20830.1| cytochrome c oxidase subunit III [Lama guanicoe]
 gi|108794613|gb|ABG20831.1| cytochrome c oxidase subunit III [Lama glama]
 gi|108794615|gb|ABG20832.1| cytochrome c oxidase subunit III [Lama pacos]
 gi|108794617|gb|ABG20833.1| cytochrome c oxidase subunit III [Vicugna vicugna]
 gi|186968988|gb|ACC97310.1| cytochrome c oxidase subunit III [Lama guanicoe]
 gi|213389355|gb|ACJ45794.1| cytochrome c oxidase subunit III [Vicugna vicugna]
 gi|223972338|dbj|BAH23373.1| cytochrome oxidase subunit III [Lama glama]
          Length = 261

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 41/196 (20%), Positives = 77/196 (39%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F+ FF  +                P  I   +  
Sbjct: 68  QGHHTPSVQKGLRYGMVLFIVSEVLFFSGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +      +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRTHMLQALFITIALGLYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                 S + S+FF   G HGLHV  G  +L V  ++ LK    S +       + +WHF
Sbjct: 185 PFTISDSVYGSTFFVATGFHGLHVIIGSTFLAVCFLRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|89071030|ref|ZP_01158247.1| Cytochrome c oxidase, aa3-type, subunit III [Oceanicola granulosus
           HTCC2516]
 gi|89043418|gb|EAR49635.1| Cytochrome c oxidase, aa3-type, subunit III [Oceanicola granulosus
           HTCC2516]
          Length = 266

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 49/200 (24%), Positives = 89/200 (44%), Gaps = 14/200 (7%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA----------VLGKNYAAGPAPIDVF 69
              + V   G  LGF +++MS+ + FAV+F  +               +    PA I+ F
Sbjct: 69  GDHTPVVRIGLRLGFILFIMSEVMFFAVWFWNFFKNAMYPMGPESPRVDGQWPPAGIETF 128

Query: 70  DIS-GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAH 128
           D      ++T++LL S  + ++A  A   +         L +    G++F   + YE+ H
Sbjct: 129 DPWHLPLINTLILLCSGAAATWAHHALVHENNRQDIKYGLWLAIALGVVFTFFQAYEYTH 188

Query: 129 LISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSM 188
                     + + ++FF   G HG+HV  G I+L V + ++        N       + 
Sbjct: 189 ---AAFGFSGNIYGATFFMATGFHGVHVIIGTIFLAVCLARVYAGHFTPTNHVGFEAAAW 245

Query: 189 FWHFLDLIWICVFSFVYLMG 208
           +WHF+D++W+ +F  VY+ G
Sbjct: 246 YWHFVDVVWLFLFVAVYVWG 265


>gi|42632194|ref|NP_976184.1| cytochrome c oxidase subunit III [Sebastes schlegelii]
 gi|38640813|gb|AAR26014.1| cytochrome c oxidase subunit 3 [Sebastes schlegelii]
          Length = 261

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 37/196 (18%), Positives = 73/196 (37%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  +++ S+  +F  FF  +                P  I   D  
Sbjct: 68  QGHHTPPVQKGLRYGMILFITSEVFLFLGFFWAFYHASLAPTPELGGCWPPTGITTLDPF 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +L +S         S  +    +T+  L +T   G  F  ++  E+      
Sbjct: 128 EVPLLNTTVLPASGVTLTWTHHSIMEGERKQTIQSLALTILLGFYFTFLQALEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLH+  G  +L V +++ +     S +       + +WHF
Sbjct: 185 PFTIADGVYGSTFFVATGFHGLHLIIGSTFLAVCLLRQIPYHFTSEHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYISIYWWG 260


>gi|114052825|ref|YP_740273.1| cytochrome c oxidase subunit III [Solea senegalensis]
 gi|113208355|dbj|BAF03546.1| cytochrome oxidase subunit III [Solea senegalensis]
          Length = 261

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 83/199 (41%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPIDVF 69
               +    +G   G  +++ S+ L F  FF  +                  G  P+D F
Sbjct: 68  QGHHTPPVQNGLRFGMILFIASEVLFFVGFFWAFYHASLAPTVDLGNTWPPTGITPLDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  +        + +  L +T   G+ F  ++  E+   
Sbjct: 128 EVP--LLNTAVLLASGVTVTWAHHSIMEGN-RPQAIQSLALTILLGLYFTFLQAMEY--- 181

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + ++FF   G HGLHV  G  +L V +++  +    S +       + +
Sbjct: 182 YEAPFTLADGVYGTTFFVATGFHGLHVIIGTTFLIVCLLRQTEHHFTSDHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYISIYWWG 260


>gi|254455517|ref|ZP_05068946.1| cytochrome-c oxidase [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082519|gb|EDZ59945.1| cytochrome-c oxidase [Candidatus Pelagibacter sp. HTCC7211]
          Length = 262

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/197 (20%), Positives = 76/197 (38%), Gaps = 9/197 (4%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK------NYAAGPAPIDVFDI 71
                + V       G  +++ S+ + F  +F  Y  +             P  I+ FD 
Sbjct: 68  HQGHHTPVVQIHHRYGMTLFIASEVMFFVAWFWAYFDISLFPNEFVGNVWPPKDIETFDP 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
             I +   ++LL S +       S  +      +  L  T   G  F +++ YE+ H   
Sbjct: 128 WDIPLINTLVLLLSGTTVTWAHHSLIEGDRKGFIQGLTSTVILGFFFTLLQAYEYHH--- 184

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + + F+   G HG HV  G I+L V + +         +       + +WH
Sbjct: 185 ATFDYSGHIYGAVFYMATGFHGFHVIIGTIFLAVCLWRGKLGHFTKDHHFGFEAAAWYWH 244

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ +F+ +Y+ G
Sbjct: 245 FVDVVWLFLFAAIYIWG 261


>gi|5921867|sp|O48374|COX3_GAZDA RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2731916|gb|AAB93608.1| cytochrome oxidase subunit III [Nanger dama]
 gi|2731918|gb|AAB93609.1| cytochrome oxidase subunit III [Nanger dama]
          Length = 261

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPNVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|157056527|gb|ABV02159.1| cytochrome c oxidase subunit 3 [Sus scrofa]
          Length = 261

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 82/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               + V   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTSVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +LL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSILLASGVSITWAHHSLMEGDRKH-MIQALSITIALGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V +++ LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|49147192|ref|YP_025785.1| cytochrome c oxidase subunit 3 [Pseudendoclonium akinetum]
 gi|33439207|gb|AAQ18744.1| cytochrome c oxidase subunit 3 [Pseudendoclonium akinetum]
          Length = 261

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 50/198 (25%), Positives = 85/198 (42%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
           V     +     G   G  ++++S+ ++FA FF  +                P  I+  D
Sbjct: 66  VYQGHHTRAVQTGIRYGMILFIVSEIMLFAGFFWAFGHSSLAPTIELAGVWPPRGIEALD 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
             GI     ++LLSS +       +       + +  L +T     IF   + YE+   +
Sbjct: 126 PFGIPFLNTLILLSSGASVTWAHYAILLGDRKQGILSLAITIILAAIFTGFQAYEY---V 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
           S       S + S+F+ L GLHG HV  G I+L V + ++ K  L   +       +++W
Sbjct: 183 SASFTISDSVYGSAFYMLTGLHGTHVLVGTIFLAVCLYRLSKAELRPDHHLGFELAALYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ VF  VY  G
Sbjct: 243 HFVDVVWLIVFIVVYWWG 260


>gi|21908050|ref|NP_663798.1|COX3_16534 cytochrome c oxidase subunit III [Muntiacus reevesi]
 gi|116235408|ref|YP_794155.1| cytochrome c oxidase subunit III [Muntiacus reevesi micrurus]
 gi|21842394|gb|AAM77758.1|AF527537_5 cytochrome c oxidase subunit III [Muntiacus reevesi]
 gi|116006450|gb|ABJ51756.1| cytochrome c oxidase subunit III [Muntiacus reevesi micrurus]
          Length = 261

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|145208216|gb|ABP38005.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|145208230|gb|ABP38018.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532492|gb|ACU81419.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532604|gb|ACU81523.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532632|gb|ACU81549.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532772|gb|ACU81679.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533024|gb|ACU81913.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533178|gb|ACU82056.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533416|gb|ACU82277.1| cytochrome c oxidase subunit III [Bos grunniens]
          Length = 260

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRNHMLQALFITITLGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|91176269|ref|YP_537138.1| cytochrome c oxidase subunit III [Balaenoptera omurai]
 gi|90265613|dbj|BAE91833.1| cytochrome c oxidase subunit III [Balaenoptera omurai]
          Length = 261

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 80/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIVSEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMGGNRKH-MLQALFITIALGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +K    S +       + +WH
Sbjct: 184 APFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFLRQVKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|256532660|gb|ACU81575.1| cytochrome c oxidase subunit III [Bos grunniens]
          Length = 260

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRNHMLQALFITITLGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFMATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|13476230|ref|NP_107800.1| cytochrome c oxidase subunit III [Mesorhizobium loti MAFF303099]
 gi|14026990|dbj|BAB53586.1| cytochrome c oxidase subunit III [Mesorhizobium loti MAFF303099]
          Length = 292

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 44/206 (21%), Positives = 86/206 (41%), Gaps = 17/206 (8%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA-----------VLGKNY---AAG 62
             +   + V       G  +++ S+ + F  +F  Y                 +      
Sbjct: 81  AHEGHHTRVVSLHLRYGMIMFIASEVMFFVAWFWAYFDASLFAGEVQNYARHTFTGGVWP 140

Query: 63  PAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIME 122
           P  ++V D   + +   ++LL S +       S         ++ L++T   GM+F +++
Sbjct: 141 PKGMEVLDPFHLPLYNTIILLLSGTTVTWAHHSLIHGDRKGLINGLVLTVGLGMLFTMVQ 200

Query: 123 IYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRR 182
            YE+   I      + S + ++FF   G HG HV  G I+L V +I+ +K          
Sbjct: 201 AYEY---IHAPFGFKDSIYGATFFMATGFHGFHVIIGTIFLLVCLIRAMKGDFTPKQHFG 257

Query: 183 LICLSMFWHFLDLIWICVFSFVYLMG 208
               + +WHF+D++W+ +FS +Y+ G
Sbjct: 258 FEAAAWYWHFVDVVWLFLFSAIYVWG 283


>gi|5921876|sp|O47695|COX3_OUROU RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2731898|gb|AAB93599.1| cytochrome oxidase subunit III [Ourebia ourebi]
          Length = 261

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|312233444|ref|YP_004021845.1| cytochrome c oxidase subunit III [Cervus eldi]
 gi|308277994|gb|ADO27630.1| cytochrome c oxidase subunit III [Cervus eldi]
          Length = 261

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 76/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I+  +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGINPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|120586745|ref|YP_961401.1| cytochrome c oxidase subunit III [Elaphodus cephalophus]
 gi|111380727|gb|ABH09742.1| cytochrome c oxidase subunit III [Elaphodus cephalophus]
          Length = 261

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 41/196 (20%), Positives = 76/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   + T+  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGSRNHTLQALFITIALGIYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|223976155|ref|YP_002601091.1| cytochrome c oxidase subunit III [Pecari tajacu]
 gi|223972352|dbj|BAH23386.1| cytochrome oxidase subunit III [Pecari tajacu]
          Length = 261

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 82/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD-I 71
               +     G   G  ++++S+ L F+ FF  +                P  I   + +
Sbjct: 68  QGHHTSAVQKGLRYGMILFIISEVLFFSGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPM 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +LL S +S ++A  +       H  +  L +T   GM F +++  E+     
Sbjct: 128 EVPLLNTSILLASGVSITWAHHSLMEGDRKH-MLQALFITIALGMYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ LK    S +       + +WH
Sbjct: 184 APFTISDGIYGSTFFVATGFHGLHVIIGSTFLAVCFLRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|238625875|gb|ACR48202.1| cytochrome c oxidase subunit III [Sus scrofa]
          Length = 261

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 82/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               + V   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTSVVQKGLRYGMILFIISEALFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +LL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSILLASGVSITWAHHSLMEGDRKH-MIQALSITIALGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V +++ LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|154090900|ref|YP_001403135.1| cytochrome c oxidase subunit III [Hippoglossus hippoglossus]
 gi|154090928|ref|YP_001403148.1| cytochrome c oxidase subunit III [Hippoglossus stenolepis]
 gi|153581691|emb|CAO79623.1| cytochrome oxidase subunit III [Hippoglossus hippoglossus]
 gi|153581705|emb|CAO79636.1| cytochrome oxidase subunit III [Hippoglossus hippoglossus]
 gi|153581733|emb|CAO79662.1| cytochrome oxidase subunit III [Hippoglossus hippoglossus]
 gi|153581747|emb|CAO79675.1| cytochrome oxidase subunit III [Hippoglossus stenolepis]
 gi|153581761|emb|CAO79688.1| cytochrome oxidase subunit III [Hippoglossus stenolepis]
 gi|153581775|emb|CAO79701.1| cytochrome oxidase subunit III [Hippoglossus stenolepis]
 gi|153581789|emb|CAO79714.1| cytochrome oxidase subunit III [Hippoglossus stenolepis]
          Length = 261

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 43/199 (21%), Positives = 84/199 (42%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPIDVF 69
               +     G   G  +++ S+ L F  FF  +                 AG  P+D F
Sbjct: 68  QGHHTPPVQKGLRYGMILFITSEVLFFLGFFWAFYHSSLAPTPELGGFWPPAGITPLDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  +    +   +T+  L +T   G  F  ++  E+   
Sbjct: 128 EVP--LLNTAVLLASGVTVTWAHHSIMEGK-RKQTIQSLALTILLGGYFTFLQGLEYH-- 182

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + ++FF   G HGLHV  G  +L V +++ +     S +       + +
Sbjct: 183 -EAPFTIADGVYGATFFVATGFHGLHVLIGTSFLAVCLLRQILHHFTSNHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYISIYWWG 260


>gi|5921872|sp|O47706|COX3_GAZTH RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2731924|gb|AAB93612.1| cytochrome oxidase subunit III [Eudorcas thomsonii]
          Length = 261

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPNVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|28301761|ref|NP_783561.1| cytochrome c oxidase subunit III [Muntiacus muntjak]
 gi|28207783|gb|AAO32134.1| cytochrome c oxidase subunit III [Muntiacus muntjak]
          Length = 261

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|316926512|ref|YP_004111302.1| cytochrome c oxidase subunit III [Capra hircus]
 gi|283049410|gb|ADB07176.1| cytochrome c oxidase subunit III [Capra hircus]
          Length = 261

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRNHMLQALFITIMLGLYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|147744497|ref|YP_001218797.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|75042981|sp|Q5Y4Q4|COX3_BOSMU RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|52857755|gb|AAU89112.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|145208244|gb|ABP38031.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532464|gb|ACU81393.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532478|gb|ACU81406.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532506|gb|ACU81432.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532520|gb|ACU81445.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532534|gb|ACU81458.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532548|gb|ACU81471.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532562|gb|ACU81484.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532576|gb|ACU81497.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532590|gb|ACU81510.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532618|gb|ACU81536.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532646|gb|ACU81562.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532674|gb|ACU81588.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532688|gb|ACU81601.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532702|gb|ACU81614.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532716|gb|ACU81627.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532744|gb|ACU81653.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532758|gb|ACU81666.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532786|gb|ACU81692.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532800|gb|ACU81705.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532814|gb|ACU81718.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532828|gb|ACU81731.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532842|gb|ACU81744.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532856|gb|ACU81757.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532870|gb|ACU81770.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532884|gb|ACU81783.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532898|gb|ACU81796.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532912|gb|ACU81809.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532926|gb|ACU81822.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532940|gb|ACU81835.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532954|gb|ACU81848.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532968|gb|ACU81861.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532982|gb|ACU81874.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256532996|gb|ACU81887.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533010|gb|ACU81900.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533038|gb|ACU81926.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533052|gb|ACU81939.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533066|gb|ACU81952.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533080|gb|ACU81965.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533094|gb|ACU81978.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533108|gb|ACU81991.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533122|gb|ACU82004.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533136|gb|ACU82017.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533150|gb|ACU82030.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533164|gb|ACU82043.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533192|gb|ACU82069.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533206|gb|ACU82082.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533220|gb|ACU82095.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533234|gb|ACU82108.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533248|gb|ACU82121.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533262|gb|ACU82134.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533276|gb|ACU82147.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533290|gb|ACU82160.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533304|gb|ACU82173.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533332|gb|ACU82199.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533346|gb|ACU82212.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533360|gb|ACU82225.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533374|gb|ACU82238.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533388|gb|ACU82251.1| cytochrome c oxidase subunit III [Bos grunniens]
 gi|256533402|gb|ACU82264.1| cytochrome c oxidase subunit III [Bos grunniens]
          Length = 260

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRNHMLQALFITITLGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|119387828|ref|YP_918862.1| cytochrome c oxidase, subunit III [Paracoccus denitrificans PD1222]
 gi|461329|emb|CAA55034.1| cytochrome ba(3) [Paracoccus denitrificans]
 gi|119378403|gb|ABL73166.1| cytochrome ba3 quinol oxidase subunit 3 [Paracoccus denitrificans
           PD1222]
          Length = 205

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 110/204 (53%), Positives = 142/204 (69%), Gaps = 2/204 (0%)

Query: 7   GKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI 66
             +     ++  +      +   T LGFW+YLMSDCLMFAV F  Y VLG ++AAGP P 
Sbjct: 4   ATTDTMRQYWELEPHHHP-EGASTSLGFWVYLMSDCLMFAVLFAVYGVLGTSFAAGPGPK 62

Query: 67  DVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEF 126
           D+FD+  + V+T +LLLSS++  FAMLA         T+ WL VT FFG+ F+ +E+YEF
Sbjct: 63  DLFDLELVAVNTAMLLLSSITFGFAMLAMGKGDQR-GTLRWLAVTLFFGLCFLAIELYEF 121

Query: 127 AHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
            HLI + A PQRS FLS+FF LVG HGLHV FG IWL  L++QI + GLI  NQRR++CL
Sbjct: 122 HHLIHIGAGPQRSGFLSAFFTLVGTHGLHVTFGSIWLVTLMVQITRTGLIPANQRRMVCL 181

Query: 187 SMFWHFLDLIWICVFSFVYLMGVV 210
           SMFWHFLD+IWI VF+FVYL+G++
Sbjct: 182 SMFWHFLDVIWIGVFTFVYLLGMI 205


>gi|226453390|ref|YP_002791035.1| cytochrome c oxidase subunit III [Bison bison]
 gi|157778810|gb|ABV70939.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959389|gb|ADF48930.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959403|gb|ADF48943.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959417|gb|ADF48956.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959431|gb|ADF48969.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959445|gb|ADF48982.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959459|gb|ADF48995.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959473|gb|ADF49008.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959487|gb|ADF49021.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959501|gb|ADF49034.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959515|gb|ADF49047.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959529|gb|ADF49060.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959543|gb|ADF49073.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959557|gb|ADF49086.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959571|gb|ADF49099.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959585|gb|ADF49112.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959599|gb|ADF49125.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959613|gb|ADF49138.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959627|gb|ADF49151.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959641|gb|ADF49164.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959655|gb|ADF49177.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959669|gb|ADF49190.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959683|gb|ADF49203.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959697|gb|ADF49216.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959711|gb|ADF49229.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959725|gb|ADF49242.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959739|gb|ADF49255.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959753|gb|ADF49268.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959767|gb|ADF49281.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959781|gb|ADF49294.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959795|gb|ADF49307.1| cytochrome c oxidase subunit III [Bison bison]
 gi|294959809|gb|ADF49320.1| cytochrome c oxidase subunit III [Bison bison]
          Length = 260

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRNHMLQALFITITLGIYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|284177734|ref|YP_003406735.1| cytochrome c oxidase subunit III [Moschus moschiferus]
 gi|213990236|gb|ACJ60538.1| cytochrome c oxidase subunit III [Moschus moschiferus]
          Length = 261

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|38707457|ref|NP_944717.1| cytochrome c oxidase subunit III [Inia geoffrensis]
 gi|38602536|emb|CAD87994.1| cytochrome c oxidase polypeptide III [Inia geoffrensis]
          Length = 261

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 81/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               +     G   G  ++++S+ L F  FF  +  + L      G +            
Sbjct: 68  QGHHTPTVQKGLRYGMILFILSEVLFFTGFFWAFYHSSLAPTPELGGSWPPTGIYPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRKHA-LQALFITITLGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L +  I+ +K    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIICFIRHMKFHFTSTHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|63025133|ref|YP_232839.1| cytochrome c oxidase subunit III [Cervus nippon centralis]
 gi|62751077|dbj|BAD95768.1| cytochrome c oxidase subunit3 [Cervus nippon centralis]
          Length = 261

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIVSEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|153581719|emb|CAO79649.1| cytochrome oxidase subunit III [Hippoglossus hippoglossus]
          Length = 261

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 43/199 (21%), Positives = 84/199 (42%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPIDVF 69
               +     G   G  +++ S+ L F  FF  +                 AG  P+D F
Sbjct: 68  QGHHTPPVQKGLRYGMILFITSEVLFFLGFFWAFYHSSLAPTPELGGFWPPAGITPLDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  +    +   +T+  L +T   G  F  ++  E+   
Sbjct: 128 EVP--LLNTAVLLASGVTVTWAHHSIMEGK-RKQTIQSLALTILLGGYFTFLQGLEYH-- 182

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + ++FF   G HGLHV  G  +L V +++ +     S +       + +
Sbjct: 183 -EAPFTIADGVYGAAFFVATGFHGLHVLIGTSFLAVCLLRQILHHFTSNHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYISIYWWG 260


>gi|207559917|gb|ACI24516.1| cytochrome c oxidase subunit 3 [Hemitragus jemlahicus]
          Length = 261

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 74/196 (37%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  +++ S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFITSEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRNHMLQALFITITLGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|19919708|gb|AAM08332.1| cytochrome oxidase subunit III [Bos taurus]
 gi|19919722|gb|AAM08345.1| cytochrome oxidase subunit III [Bos taurus]
 gi|20149074|gb|AAM12795.1| cytochrome oxidase subunit III [Bos taurus]
 gi|20149088|gb|AAM12808.1| cytochrome oxidase subunit III [Bos taurus]
 gi|37960021|gb|AAP47834.1| cytochrome oxidase subunit III [Bos taurus]
 gi|37960035|gb|AAP47847.1| cytochrome oxidase subunit III [Bos taurus]
 gi|37960049|gb|AAP47860.1| cytochrome oxidase subunit III [Bos taurus]
 gi|37960063|gb|AAP47873.1| cytochrome oxidase subunit III [Bos taurus]
          Length = 267

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 79/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRKH-MLQALFITITLGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V   + LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|5921874|sp|O47699|COX3_MADGU RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2731906|gb|AAB93603.1| cytochrome oxidase subunit III [Madoqua guentheri]
          Length = 261

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNPMLQALFITIALGIYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|37545832|gb|AAM95736.1| cytochrome c oxidase subunit 3 [Bos indicus]
          Length = 267

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 79/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRKH-MLQALFITITLGIYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V   + LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|297593516|gb|ADI47475.1| cytochrome oxidase subunit III [Tetrapturus georgii]
          Length = 261

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 38/199 (19%), Positives = 81/199 (40%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPIDVF 69
               +     G   G  +++ S+   F  FF  +                  G   +D F
Sbjct: 68  QGHHTPPVQKGLRYGMILFITSEVPFFLGFFWAFYHSSLAPTPELGGHWPPTGITALDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  +    +   + +  L +T   G  F  ++  E++  
Sbjct: 128 EVP--LLNTAVLLASGVTVTWAHHSIMEAK-RKQAIQSLALTILLGAYFTFLQALEYS-- 182

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + ++F    G HGLHV  G  +L V +++ ++    S +       + +
Sbjct: 183 -EAPFTIADGVYGATFSVATGFHGLHVLIGSTFLAVCLLRQIRHHFTSSHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYISIYWWG 260


>gi|5921866|sp|O47708|COX3_GAZCU RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2731928|gb|AAB93614.1| cytochrome oxidase subunit III [Gazella cuvieri]
          Length = 261

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPNVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|223976113|ref|YP_002600876.1| cytochrome c oxidase subunit III [Antilope cervicapra]
 gi|5921861|sp|O47702|COX3_ANTCE RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2731912|gb|AAB93606.1| cytochrome oxidase subunit III [Antilope cervicapra]
 gi|223972282|dbj|BAH23321.1| cytochrome oxidase subunit III [Antilope cervicapra]
          Length = 261

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPNVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|223976099|ref|YP_002600796.1| cytochrome c oxidase subunit III [Capricornis crispus]
 gi|223972380|dbj|BAH23412.1| cytochrome oxidase subunit III [Capricornis crispus]
          Length = 261

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITITLGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYISIYWWG 260


>gi|226464068|ref|YP_002735049.1| cytochrome c oxidase subunit III [Neuroctenus parus]
 gi|166897824|gb|ABZ02065.1| cytochrome c oxidase subunit III [Neuroctenus parus]
          Length = 260

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 45/194 (23%), Positives = 88/194 (45%), Gaps = 11/194 (5%)

Query: 22  ESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA------AGPAPIDVFD-ISGI 74
            +    +G  LG  ++++S+ + F  FF  +     + +        P  I  F+ +   
Sbjct: 70  HTLKVVNGLKLGMILFIVSEVMFFVSFFWAFLHSSLSPSVEIGMIWPPKGIQPFNPMEIP 129

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            ++T +LL S ++ ++A  +         TV  L  T   G++F I++ YE+   +    
Sbjct: 130 LLNTTILLCSGITVTWAHHSIMEGNHKSTTV-SLATTVILGIMFTILQGYEY---LEASF 185

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
               S + S FF   G HG+HV  G  +L V +++ +     S +       + +WHF+D
Sbjct: 186 CIADSIYGSVFFVSTGFHGIHVIIGTTFLGVCLMRHMAHQFSSTHHFGFEAAAWYWHFVD 245

Query: 195 LIWICVFSFVYLMG 208
           ++W+ ++  VY  G
Sbjct: 246 VVWLFLYIMVYWWG 259


>gi|315125954|ref|YP_004067957.1| cytochrome o ubiquinol oxidase subunit III (ubiquinol oxidase chain
           C) [Pseudoalteromonas sp. SM9913]
 gi|315014468|gb|ADT67806.1| cytochrome o ubiquinol oxidase subunit III (ubiquinol oxidase chain
           C) [Pseudoalteromonas sp. SM9913]
          Length = 210

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 99/195 (50%), Positives = 136/195 (69%), Gaps = 4/195 (2%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF 75
           +  +  ++  D   T  GFW+YLM+DCL+FA FF TYAVL  N A G +  D+F++  + 
Sbjct: 20  HTHEHHDTSGD---TIFGFWLYLMTDCLLFASFFATYAVLYMNTAGGVSGKDIFELDFVA 76

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           V T  LL+SS++  FAM+A+  ++    T+ WL VT   G +FI MEIYEF HLI     
Sbjct: 77  VETAALLISSITFGFAMIAAQGQK-KALTLGWLAVTFCLGAVFIGMEIYEFHHLIVHGNG 135

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           PQ+SAFL+SFF+LVGLHGLHV  GLIW+ +++I+++K+GL      RL CLS+FWHFLD+
Sbjct: 136 PQQSAFLTSFFSLVGLHGLHVTAGLIWMSIMMIEVIKRGLGKQTVTRLSCLSLFWHFLDI 195

Query: 196 IWICVFSFVYLMGVV 210
           +WICVF+ VYLMG +
Sbjct: 196 VWICVFTVVYLMGAM 210


>gi|292486454|ref|YP_003541090.1| cytochrome c oxidase subunit III [Bos primigenius]
 gi|28381353|sp|P00415|COX3_BOVIN RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|40889825|pdb|1V54|C Chain C, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
           State
 gi|40889838|pdb|1V54|P Chain P, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
           State
 gi|40889851|pdb|1V55|C Chain C, Bovine Heart Cytochrome C Oxidase At The Fully Reduced
           State
 gi|40889864|pdb|1V55|P Chain P, Bovine Heart Cytochrome C Oxidase At The Fully Reduced
           State
 gi|145579211|pdb|2DYR|C Chain C, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
           State
 gi|145579224|pdb|2DYR|P Chain P, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
           State
 gi|149241473|pdb|2EIJ|C Chain C, Bovine Heart Cytochrome C Oxidase In The Fully Reduced
           State
 gi|149241486|pdb|2EIJ|P Chain P, Bovine Heart Cytochrome C Oxidase In The Fully Reduced
           State
 gi|149241508|pdb|2EIK|C Chain C, Cadmium Ion Binding Structure Of Bovine Heart Cytochrome C
           Oxidase In The Fully Reduced State
 gi|149241521|pdb|2EIK|P Chain P, Cadmium Ion Binding Structure Of Bovine Heart Cytochrome C
           Oxidase In The Fully Reduced State
 gi|149241538|pdb|2EIL|C Chain C, Cadmium Ion Binding Structure Of Bovine Heart Cytochrome C
           Oxidase In The Fully Oxidized State
 gi|149241551|pdb|2EIL|P Chain P, Cadmium Ion Binding Structure Of Bovine Heart Cytochrome C
           Oxidase In The Fully Oxidized State
 gi|149241568|pdb|2EIM|C Chain C, Zinc Ion Binding Structure Of Bovine Heart Cytochrome C
           Oxidase In The Fully Reduced State
 gi|149241581|pdb|2EIM|P Chain P, Zinc Ion Binding Structure Of Bovine Heart Cytochrome C
           Oxidase In The Fully Reduced State
 gi|149241598|pdb|2EIN|C Chain C, Zinc Ion Binding Structure Of Bovine Heart Cytochrome C
           Oxidase In The Fully Oxidized State
 gi|149241611|pdb|2EIN|P Chain P, Zinc Ion Binding Structure Of Bovine Heart Cytochrome C
           Oxidase In The Fully Oxidized State
 gi|224036259|pdb|2ZXW|C Chain C, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
           State (1-S X-Ray Exposure Dataset)
 gi|224036272|pdb|2ZXW|P Chain P, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
           State (1-S X-Ray Exposure Dataset)
 gi|284055448|pdb|3ABL|C Chain C, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
           State (15-S X-Ray Exposure Dataset)
 gi|284055461|pdb|3ABL|P Chain P, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
           State (15-S X-Ray Exposure Dataset)
 gi|284055474|pdb|3ABM|C Chain C, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
           State (200-S X-Ray Exposure Dataset)
 gi|284055487|pdb|3ABM|P Chain P, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
           State (200-S X-Ray Exposure Dataset)
 gi|290789921|pdb|3ABK|C Chain C, Bovine Heart Cytochrome C Oxidase At The No-Bound Fully
           Reduced State (50k)
 gi|290789934|pdb|3ABK|P Chain P, Bovine Heart Cytochrome C Oxidase At The No-Bound Fully
           Reduced State (50k)
 gi|295321544|pdb|3AG1|C Chain C, Bovine Heart Cytochrome C Oxidase In The Carbon
           Monoxide-Bou Reduced State At 280 K
 gi|295321557|pdb|3AG1|P Chain P, Bovine Heart Cytochrome C Oxidase In The Carbon
           Monoxide-Bou Reduced State At 280 K
 gi|295321570|pdb|3AG2|C Chain C, Bovine Heart Cytochrome C Oxidase In The Carbon
           Monoxide-Bou Reduced State At 100 K
 gi|295321583|pdb|3AG2|P Chain P, Bovine Heart Cytochrome C Oxidase In The Carbon
           Monoxide-Bou Reduced State At 100 K
 gi|295321596|pdb|3AG3|C Chain C, Bovine Heart Cytochrome C Oxidase In The Nitric
           Oxide-Bound Reduced State At 100 K
 gi|295321609|pdb|3AG3|P Chain P, Bovine Heart Cytochrome C Oxidase In The Nitric
           Oxide-Bound Reduced State At 100 K
 gi|295321622|pdb|3AG4|C Chain C, Bovine Heart Cytochrome C Oxidase In The Cyanide Ion-Bound
           F Reduced State At 100 K
 gi|295321635|pdb|3AG4|P Chain P, Bovine Heart Cytochrome C Oxidase In The Cyanide Ion-Bound
           F Reduced State At 100 K
 gi|324357505|pdb|2Y69|C Chain C, Bovine Heart Cytochrome C Oxidase Re-Refined With
           Molecular Oxygen
 gi|324357518|pdb|2Y69|P Chain P, Bovine Heart Cytochrome C Oxidase Re-Refined With
           Molecular Oxygen
 gi|33321654|gb|AAQ06586.1| cytochrome c oxidase subunit 3 [Bos indicus]
 gi|33321668|gb|AAQ06599.1| cytochrome c oxidase subunit 3 [Bos taurus]
 gi|291463829|gb|ADE05533.1| cytochrome c oxidase subunit III [Bos primigenius]
 gi|306977274|gb|ADN11781.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|306977288|gb|ADN11794.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|306977302|gb|ADN11807.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|306977316|gb|ADN11820.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|306977330|gb|ADN11833.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|306977344|gb|ADN11846.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|306977358|gb|ADN11859.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|306977372|gb|ADN11872.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|306977386|gb|ADN11885.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|306977400|gb|ADN11898.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|306977484|gb|ADN11976.1| cytochrome c oxidase subunit III [Bos taurus]
          Length = 261

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 79/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRKH-MLQALFITITLGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V   + LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|5921870|sp|O47710|COX3_GAZSA RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2731940|gb|AAB93620.1| cytochrome oxidase subunit III [Gazella saudiya]
          Length = 261

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPNVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|71274826|ref|ZP_00651114.1| Cytochrome c oxidase, subunit III [Xylella fastidiosa Dixon]
 gi|71899872|ref|ZP_00682021.1| Cytochrome c oxidase, subunit III [Xylella fastidiosa Ann-1]
 gi|170729929|ref|YP_001775362.1| cytochrome o ubiquinol oxidase subunit III [Xylella fastidiosa M12]
 gi|71164558|gb|EAO14272.1| Cytochrome c oxidase, subunit III [Xylella fastidiosa Dixon]
 gi|71730389|gb|EAO32471.1| Cytochrome c oxidase, subunit III [Xylella fastidiosa Ann-1]
 gi|167964722|gb|ACA11732.1| cytochrome o ubiquinol oxidase subunit III [Xylella fastidiosa M12]
          Length = 202

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 101/191 (52%), Positives = 126/191 (65%), Gaps = 1/191 (0%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTI 79
                   D T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T 
Sbjct: 13  DHAHHDTGDNTVFGFWVYLMSDCLIFAGLFATYAVLVGATVDGPTAKELFDLKFVLVETF 72

Query: 80  VLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS 139
           +LL SSL+  FAM+A+  +  I     WL+VTA FG+ F+ ME+YEF HLI   A P RS
Sbjct: 73  LLLFSSLTFGFAMIAAHKRH-IPALYGWLMVTALFGLGFLGMELYEFHHLIQEGAGPGRS 131

Query: 140 AFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWIC 199
           AFLS+FF LVG HGLHV  GL+W+ +LVIQI+K GL   N  RL CLS+FWHFL +IWI 
Sbjct: 132 AFLSAFFTLVGTHGLHVASGLLWMLILVIQIVKNGLTPRNSTRLACLSLFWHFLGVIWIG 191

Query: 200 VFSFVYLMGVV 210
           VF+ VYL+G +
Sbjct: 192 VFTIVYLLGAL 202


>gi|270153151|gb|ACZ61162.1| cytochrome c oxidase subunit III [Capra hircus]
          Length = 260

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRNHMLQALFITITLGLYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|157690791|ref|YP_001488948.1| cytochrome c oxidase subunit III [Camelus dromedarius]
 gi|157394468|gb|ABV53314.1| cytochrome c oxidase subunit III [Camelus dromedarius]
          Length = 261

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIVSEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +      +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRAHMLQALFITIALGLYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V  ++ LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLTVCFLRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|150378418|ref|YP_001315078.1| cytochrome c oxidase subunit III [Camelus ferus]
 gi|122003957|gb|ABM65791.1| cytochrome oxidase subunit III [Camelus ferus]
 gi|134302897|gb|ABO70712.1| cytochrome c oxidase subunit III [Camelus ferus]
          Length = 261

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIVSEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +      +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRAHMLQALFITIALGLYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V  ++ LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLTVCFLRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|88766327|ref|YP_052703.2| cytochrome c oxidase subunit III [Bos indicus]
 gi|116243186|sp|Q576B8|COX3_BOSIN RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|306977414|gb|ADN11911.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|306977428|gb|ADN11924.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|306977442|gb|ADN11937.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|306977456|gb|ADN11950.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|306977470|gb|ADN11963.1| cytochrome c oxidase subunit III [Bos taurus]
          Length = 261

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 79/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRKH-MLQALFITITLGIYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V   + LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|207559945|gb|ACI24542.1| cytochrome c oxidase subunit 3 [Capricornis crispus]
 gi|207559959|gb|ACI24555.1| cytochrome c oxidase subunit 3 [Capricornis sumatraensis]
          Length = 261

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITITLGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYISIYWWG 260


>gi|256532730|gb|ACU81640.1| cytochrome c oxidase subunit III [Bos grunniens]
          Length = 260

 Score =  132 bits (331), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQQGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRNHMLQALFITITLGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|207559931|gb|ACI24529.1| cytochrome c oxidase subunit 3 [Naemorhedus griseus]
          Length = 261

 Score =  132 bits (331), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITITLGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYISIYWWG 260


>gi|5921875|sp|O47698|COX3_NEOMO RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2731904|gb|AAB93602.1| cytochrome oxidase subunit III [Neotragus moschatus]
          Length = 261

 Score =  132 bits (331), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGISPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|115494894|ref|YP_778675.1| cytochrome c oxidase subunit III [Rusa unicolor swinhoei]
 gi|116014303|ref|YP_788149.1| cytochrome c oxidase subunit III [Cervus nippon taiouanus]
 gi|288903457|ref|YP_003434175.1| cytochrome c oxidase subunit III [Cervus nippon hortulorum]
 gi|114329510|gb|ABI64274.1| cytochrome c oxidase subunit 3 [Rusa unicolor swinhoei]
 gi|115531527|gb|ABJ09686.1| cytochrome c oxidase subunit 3 [Cervus nippon taiouanus]
 gi|117649975|gb|ABK54031.1| cytochrome c oxidase subunit III [Cervus nippon taiouanus]
 gi|117650153|gb|ABK54081.1| cytochrome c oxidase subunit III [Rusa unicolor swinhoei]
 gi|285013423|gb|ADC32702.1| cytochrome c oxidase subunit III [Cervus nippon hortulorum]
 gi|309399273|gb|ADO78907.1| cytochrome c oxidase subunit III [Cervus nippon hortulorum]
          Length = 261

 Score =  132 bits (331), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|5921860|sp|O47691|COX3_AEPME RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2731890|gb|AAB93595.1| cytochrome oxidase subunit III [Aepyceros melampus]
          Length = 261

 Score =  132 bits (331), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|156743494|ref|YP_001433623.1| cytochrome c oxidase subunit III [Roseiflexus castenholzii DSM
           13941]
 gi|156234822|gb|ABU59605.1| cytochrome c oxidase subunit III [Roseiflexus castenholzii DSM
           13941]
          Length = 203

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 58/195 (29%), Positives = 85/195 (43%), Gaps = 4/195 (2%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY---AAGPAPIDVFDIS 72
           +      + +  D   LG W ++ S+ L FA    TY V             P +  DI 
Sbjct: 10  HATTAHHTSLGVDNRKLGVWAFIGSETLFFATLITTYFVFAPVNRARPDFQDPREFLDIE 69

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
              V   +LL SSL+   A+ AS        T   L      G+ FI  ++YEF HL   
Sbjct: 70  LTTVLASILLASSLTMVLALSASKRGDRRWFTTWLLATVG-LGLAFIGGQVYEFNHLYHE 128

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                 S F ++FF L G HG HV  G+IWL  +  ++        N   +    ++WHF
Sbjct: 129 GLTLSSSLFGTTFFVLTGFHGTHVAIGVIWLLSVFFKVRTYPNSPENAMDVEIAGLYWHF 188

Query: 193 LDLIWICVFSFVYLM 207
           +DL+W+ +F  VYL+
Sbjct: 189 VDLVWVAIFVLVYLI 203


>gi|223976127|ref|YP_002600983.1| cytochrome c oxidase subunit III [Giraffa camelopardalis
           angolensis]
 gi|223972310|dbj|BAH23347.1| cytochrome oxidase subunit III [Giraffa camelopardalis]
          Length = 261

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 80/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD-I 71
               +     G   G  ++++S+ L F  FF  +                P  I   + +
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPM 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MLQALFITISLGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V   + LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGTTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|114707978|ref|ZP_01440870.1| Cytochrome c oxidase, subunit III [Fulvimarina pelagi HTCC2506]
 gi|114536607|gb|EAU39739.1| Cytochrome c oxidase, subunit III [Fulvimarina pelagi HTCC2506]
          Length = 208

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 104/190 (54%), Positives = 136/190 (71%), Gaps = 1/190 (0%)

Query: 21  KESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIV 80
           +        T LGFWIYLMSDCL+FAV F TY VLG NYAAGP P D+F++  + V+T +
Sbjct: 20  EHGHETGSSTMLGFWIYLMSDCLIFAVLFATYGVLGANYAAGPRPEDIFELPLLAVNTAM 79

Query: 81  LLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA 140
           LL SS++  FAM+A   ++     + WL VT  FG +F+ +E+YEF   I   A PQRS 
Sbjct: 80  LLFSSITYGFAMIAMQARQTKM-VLLWLAVTGVFGALFLGIELYEFGVFIGEGASPQRSG 138

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICV 200
           FLS+FF LVG HGLHV FG++WL  L++QI K GLIS N+RR++CLSMFWHFLD++WI V
Sbjct: 139 FLSAFFTLVGTHGLHVTFGIVWLVTLMVQIQKYGLISANRRRIMCLSMFWHFLDVVWIGV 198

Query: 201 FSFVYLMGVV 210
           F+FVYL+ ++
Sbjct: 199 FTFVYLIRMI 208


>gi|150375659|ref|YP_001315065.1| cytochrome c oxidase subunit III [Camelus bactrianus]
 gi|122003946|gb|ABM65783.1| cytochrome oxidase subunit III [Camelus bactrianus]
 gi|134302860|gb|ABO70678.1| cytochrome c oxidase subunit III [Camelus bactrianus]
 gi|134302874|gb|ABO70691.1| cytochrome c oxidase subunit III [Camelus bactrianus]
 gi|134302883|gb|ABO70699.1| cytochrome c oxidase subunit III [Camelus ferus]
 gi|223972296|dbj|BAH23334.1| cytochrome oxidase subunit III [Camelus bactrianus]
          Length = 261

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIVSEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +      +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRAHMLQALFITIALGLYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V  ++ LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLTVCFLRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|207560015|gb|ACI24607.1| cytochrome c oxidase subunit 3 [Rupicapra pyrenaica]
          Length = 261

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|5921877|sp|O47692|COX3_PELCP RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2731892|gb|AAB93596.1| cytochrome oxidase subunit III [Pelea capreolus]
          Length = 261

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPSVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|5921889|sp|O47689|COX3_TRAST RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2707251|gb|AAB92240.1| cytochrome oxidase subunit III [Tragelaphus strepsiceros]
          Length = 261

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 41/196 (20%), Positives = 76/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               + V   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGHRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|60101831|ref|YP_209211.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|237869049|ref|YP_002907380.1| cytochrome c oxidase subunit III [Bos javanicus]
 gi|42521319|gb|AAS18248.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|56410901|gb|AAV88116.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|56410915|gb|AAV88129.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|56410929|gb|AAV88142.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|56410957|gb|AAV88168.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|56410971|gb|AAV88181.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|56410985|gb|AAV88194.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|56410999|gb|AAV88207.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|56411013|gb|AAV88220.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|56411027|gb|AAV88233.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|56411041|gb|AAV88246.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|56411055|gb|AAV88259.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|56411069|gb|AAV88272.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|56411083|gb|AAV88285.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|56411097|gb|AAV88298.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|56411111|gb|AAV88311.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|56411125|gb|AAV88324.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|56411139|gb|AAV88337.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|56411153|gb|AAV88350.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987489|gb|AAZ16539.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987503|gb|AAZ16552.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987517|gb|AAZ16565.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987531|gb|AAZ16578.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987559|gb|AAZ16604.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987573|gb|AAZ16617.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987587|gb|AAZ16630.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987601|gb|AAZ16643.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987615|gb|AAZ16656.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987629|gb|AAZ16669.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987643|gb|AAZ16682.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987671|gb|AAZ16708.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987685|gb|AAZ16721.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987699|gb|AAZ16734.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987713|gb|AAZ16747.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987727|gb|AAZ16760.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987741|gb|AAZ16773.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987755|gb|AAZ16786.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987769|gb|AAZ16799.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987783|gb|AAZ16812.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987797|gb|AAZ16825.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987811|gb|AAZ16838.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987825|gb|AAZ16851.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987839|gb|AAZ16864.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987853|gb|AAZ16877.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987867|gb|AAZ16890.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987881|gb|AAZ16903.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987895|gb|AAZ16916.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987909|gb|AAZ16929.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987937|gb|AAZ16955.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987951|gb|AAZ16968.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987965|gb|AAZ16981.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987993|gb|AAZ17007.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70988007|gb|AAZ17020.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70988021|gb|AAZ17033.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70988035|gb|AAZ17046.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70988049|gb|AAZ17059.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70988063|gb|AAZ17072.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70988077|gb|AAZ17085.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70988105|gb|AAZ17111.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70988119|gb|AAZ17124.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70988133|gb|AAZ17137.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778026|gb|ABV70211.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778040|gb|ABV70224.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778054|gb|ABV70237.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778068|gb|ABV70250.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778082|gb|ABV70263.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778096|gb|ABV70276.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778110|gb|ABV70289.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778124|gb|ABV70302.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778138|gb|ABV70315.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778152|gb|ABV70328.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778166|gb|ABV70341.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778180|gb|ABV70354.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778194|gb|ABV70367.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778208|gb|ABV70380.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778222|gb|ABV70393.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778236|gb|ABV70406.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778250|gb|ABV70419.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778264|gb|ABV70432.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778278|gb|ABV70445.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778292|gb|ABV70458.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778306|gb|ABV70471.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778320|gb|ABV70484.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778334|gb|ABV70497.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778348|gb|ABV70510.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778362|gb|ABV70523.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778376|gb|ABV70536.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778390|gb|ABV70549.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778404|gb|ABV70562.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778418|gb|ABV70575.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778432|gb|ABV70588.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778446|gb|ABV70601.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778460|gb|ABV70614.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778474|gb|ABV70627.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778488|gb|ABV70640.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778502|gb|ABV70653.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778516|gb|ABV70666.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778530|gb|ABV70679.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778544|gb|ABV70692.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778558|gb|ABV70705.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778572|gb|ABV70718.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778586|gb|ABV70731.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778600|gb|ABV70744.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778614|gb|ABV70757.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778628|gb|ABV70770.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778642|gb|ABV70783.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778670|gb|ABV70809.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778712|gb|ABV70848.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778726|gb|ABV70861.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778740|gb|ABV70874.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778754|gb|ABV70887.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778782|gb|ABV70913.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778796|gb|ABV70926.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|229501221|gb|ACQ73755.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|229501235|gb|ACQ73768.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|229501249|gb|ACQ73781.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|229501263|gb|ACQ73794.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|229501319|gb|ACQ73846.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|233142551|gb|ACQ91128.1| cytochrome c oxidase subunit III [Bos javanicus]
 gi|237780768|gb|ACR19413.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|237780782|gb|ACR19426.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|294679598|gb|ADF29603.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|294959823|gb|ADF49333.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|294959851|gb|ADF49359.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|294959865|gb|ADF49372.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|294959879|gb|ADF49385.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|294959907|gb|ADF49411.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|294959949|gb|ADF49450.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|294959963|gb|ADF49463.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|294959977|gb|ADF49476.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|294959991|gb|ADF49489.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|294960005|gb|ADF49502.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|294960019|gb|ADF49515.1| cytochrome c oxidase subunit III [Bos taurus]
          Length = 260

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 79/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRKH-MLQALFITITLGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V   + LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|256533318|gb|ACU82186.1| cytochrome c oxidase subunit III [Bos grunniens]
          Length = 260

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 74/196 (37%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  +++ S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFITSEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRNHMLQALFITITLGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|126215508|ref|YP_001054756.1| cytochrome c oxidase subunit III [Anomalurus sp. GP-2005]
 gi|118140634|emb|CAJ43818.1| cytochrome c oxidase subunit 3 [Anomalurus sp. GP-2005]
          Length = 262

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 43/199 (21%), Positives = 84/199 (42%), Gaps = 11/199 (5%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG- 73
                 +     G   G  ++++S+ L F  FF  +  + L   +  G +      I   
Sbjct: 66  TYQGHHTFNVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTHDLGGSWPPTGIIPLN 125

Query: 74  ----IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
                 ++T VLL S +S ++A  +   +    + +  L +T   G+ F +++  E+   
Sbjct: 126 PLEVPLLNTSVLLASGVSITWAHHSLM-QGNRTQMIQALSITIILGLYFTLLQTSEY--- 181

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + S+FF   G HGLHV  G  +L V +++ L     S +       + +
Sbjct: 182 FETPFTISDGVYGSTFFMATGFHGLHVIIGSTFLIVCLLRQLTYHFTSQHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYVSIYWWG 260


>gi|38707633|ref|NP_944704.1| cytochrome c oxidase subunit III [Platanista minor]
 gi|38602522|emb|CAD87981.1| cytochrome c oxidase polypeptide III [Platanista minor]
          Length = 261

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 42/197 (21%), Positives = 81/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFILSEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIYPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F ++++ E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MIHALSITIMLGLYFTLLQMSEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HG HV  G  +L V +++ +K    S +       + +WH
Sbjct: 184 APFTISDGIYGSTFFMATGFHGFHVIIGSTFLIVCLLRQMKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|18034354|gb|AAL57482.1|AF419238_1 cytochrome oxidase subunit 3 [Bos indicus]
 gi|70987475|gb|AAZ16526.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987923|gb|AAZ16942.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778656|gb|ABV70796.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778768|gb|ABV70900.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|229501277|gb|ACQ73807.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|229501291|gb|ACQ73820.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|229501305|gb|ACQ73833.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|229501333|gb|ACQ73859.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|270486453|gb|ACZ83017.1| cytochrome c oxidase subunit III [Bos indicus]
          Length = 260

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 79/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRKH-MLQALFITITLGIYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V   + LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|113475448|ref|YP_721509.1| cytochrome c oxidase III [Trichodesmium erythraeum IMS101]
 gi|110166496|gb|ABG51036.1| cytochrome c oxidase, subunit III [Trichodesmium erythraeum IMS101]
          Length = 211

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 46/190 (24%), Positives = 86/190 (45%), Gaps = 5/190 (2%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +      D    G   +L S+ LMF   F  Y +   N    P      ++    ++T
Sbjct: 23  EAEHHEEHQDLRVFGLLTFLASESLMFGGLFAAYLIYRTNAGVWPPEETEVELLLPTINT 82

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           I+L+ SS        A      +     W LVTA  G+IF+  ++YE+    ++      
Sbjct: 83  IILVSSSFVIHKGDTAIKK-NDVSGMRLWYLVTAIMGIIFLGGQVYEYM---TLGYGLTT 138

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILK-KGLISGNQRRLICLSMFWHFLDLIW 197
           + F + F+ + G HGLHVF G++ +  ++ +  +           +    ++WHF+D+IW
Sbjct: 139 NVFSNCFYLMTGFHGLHVFVGVLLILGVLWRSRRAGHYNEEKHVGIEMAEIYWHFVDIIW 198

Query: 198 ICVFSFVYLM 207
           I +F+ +Y++
Sbjct: 199 IVLFTLIYIL 208


>gi|255077736|gb|ACU00371.1| cytochrome c oxidase subunit III [Proteus anguinus]
          Length = 261

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 44/199 (22%), Positives = 82/199 (41%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK---------NYAAGPAPIDVF 69
               +     G   G  +++ S+ L F  FF  +                 AG  P+D F
Sbjct: 68  QGHHTPPVQKGLRYGMILFITSEVLFFIGFFWAFYNSSLAPTPELGECWPPAGITPLDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  +         T   L +T   G+ F I++  E+   
Sbjct: 128 EVP--LLNTAVLLASGVTVTWAHHSIMHGTRKEAT-QSLTLTVALGLYFTILQAMEY--- 181

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + S+FF   G HGLHV  G ++L V + + +       +       + +
Sbjct: 182 YEAPFTIADGIYGSTFFVATGFHGLHVIIGSLFLTVCLFRQVNYHFTLNHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYISIYWWG 260


>gi|38707619|ref|NP_944678.1| cytochrome c oxidase subunit III [Hyperoodon ampullatus]
 gi|38602494|emb|CAD87955.1| cytochrome c oxidase polypeptide III [Hyperoodon ampullatus]
          Length = 261

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 39/196 (19%), Positives = 77/196 (39%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               + +   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPMVQKGLRYGMILFILSEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITITLGIYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V  ++ +K    S +       + +WHF
Sbjct: 185 PFTISDGIYGSTFFVATGFHGLHVIIGSTFLLVCFLRQMKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|187250416|ref|YP_001874833.1| cytochrome c oxidase subunit III [Naemorhedus swinhoei]
 gi|145967295|gb|ABP99011.1| cytochrome c oxidase subunit 3 [Naemorhedus swinhoei]
          Length = 260

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITITLGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYISIYWWG 260


>gi|207559847|gb|ACI24451.1| cytochrome c oxidase subunit 3 [Capra ibex]
          Length = 261

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 74/196 (37%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPPVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +      +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRSHMLQALFITITLGLYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|56410943|gb|AAV88155.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987545|gb|AAZ16591.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70987979|gb|AAZ16994.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|70988091|gb|AAZ17098.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|294959837|gb|ADF49346.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|294959893|gb|ADF49398.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|294959921|gb|ADF49424.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|294959935|gb|ADF49437.1| cytochrome c oxidase subunit III [Bos taurus]
          Length = 260

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 79/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRKH-MLQALFITITLGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V   + LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYISIYWWG 260


>gi|133755334|ref|NP_008607.2|COX3_15064 cytochrome c oxidase subunit III [Erinaceus europaeus]
          Length = 261

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 43/196 (21%), Positives = 82/196 (41%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA------AGPAPIDVFDIS 72
               + +   G   G  ++++S+ L F  FF  +                PA I   +  
Sbjct: 68  QGHHTPIVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLVPTTELGGYWPPAGIKPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  ++     +  L+VT   G+ F +++I E+      
Sbjct: 128 EVPLLNTAVLLASGVSVTWAHHSILEKDRINAIQALIVTISLGLYFTLLQIMEY---YES 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                 S + S+FF   G HG HV  G  +LF+ +++ LK    S +       + +WHF
Sbjct: 185 PFTIADSVYGSTFFMATGFHGFHVIIGSSFLFICLMRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|38707605|ref|NP_944691.1| cytochrome c oxidase subunit III [Berardius bairdii]
 gi|38602508|emb|CAD87968.1| cytochrome c oxidase polypeptide III [Berardius bairdii]
          Length = 261

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 80/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFILSEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EIPLLNTSVLLASGVSITWAHHSLMEGSRKH-MLQALFITIMLGIYFTLLQASEYH---E 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +K    S +       + +WH
Sbjct: 184 APFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFLRQMKFHFTSSHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|299829068|ref|YP_003735085.1| cytochrome c oxidase subunit III [Chimaera fulva]
 gi|298110894|gb|ADI57846.1| cytochrome c oxidase subunit III [Chimaera fulva]
          Length = 261

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 84/199 (42%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK---------NYAAGPAPIDVF 69
               +     G   G  +++ S+ L F  FF  +                  G +P+D F
Sbjct: 68  QGHHTPPVQKGLRWGMILFITSEVLFFLGFFWAFYHSSLAPTPELGNCWPPTGISPLDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T +LL S ++ ++A  +        +    L +T   G+ F +++  E+   
Sbjct: 128 EVP--LLNTAILLASGVTITWAHHSLMEGS-RKEMTQALSLTVILGLYFTLLQAMEY--- 181

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + S+FF   G HGLHV  G  +L V +++ ++    S +       + +
Sbjct: 182 YEAPFTISDGVYGSTFFVATGFHGLHVIIGTTFLMVCLMRQIQYHFTSMHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYVSIYWWG 260


>gi|5921887|sp|O47688|COX3_TRASP RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2707249|gb|AAB92239.1| cytochrome oxidase subunit III [Tragelaphus spekii]
          Length = 261

 Score =  131 bits (330), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 42/196 (21%), Positives = 76/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               + V   G   G  ++++S+ L F  FF  +                P  I   D  
Sbjct: 68  QGHHTPVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLDPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGHRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGTTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|84488587|ref|YP_448952.1| cytochrome c oxidase subunit III [Cervus elaphus]
 gi|84095038|dbj|BAE66706.1| cytochrome c oxidase subunit 3 [Cervus elaphus]
          Length = 261

 Score =  131 bits (330), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|62288055|sp|P68088|COX3_GAZGR RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|62288056|sp|P68089|COX3_GAZSO RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2731914|gb|AAB93607.1| cytochrome oxidase subunit III [Nanger granti]
 gi|2731920|gb|AAB93610.1| cytochrome oxidase subunit III [Nanger soemmerringii]
          Length = 261

 Score =  131 bits (330), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPNVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|16117431|ref|NP_395446.1| cytochrome c oxidase subunit III [Chimaera monstrosa]
 gi|16026859|emb|CAC84205.1| cyt oxidase subunit 3 [Chimaera monstrosa]
          Length = 261

 Score =  131 bits (330), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 84/199 (42%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK---------NYAAGPAPIDVF 69
               +     G   G  +++ S+ L F  FF  +                  G +P+D F
Sbjct: 68  QGHHTPPVQKGLRWGMILFITSEILFFLGFFWAFYHSSLAPTPELGNCWPPTGISPLDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T +LL S ++ ++A  +        +    L +T   G+ F +++  E+   
Sbjct: 128 EVP--LLNTAILLASGVTITWAHHSLMEGS-RKEMTQALTLTVILGVYFTLLQAMEY--- 181

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + S+FF   G HGLHV  G  +L V +++ ++    S +       + +
Sbjct: 182 YEAPFTISDGVYGSTFFVATGFHGLHVIIGTTFLMVCLVRQIQYHFTSMHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYVSIYWWG 260


>gi|240266347|ref|YP_002970600.1| cytochrome c oxidase subunit III [Thermophis zhaoermii]
 gi|238800136|gb|ACR55927.1| cytochrome c oxidase subunit III [Thermophis zhaoermii]
          Length = 261

 Score =  131 bits (330), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 38/198 (19%), Positives = 75/198 (37%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF     +             P  I   +
Sbjct: 66  TYQGHHTKGVQKNMRYGMILFITSEVFFFLGFFWALYHVSLVPTPELGAEWPPTGITPLN 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
            + + +    +LLSS +       +  K    +  + L+ T   G  F  +++ E+    
Sbjct: 126 PTEVPLLNTAVLLSSGATITWSHHATMKGNKKEAANALMTTIVLGAYFTALQVSEYQ--- 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L V ++++++    + +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMIGTSFLIVCLLRLIQHHFTTTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDIVWLLLYISVYWWG 260


>gi|2731956|gb|AAB93628.1| cytochrome oxidase subunit III [Gazella gazella]
          Length = 261

 Score =  131 bits (330), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPNVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMIQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|207559833|gb|ACI24438.1| cytochrome c oxidase subunit 3 [Capra falconeri]
          Length = 261

 Score =  131 bits (330), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRNHMLQALFITIMLGLYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|222085123|ref|YP_002543653.1| cytochrome-c oxidase [Agrobacterium radiobacter K84]
 gi|221722571|gb|ACM25727.1| cytochrome-c oxidase [Agrobacterium radiobacter K84]
          Length = 311

 Score =  131 bits (330), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 43/206 (20%), Positives = 82/206 (39%), Gaps = 17/206 (8%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA-----------VLGKNYAAG--- 62
             +   + V       G  +++ S+ + F  +F  Y                 +  G   
Sbjct: 100 AHEGAHTRVVSLHLRYGMIMFIASEVMFFVAWFWAYFDVSLFPNEAIQASRTAFLGGQFP 159

Query: 63  PAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIME 122
           P  ++V D   + +   ++LL S +       +         +  L +T   G  F  ++
Sbjct: 160 PKGVEVLDPWHLPIYNTIILLLSGTTVTWAHHALLHNDRKSMIQGLTLTVLLGAFFSCVQ 219

Query: 123 IYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRR 182
            YE+AH        + S + ++FF   G HG HV  G I+L V +I+ +K          
Sbjct: 220 AYEYAH---APFEFKNSIYGATFFMATGFHGFHVLIGTIFLLVCLIRAIKGDFTPKQHFG 276

Query: 183 LICLSMFWHFLDLIWICVFSFVYLMG 208
               + +WHF+D++W+ +F  +Y+ G
Sbjct: 277 FEAAAWYWHFVDVVWLFLFFCIYIWG 302


>gi|270153137|gb|ACZ61149.1| cytochrome c oxidase subunit III [Capra hircus]
          Length = 260

 Score =  131 bits (330), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRNHMLQALFITIMLGLYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|261864009|gb|ACY01500.1| cytochrome c oxidase subunit III [Capra hircus]
 gi|270153123|gb|ACZ61136.1| cytochrome c oxidase subunit III [Capra hircus]
 gi|270153165|gb|ACZ61175.1| cytochrome c oxidase subunit III [Capra hircus]
          Length = 260

 Score =  131 bits (330), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRNHMLQALFITIMLGLYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|207559973|gb|ACI24568.1| cytochrome c oxidase subunit 3 [Oreamnos americanus]
          Length = 261

 Score =  131 bits (330), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 45/197 (22%), Positives = 81/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               + V   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F ++++ E+     
Sbjct: 128 EVPLLNTSVLLTSGVSITWAHHSLMEGDRKH-MLQALFITIALGLYFTLLQVSEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V   + LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|296531259|dbj|BAJ08105.1| cytochrome oxidase subunit 3 [Kinyongia fischeri]
          Length = 261

 Score =  131 bits (330), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 41/198 (20%), Positives = 80/198 (40%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +     G   G  +++ S+ L F  FF T+     N          P  I+  +
Sbjct: 66  TYQGHHTTKVQTGLRYGMILFITSEVLFFLGFFWTFYFSSTNPNPALGLQWPPKGIEPLN 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +   ++LL+S         S  K L   T   LL+T   G  F +++  E+    
Sbjct: 126 PIEVPLLNTMILLASGMTLTWSHHSIMKGLKKNTSWSLLLTTLLGGYFTLLQALEYKD-- 183

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
             +       + + FF   G HGLHV  G  +L + +++ +     + +       + +W
Sbjct: 184 -TKFSISDGTYGAIFFTATGFHGLHVMVGTSFLIICLMRQMHSHFTTKHYFGFEAAAWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ +++ +Y  G
Sbjct: 243 HFVDVVWLFLYTSIYWWG 260


>gi|577079|emb|CAA57788.1| coxIII [Helianthus annuus]
          Length = 272

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 43/199 (21%), Positives = 81/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFF--VTYAVLGKNYAAG----PAPIDVFDI- 71
           +   + V   G   GF ++++S+ +     F    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKVVQLGPRYGFILFIVSEVMFLFALFRASYHSSLAPTVEIGGIWPPKGIAVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T + L S  + ++A  A    +   + V  L+ T    ++F   +  E+     
Sbjct: 131 EIPFLNTPIPLSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVFTAFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++  V  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFLATGFHGFHVIIGTLFSIVCGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|5921862|sp|O47701|COX3_ANTMR RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2731910|gb|AAB93605.1| cytochrome oxidase subunit III [Antidorcas marsupialis]
          Length = 261

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPNVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITISLGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|2731950|gb|AAB93625.1| cytochrome oxidase subunit III [Gazella gazella]
          Length = 261

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPNVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITITLGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|4379165|emb|CAA24003.1| cytochrome oxidase III [Bos taurus]
          Length = 267

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 79/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRKH-MLQALFITITLGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V   + LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAGAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|62288057|sp|P68299|COX3_GAZDO RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|62288058|sp|P68300|COX3_GAZSP RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2731926|gb|AAB93613.1| cytochrome oxidase subunit III [Gazella spekei]
 gi|2731944|gb|AAB93622.1| cytochrome oxidase subunit III [Gazella dorcas]
 gi|2731946|gb|AAB93623.1| cytochrome oxidase subunit III [Gazella dorcas]
          Length = 261

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPNVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|55976795|sp|P68531|COX3_GAZBE RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|55976796|sp|P68532|COX3_GAZGA RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2731936|gb|AAB93618.1| cytochrome oxidase subunit III [Gazella bennettii]
 gi|2731938|gb|AAB93619.1| cytochrome oxidase subunit III [Gazella bennettii]
 gi|2731948|gb|AAB93624.1| cytochrome oxidase subunit III [Gazella gazella]
 gi|2731952|gb|AAB93626.1| cytochrome oxidase subunit III [Gazella gazella]
 gi|2731954|gb|AAB93627.1| cytochrome oxidase subunit III [Gazella gazella]
          Length = 261

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPNVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|149189686|ref|ZP_01867968.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio shilonii AK1]
 gi|148836498|gb|EDL53453.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio shilonii AK1]
          Length = 199

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 96/190 (50%), Positives = 125/190 (65%), Gaps = 1/190 (0%)

Query: 21  KESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIV 80
            +S    D    GFWIYLMSDC++FA  F TYAVL  N   G    ++F++  +FV T++
Sbjct: 10  HDSHDHSDNKLFGFWIYLMSDCVLFATLFATYAVLASNPMTGSLARELFELPFVFVETML 69

Query: 81  LLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSA 140
           LLLSS++  F M+A   + + +    W+ VT   G+ FI ME+YEF HLI     PQ +A
Sbjct: 70  LLLSSITFGFGMIAMKRQDITN-LKLWMKVTFLLGLGFIGMEVYEFHHLIVEGYGPQTNA 128

Query: 141 FLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICV 200
           FLS+FF LVG HGLHV FGLIW+ V   Q+ KKGL S    R  CLS+FWHFLD++WICV
Sbjct: 129 FLSAFFTLVGTHGLHVTFGLIWMAVCYHQLSKKGLNSNMTMRFSCLSLFWHFLDIVWICV 188

Query: 201 FSFVYLMGVV 210
           F+ VYL+GV+
Sbjct: 189 FTIVYLLGVM 198


>gi|5921873|sp|O47700|COX3_LITWA RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2731908|gb|AAB93604.1| cytochrome oxidase subunit III [Litocranius walleri]
          Length = 261

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPNVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|52220990|ref|YP_087088.1| cytochrome c oxidase subunit III [Bubalus bubalis]
 gi|51173188|gb|AAT97420.1| cytochrome c oxidase subunit III [Bubalus bubalis]
          Length = 260

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 76/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I+  +  
Sbjct: 68  QGHHTSAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGINPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGSRNHMLQALFITITLGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|16357395|ref|NP_443443.1| cytochrome c oxidase subunit III [Kareius bicoloratus]
 gi|190349419|ref|YP_001974598.1| cytochrome c oxidase subunit III [Platichthys stellatus]
 gi|16267334|dbj|BAB70449.1| cytochrome c oxidase subunit III [Kareius bicoloratus]
 gi|125657051|gb|ABN48618.1| cytochrome oxidase subunit 3 [Platichthys stellatus]
          Length = 261

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 42/199 (21%), Positives = 83/199 (41%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPIDVF 69
               +     G   G  +++ S+ L F  FF  +                 AG  P+D F
Sbjct: 68  QGHHTPPVQKGLRYGMILFITSEVLFFLGFFWAFYHSSLAPTPDLGGFWPPAGITPLDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  +    +   + +  L +T   G  F  ++  E+   
Sbjct: 128 EVP--LLNTAVLLASGVTVTWAHHSIMEGK-RKQAIQSLALTILLGGYFTFLQGLEYH-- 182

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + ++FF   G HGLHV  G  +L V +++ +     S +       + +
Sbjct: 183 -EAPFTIADGVYGATFFVATGFHGLHVLVGSSFLAVCLLRQILHHFTSDHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYISIYWWG 260


>gi|207560001|gb|ACI24594.1| cytochrome c oxidase subunit 3 [Pseudois nayaur]
          Length = 261

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|194367565|ref|YP_002030175.1| cytochrome o ubiquinol oxidase subunit III [Stenotrophomonas
           maltophilia R551-3]
 gi|194350369|gb|ACF53492.1| cytochrome o ubiquinol oxidase, subunit III [Stenotrophomonas
           maltophilia R551-3]
          Length = 211

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 89/178 (50%), Positives = 115/178 (64%), Gaps = 1/178 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
            G W+YLMSD ++F   F +YAVL   YA GP   D+F +  +   T +LL+SS++   A
Sbjct: 34  FGMWVYLMSDLVLFGSLFASYAVLSTAYAGGPTGKDLFSLPFVMAETFLLLVSSITYGQA 93

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +LA          + WL VT   G  FI MEIYEF+HLI   A P  SA+LS+FFALV  
Sbjct: 94  VLAMHRHDTS-AVLRWLGVTFVLGASFIGMEIYEFSHLIHEGAGPSTSAYLSAFFALVAT 152

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           HGLHV  GLIW+ V++ Q+  +GL   N  R+ CLS+FWHFLDL+WICVF+FVYL+G 
Sbjct: 153 HGLHVASGLIWMAVVMHQVYSRGLTPTNITRVSCLSLFWHFLDLVWICVFTFVYLIGA 210


>gi|194033212|ref|YP_002000549.1| cytochrome c oxidase subunit 3 [Oryza sativa Japonica Group]
 gi|60498734|dbj|BAC19853.2| Cytochrome c oxidase subunit 3 [Oryza sativa Japonica Group]
          Length = 280

 Score =  131 bits (329), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 42/199 (21%), Positives = 80/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDIS 72
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 86  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPW 145

Query: 73  -GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 146 EIPLLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 201

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++L V  I+     L   +       + +WH
Sbjct: 202 APSTISDSIYGSTFFLATGFHGFHVIIGTLFLIVCGIRQYLGHLTKKHHVGFEAAAWYWH 261

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++W+  F  +Y  G +
Sbjct: 262 FVDVVWLFPFVSIYWWGGI 280


>gi|1942988|pdb|1OCC|C Chain C, Structure Of Bovine Heart Cytochrome C Oxidase At The
           Fully Oxidized State
 gi|1943001|pdb|1OCC|P Chain P, Structure Of Bovine Heart Cytochrome C Oxidase At The
           Fully Oxidized State
 gi|4389081|pdb|2OCC|C Chain C, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
           State
 gi|4389094|pdb|2OCC|P Chain P, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
           State
 gi|5822140|pdb|1OCO|C Chain C, Bovine Heart Cytochrome C Oxidase In Carbon Monoxide-Bound
           State
 gi|5822153|pdb|1OCO|P Chain P, Bovine Heart Cytochrome C Oxidase In Carbon Monoxide-Bound
           State
 gi|5822166|pdb|1OCR|C Chain C, Bovine Heart Cytochrome C Oxidase In The Fully Reduced
           State
 gi|5822179|pdb|1OCR|P Chain P, Bovine Heart Cytochrome C Oxidase In The Fully Reduced
           State
 gi|5822192|pdb|1OCZ|C Chain C, Bovine Heart Cytochrome C Oxidase In Azide-Bound State
 gi|5822205|pdb|1OCZ|P Chain P, Bovine Heart Cytochrome C Oxidase In Azide-Bound State
          Length = 261

 Score =  131 bits (329), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 79/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRKH-MLQALFITITLGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V   + LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAGAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|207559889|gb|ACI24490.1| cytochrome c oxidase subunit 3 [Capra sibirica]
          Length = 261

 Score =  131 bits (329), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTLAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRNHMLQALFITITLGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAATWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|308070784|ref|YP_003872389.1| Quinol oxidase polypeptide III (Quinol oxidase aa3-600, subunit
           qoxC) [Paenibacillus polymyxa E681]
 gi|305860063|gb|ADM71851.1| Quinol oxidase polypeptide III (Quinol oxidase aa3-600, subunit
           qoxC) [Paenibacillus polymyxa E681]
          Length = 202

 Score =  131 bits (329), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 78/184 (42%), Positives = 118/184 (64%), Gaps = 1/184 (0%)

Query: 27  HDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSL 86
            +   LGFWI+L++D ++F+  F T+ VL  N A GP   ++F+++G+ + T +LL SS 
Sbjct: 20  QELKMLGFWIFLVTDVILFSTLFATFVVLRNNTAGGPGGAELFNMTGVIIETFLLLTSSF 79

Query: 87  SCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFF 146
           +   A+LA     +    ++WL+VTA  G+ FI  E+YEF  L+   A    SAFLS+FF
Sbjct: 80  TSGLAVLAMNKGSMK-GLINWLIVTAILGLGFIGFEVYEFVELVHEGANYGTSAFLSAFF 138

Query: 147 ALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
            LVG HGLHV  GL+W+  L+ Q+ K+GL    + ++  LS++WHFLD +WI + + VYL
Sbjct: 139 TLVGTHGLHVSLGLVWMIGLMFQLKKRGLTPETKGKVSALSLYWHFLDAVWIFLLTVVYL 198

Query: 207 MGVV 210
           MGV+
Sbjct: 199 MGVM 202


>gi|284177706|ref|YP_003406709.1| cytochrome c oxidase subunit III [Naemorhedus caudatus]
 gi|213990208|gb|ACJ60512.1| cytochrome c oxidase subunit III [Naemorhedus caudatus]
          Length = 260

 Score =  131 bits (329), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 41/196 (20%), Positives = 76/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +   G            P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSGLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITITLGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYISIYWWG 260


>gi|2707239|gb|AAB92234.1| cytochrome oxidase subunit III [Tragelaphus buxtoni]
          Length = 261

 Score =  131 bits (329), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 41/196 (20%), Positives = 76/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               + V   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGHRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|207559987|gb|ACI24581.1| cytochrome c oxidase subunit 3 [Ovibos moschatus]
          Length = 261

 Score =  131 bits (329), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIVSEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIMLGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYISIYWWG 260


>gi|260778347|ref|ZP_05887240.1| cytochrome O ubiquinol oxidase subunit III [Vibrio coralliilyticus
           ATCC BAA-450]
 gi|260606360|gb|EEX32645.1| cytochrome O ubiquinol oxidase subunit III [Vibrio coralliilyticus
           ATCC BAA-450]
          Length = 198

 Score =  131 bits (329), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 96/193 (49%), Positives = 122/193 (63%), Gaps = 2/193 (1%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            D        +    GFW+YLMSDC++FA  F TYAVL     +GP   D+F++  +FV 
Sbjct: 8   HDHDHHDTSGNKL-FGFWVYLMSDCVLFATLFATYAVLESGSISGPTGKDIFELPFVFVE 66

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T++LL SS++  F M+A   K  +     WL VT   G+ FI ME+YEF HLI+    PQ
Sbjct: 67  TMLLLFSSITFGFGMIAMKRKD-VAGLKRWLQVTFLLGLGFIGMEVYEFHHLIAEGYGPQ 125

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
            SAFLS+FF LVG HGLHV FGLIWL V   Q+  KGL      R  CLS+FWHFLD++W
Sbjct: 126 ASAFLSAFFTLVGTHGLHVTFGLIWLAVCYHQLSTKGLNDNMAMRFNCLSLFWHFLDIVW 185

Query: 198 ICVFSFVYLMGVV 210
           ICVF+ VYL+GV+
Sbjct: 186 ICVFTIVYLLGVM 198


>gi|154760703|ref|YP_001425504.1| cytochrome c oxidase subunit III [Osteolaemus tetraspis]
 gi|154425190|emb|CAM35765.1| cytochrome oxidase subunit III [Osteolaemus tetraspis]
          Length = 261

 Score =  131 bits (329), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 40/195 (20%), Positives = 75/195 (38%), Gaps = 9/195 (4%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDISG 73
              +     G   G  +++ S+ L F  FF  +     +          P  I   D   
Sbjct: 69  GHHTPPVQKGLRYGMILFITSEVLFFLGFFWAFYHSSLSPTPELGGQWPPTGITTLDPFE 128

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           + +    +LL+S         S  K      +  L++T   G+ F  ++  E+       
Sbjct: 129 VPLLNTAVLLASGVTVTWAHHSLMKADRKSAIHALMLTIILGLYFTALQAMEY---YEAP 185

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
                S++ S+FF   G HGLHV  G  +L   + + +     S +       + +WHF+
Sbjct: 186 FTIADSSYGSTFFVATGFHGLHVIIGSTFLTACLYRQIMYHFTSNHHFGFEAAAWYWHFV 245

Query: 194 DLIWICVFSFVYLMG 208
           D++W+ ++  +Y  G
Sbjct: 246 DVVWLFLYISIYWWG 260


>gi|298110824|gb|ADI57781.1| cytochrome c oxidase subunit III [Ovis ammon]
          Length = 261

 Score =  131 bits (329), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRYHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|212639692|ref|YP_002316212.1| cytochrome caa3 oxidase subunit III [Anoxybacillus flavithermus
           WK1]
 gi|212561172|gb|ACJ34227.1| Cytochrome caa3 oxidase (subunit III) [Anoxybacillus flavithermus
           WK1]
          Length = 206

 Score =  131 bits (329), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 69/192 (35%), Positives = 113/192 (58%), Gaps = 1/192 (0%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++    +LGFW +L  + ++FA  F T+  L  + A GP   ++F +  +F++T
Sbjct: 15  EPEKATLEGKNKFLGFWFFLGGETVLFASLFATFLALRDSVANGPTAEELFKMPIVFLAT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           ++LL SSL+  +AM          K   WL +T   G  F+ +EIYEF   +        
Sbjct: 75  MLLLTSSLTSVYAMHHMRNFDFK-KMQLWLGITVLLGAGFLALEIYEFTEYVHEGFKFST 133

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF SSF+ LVG HG HV FGL+W+  L+++  K+GL   N  +    S++WHF+D++W+
Sbjct: 134 SAFSSSFYTLVGTHGGHVAFGLLWIITLMVRNAKRGLNLYNAPKFYVASLYWHFIDVVWV 193

Query: 199 CVFSFVYLMGVV 210
            +F+ VYLMG+V
Sbjct: 194 FIFTVVYLMGMV 205


>gi|157778684|gb|ABV70822.1| cytochrome c oxidase subunit III [Bos taurus]
 gi|157778698|gb|ABV70835.1| cytochrome c oxidase subunit III [Bos taurus]
          Length = 260

 Score =  131 bits (329), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 78/197 (39%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  +++ S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFITSEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRKH-MLQALFITITLGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V   + LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|2707241|gb|AAB92235.1| cytochrome oxidase subunit III [Tragelaphus eurycerus]
          Length = 261

 Score =  131 bits (329), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 41/196 (20%), Positives = 76/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               + V   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGHRNHVLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVTTGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|291612323|ref|YP_003540753.1| cytochrome c oxidase subunit III [Pseudoleptodeira latifasciata]
 gi|189164379|gb|ACD77322.1| cytochrome c oxidase subunit III [Pseudoleptodeira latifasciata]
          Length = 261

 Score =  131 bits (329), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 39/198 (19%), Positives = 76/198 (38%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF     +             P  I   D
Sbjct: 66  TYQGHHTKGVQKNMRYGMILFITSEVFFFLGFFWALYHVSLVPTPELGAEWPPVGITPLD 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +  K    + +  L++T   G+ F  +++ E+    
Sbjct: 126 PMEVPLLNTTVLLSSGATITWSHHTMMKGNKKEAIYTLMITILLGVYFTALQMSEYQ--- 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L V ++++++    + +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVLIGTSFLLVCMLRLMQNHFTTTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDIVWLFLYISVYWWG 260


>gi|27543912|dbj|BAC54741.1| Cytochrome c oxidase polypeptide III [Bos taurus]
 gi|27543926|dbj|BAC54754.1| Cytochrome c oxidase polypeptide III [Bos taurus]
 gi|27543940|dbj|BAC54767.1| cytochrome c oxidase polypeptide III [Bos taurus]
 gi|27543954|dbj|BAC54780.1| cytochrome c oxidase polypeptide III [Bos taurus]
 gi|27543968|dbj|BAC54793.1| cytochrome c oxidase polypeptide III [Bos taurus]
 gi|27543982|dbj|BAC54806.1| cytochrome c oxidase polypeptide III [Bos taurus]
 gi|27543996|dbj|BAC54819.1| cytochrome c oxidase polypeptide III [Bos taurus]
          Length = 260

 Score =  130 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 79/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRKH-MLQALFITITLGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V   + LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAGAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|207559791|gb|ACI24399.1| cytochrome c oxidase subunit 3 [Ammotragus lervia]
          Length = 261

 Score =  130 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|215399133|ref|YP_002332264.1| cytochrome c oxidase subunit III [Phoenicolacerta kulzeri]
 gi|213983281|gb|ACJ54965.1| cytochrome c oxidase subunit III [Phoenicolacerta kulzeri]
          Length = 261

 Score =  130 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 41/201 (20%), Positives = 85/201 (42%), Gaps = 15/201 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPID 67
                 +     G   G  +++ S+ L F  FF  +             +    G  P++
Sbjct: 66  TYQGHHTMPVQKGLRYGMILFITSEVLFFMGFFWAFYHSSLAPTPELGGQWPPNGIQPLN 125

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
            F++    ++T VLL S ++ ++A  A    +     +  L +T   G+ F +++  E+ 
Sbjct: 126 AFEVP--LLNTAVLLASGVTVTWAHHALMEGKRKD-MIQALTMTITLGLYFTLLQASEY- 181

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
                      S + ++FF   G HGLHV  G  +L + +I+ +     + +       +
Sbjct: 182 --YETPFTIADSVYGTTFFVATGFHGLHVIIGSTFLLICLIRQMFYHFTTNHHFGFEAAA 239

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ ++  +Y  G
Sbjct: 240 WYWHFVDVVWLFLYVSIYWWG 260


>gi|5921888|sp|O47687|COX3_TRASR RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2707247|gb|AAB92238.1| cytochrome oxidase subunit III [Tragelaphus scriptus]
          Length = 261

 Score =  130 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 41/196 (20%), Positives = 76/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               + V   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGHRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|207560029|gb|ACI24620.1| cytochrome c oxidase subunit 3 [Rupicapra rupicapra]
          Length = 261

 Score =  130 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 39/196 (19%), Positives = 74/196 (37%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   +  K    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQXKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|221198371|ref|ZP_03571417.1| ubiquinol oxidase, subunit III [Burkholderia multivorans CGD2M]
 gi|221208952|ref|ZP_03581949.1| ubiquinol oxidase, subunit III [Burkholderia multivorans CGD2]
 gi|221215751|ref|ZP_03588711.1| ubiquinol oxidase, subunit III [Burkholderia multivorans CGD1]
 gi|221164363|gb|EED96849.1| ubiquinol oxidase, subunit III [Burkholderia multivorans CGD1]
 gi|221171235|gb|EEE03685.1| ubiquinol oxidase, subunit III [Burkholderia multivorans CGD2]
 gi|221182303|gb|EEE14704.1| ubiquinol oxidase, subunit III [Burkholderia multivorans CGD2M]
          Length = 202

 Score =  130 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 101/195 (51%), Positives = 130/195 (66%), Gaps = 7/195 (3%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            D          +  GFW+YLM+DC++FA  F T+AVLG  YA GP   D+FDI G+ + 
Sbjct: 13  HDDHPP----SHSVFGFWLYLMTDCVIFAALFATFAVLGNQYAGGPTAKDLFDIPGVAIE 68

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T  LLLSS++  FAMLA+  K+     + WL VT   G  F+ ME+ EF+HLI+  A PQ
Sbjct: 69  TAALLLSSITYGFAMLAA-YKQRRGALLGWLAVTFVLGAAFLAMELREFSHLIAEGAGPQ 127

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLICLSMFWHFLDL 195
           RSAFLS+FF LVG HGLHV  GL+W+ VL  QI+ +G  L   + RRL CLS+FWHFLD+
Sbjct: 128 RSAFLSAFFTLVGTHGLHVTAGLLWMIVLAGQIVARGGDLTDRDLRRLTCLSLFWHFLDI 187

Query: 196 IWICVFSFVYLMGVV 210
           +WICVF+FVYL  V+
Sbjct: 188 VWICVFTFVYLASVI 202


>gi|73538404|ref|YP_298771.1| cytochrome O ubiquinol oxidase subunit III [Ralstonia eutropha
           JMP134]
 gi|72121741|gb|AAZ63927.1| cyoC2, RSc1860; probable transmembrane cytochrome O ubiquinol
           oxidase (subunit III) oxidoreductase protein [Ralstonia
           eutropha JMP134]
          Length = 220

 Score =  130 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 99/197 (50%), Positives = 126/197 (63%), Gaps = 7/197 (3%)

Query: 17  VKDKKESCVDHD------GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFD 70
           V     +  +HD       T LGFW+YLMSDCL+FAV F TY VLG + A GPA  ++FD
Sbjct: 20  VHHAAHTGAEHDAHASEGHTTLGFWLYLMSDCLIFAVLFATYGVLGNHTAGGPAGRELFD 79

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHK-TVSWLLVTAFFGMIFIIMEIYEFAHL 129
           +  + V T++LL SS +   AM++    R   +  + WL +T   G  FI MEIYEF  L
Sbjct: 80  LRFVLVETMLLLCSSYTFGMAMMSIKNGRGEVRDVIRWLAITFMLGACFIGMEIYEFREL 139

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
           +   A PQRSA LS+FF LVG HG+HV  GL W+ VL  Q+   GL +  +RRL CLS+F
Sbjct: 140 LHEGAGPQRSAALSAFFMLVGTHGMHVAAGLAWIVVLAHQMQAFGLDAIVRRRLACLSLF 199

Query: 190 WHFLDLIWICVFSFVYL 206
           WHFLDL+WICVF+FVYL
Sbjct: 200 WHFLDLVWICVFTFVYL 216


>gi|57282267|emb|CAD32362.1| cytochrome oxidase subunit 3 [Eustrephus latifolius]
          Length = 265

 Score =  130 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 42/199 (21%), Positives = 82/199 (41%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   GF ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGPRYGFILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF+  G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFSATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|32526849|ref|NP_871754.1| cytochrome c oxidase subunit III [Hemiechinus auritus]
 gi|32469158|dbj|BAC78854.1| cytochrome oxidase subunit 3 [Hemiechinus auritus]
          Length = 261

 Score =  130 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 41/196 (20%), Positives = 80/196 (40%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA------AGPAPIDVFDIS 72
               + +   G   G  ++++S+ L F  FF  +                PA +   +  
Sbjct: 68  QGHHTPIVQKGLRYGMVLFIISEVLFFTGFFWAFYHSSLVPTTELGGYWPPAGVKPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  ++     +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTAVLLASGVSVTWAHHSILEKNRISAIQALTITISLGLYFTLLQAMEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                 S + S+FF   G HGLHV  G  +L V +++ LK    S +       + +WHF
Sbjct: 185 PFTIADSIYGSTFFMATGFHGLHVIIGSSFLIVCLMRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|218288764|ref|ZP_03493027.1| cytochrome c oxidase subunit III [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218241122|gb|EED08298.1| cytochrome c oxidase subunit III [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 211

 Score =  130 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 82/210 (39%), Positives = 120/210 (57%), Gaps = 7/210 (3%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           M     G +   +L Y   +  + +      LGFWI+L +D ++F   F TY VL  +  
Sbjct: 8   MEDTGGGGARALALEYTHAEDRTRI------LGFWIFLATDMILFGCLFATYLVLRTHTD 61

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
            GP P  +FD+ G    T+ LL SS +   A L+    R       W+ VT   G+ F+ 
Sbjct: 62  GGPTPATLFDMKGFGAETLALLTSSFTGGLATLSMRDGRQKS-VAFWMSVTIVLGLTFLS 120

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           +E  EFAH   + AV QRSAFLSSFF LVG HG HV FG++W+ V + Q+L++GL     
Sbjct: 121 IEASEFAHDAFIGAVWQRSAFLSSFFTLVGTHGCHVTFGVLWMLVTLYQVLRRGLTPRTA 180

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           R++  ++++WHFLD++WI +F+ VYL G+V
Sbjct: 181 RKVFVVNLYWHFLDVVWIFIFTVVYLTGMV 210


>gi|25057587|ref|NP_739769.1| cytochrome c oxidase subunit III [Caulophryne pelagica]
 gi|25005684|dbj|BAC23339.1| cytochrome c oxidase subunit III [Caulophryne jordani]
          Length = 261

 Score =  130 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 43/196 (21%), Positives = 87/196 (44%), Gaps = 15/196 (7%)

Query: 22  ESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK---------NYAAGPAPIDVFDIS 72
            +     G   G  +++ S+ L FA FF  +                 +G   +D F++ 
Sbjct: 71  HTPPVQKGLRYGMILFITSEVLFFAGFFWAFYHSSLAPTPELGGCWPPSGVTALDPFEVP 130

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
              ++T VLL S ++ ++A  +    +     +  LL+T   G  F +++  E+      
Sbjct: 131 --LLNTAVLLASGVTVTWAHHSIMAGQRRQA-IHSLLLTVLLGFYFTLLQAMEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G ++L + +++ ++    SG+       + +WHF
Sbjct: 185 PFTIADGVYGSTFFIATGFHGLHVIIGTLFLAICLLRQIQHHFTSGHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|218678939|ref|ZP_03526836.1| Cytochrome-c oxidase [Rhizobium etli CIAT 894]
          Length = 219

 Score =  130 bits (328), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 45/206 (21%), Positives = 85/206 (41%), Gaps = 17/206 (8%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA--------------VLGKNYAAG 62
             +   + V       G  +++ S+ + F  +F  Y               +L       
Sbjct: 8   AHEGAHTRVVSLHLRYGMIMFIASEVMFFVAWFWAYFDASLYPNEAIQAARLLYTGGTWP 67

Query: 63  PAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIME 122
           P  I+V D   + +   V+LL S +       +         +  L++T   G++F  ++
Sbjct: 68  PKGIEVLDPWHLPIYNTVILLLSGTTVTWAHHALLHNDRKGLIQGLVLTVLLGVLFSCVQ 127

Query: 123 IYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRR 182
            YE+AH        + S + ++FF   G HG HV  G I+L V +I+ L+          
Sbjct: 128 AYEYAH---APFAFKNSIYGATFFMATGFHGFHVLVGTIFLLVCLIRALRGDFTPKQHFG 184

Query: 183 LICLSMFWHFLDLIWICVFSFVYLMG 208
               + +WHF+D++W+ +F  +Y+ G
Sbjct: 185 FEAAAWYWHFVDVVWLFLFFCIYVWG 210


>gi|2731942|gb|AAB93621.1| cytochrome oxidase subunit III [Gazella dorcas]
          Length = 261

 Score =  130 bits (328), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPNVQKGLRYGMILFIISEILFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|1169063|sp|P08745|COX3_OENBE RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
          Length = 265

 Score =  130 bits (328), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 42/199 (21%), Positives = 82/199 (41%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDIS 72
           +   + V   G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKVVQLGLRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPW 130

Query: 73  -GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +LL S  + ++A  A    +   + V  L+ T    ++F   +  E+     
Sbjct: 131 EIPFLNTPILLSSGAAVTWAHHAILAGKEK-RAVYALVATVSLAIVFTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                  S + S+F+   G HG HV  G ++  +  I+     L   +       + +WH
Sbjct: 187 APPTISDSIYGSTFYLATGFHGFHVIIGTLFSIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ + +F  +Y  G +
Sbjct: 247 FVDVVRLFLFVSIYWWGGI 265


>gi|288908834|dbj|BAI77085.1| cytochrome c oxidase subunit III [Caulophryne pelagica]
          Length = 261

 Score =  130 bits (328), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 43/196 (21%), Positives = 87/196 (44%), Gaps = 15/196 (7%)

Query: 22  ESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK---------NYAAGPAPIDVFDIS 72
            +     G   G  +++ S+ L FA FF  +                 +G   +D F++ 
Sbjct: 71  HTPPVQKGLRYGMILFITSEVLFFAGFFWAFYHSSLAPTPELGGCWPPSGVTALDPFEVP 130

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
              ++T VLL S ++ ++A  +    +     +  LL+T   G  F +++  E+      
Sbjct: 131 --LLNTAVLLASGVTVTWAHHSIMAGQRRQA-IHSLLLTVLLGFYFTLLQAMEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G ++L + +++ ++    SG+       + +WHF
Sbjct: 185 PFTIADGVYGSTFFIATGFHGLHVIIGTLFLAICLLRQVQHHFTSGHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|57282239|emb|CAD32348.1| cytochrome oxidase subunit 3 [Rhodohypoxis milloides]
          Length = 265

 Score =  130 bits (328), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 42/199 (21%), Positives = 82/199 (41%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   GF ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGLRYGFLLFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF+  G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFSATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|157736208|ref|YP_001491350.1| cytochrome c oxidase subunit III [Triacanthodes anomalus]
 gi|139000706|dbj|BAF51874.1| cytochrome c oxidase subunit III [Triacanthodes anomalus]
          Length = 261

 Score =  130 bits (328), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 39/196 (19%), Positives = 74/196 (37%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  +++ S+ L F  FF  +                P  I   D  
Sbjct: 68  QGHHTPPVQKGLRFGMILFITSEVLFFVGFFWAFYHSSLAPTPELGGCWPPTGITTLDPF 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +    + +  L +T   G  F  ++  E+      
Sbjct: 128 EVPLLNTAVLLASGVTVTWAHHSIMEGERKQAIQSLFLTILLGFYFTFLQAMEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V +++ ++    S +       + +WHF
Sbjct: 185 PFTIADGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQIQYHFTSEHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYISIYWWG 260


>gi|114327938|ref|YP_745095.1| cytochrome O ubiquinol oxidase subunit III [Granulibacter
           bethesdensis CGDNIH1]
 gi|114316112|gb|ABI62172.1| cytochrome O ubiquinol oxidase subunit III [Granulibacter
           bethesdensis CGDNIH1]
          Length = 207

 Score =  130 bits (328), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 96/193 (49%), Positives = 130/193 (67%), Gaps = 3/193 (1%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTI 79
           +     +H  T  GFW+YLM+DC++F+  F  +AV    +A GP   ++FD+  + + T 
Sbjct: 16  EHAHHDEHGKTVFGFWLYLMTDCILFSGLFAAFAVARSQFAGGPTGQEIFDLKDVAIETA 75

Query: 80  VLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRS 139
           +LL SS++  FAML +     +  T+ WL VT  FG+ F++ME+ EF+HLI+  A P RS
Sbjct: 76  LLLFSSITYGFAMLQAHK-HRLGGTLQWLGVTFLFGLGFLLMEVKEFSHLIAEGAGPDRS 134

Query: 140 AFLSSFFALVGLHGLHVFFGLIWLFVLVIQ--ILKKGLISGNQRRLICLSMFWHFLDLIW 197
           AFLS+FF LVG HGLHV  GL+W+ VLV Q  +LKKGL      RL CLS+FWHFLD++W
Sbjct: 135 AFLSAFFTLVGTHGLHVTCGLLWMAVLVFQLGVLKKGLTPAYMSRLTCLSLFWHFLDIVW 194

Query: 198 ICVFSFVYLMGVV 210
           ICVFSFVYL GV+
Sbjct: 195 ICVFSFVYLAGVL 207


>gi|94676901|ref|YP_588719.1| cytochrome o ubiquinol oxidase, subunit III [Baumannia
           cicadellinicola str. Hc (Homalodisca coagulata)]
 gi|94220051|gb|ABF14210.1| cytochrome o ubiquinol oxidase, subunit III [Baumannia
           cicadellinicola str. Hc (Homalodisca coagulata)]
          Length = 203

 Score =  130 bits (328), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 93/179 (51%), Positives = 123/179 (68%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWIYLMSDC++FA+ F TY VL  + A GP+  ++F++  +   T  LLLSSL+   A
Sbjct: 26  LGFWIYLMSDCILFAMLFATYVVLSHSIAGGPSGKEIFELPAVQFETFCLLLSSLTYGIA 85

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +LA   ++  +  + WL  T   G+ FII+EI EF +LI     P RSAFLS FF+LV  
Sbjct: 86  ILA-MYRKQNNSVILWLFCTFILGLGFIIVEIMEFYNLIINGFGPNRSAFLSGFFSLVAT 144

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  GLIW+ V+++ + KKGL   NQ RL CLS+FWHFLD+IWICVF+ VYL+GV+
Sbjct: 145 HGCHVISGLIWIMVMIVHVYKKGLTLDNQIRLQCLSLFWHFLDIIWICVFTVVYLLGVL 203


>gi|70987657|gb|AAZ16695.1| cytochrome c oxidase subunit III [Bos taurus]
          Length = 260

 Score =  130 bits (328), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 79/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRKH-MLQALFITITLGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V   + LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAATWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|207559875|gb|ACI24477.1| cytochrome c oxidase subunit 3 [Capra pyrenaica]
          Length = 261

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 74/196 (37%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +      +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRSHMLQALFITITLGLYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYMSIYWWG 260


>gi|288903485|ref|YP_003434201.1| cytochrome c oxidase subunit III [Cervus elaphus xanthopygus]
 gi|288903535|ref|YP_003434289.1| cytochrome c oxidase subunit III [Cervus elaphus yarkandensis]
 gi|312233472|ref|YP_004021871.1| cytochrome c oxidase subunit III [Cervus elaphus songaricus]
 gi|285013437|gb|ADC32715.1| cytochrome c oxidase subunit III [Cervus elaphus xanthopygus]
 gi|285013451|gb|ADC32728.1| cytochrome c oxidase subunit III [Cervus elaphus yarkandensis]
 gi|309399287|gb|ADO78920.1| cytochrome c oxidase subunit III [Cervus elaphus songaricus]
          Length = 261

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|77020045|ref|YP_337830.1| cytochrome c oxidase subunit III [Pantholops hodgsonii]
 gi|74419060|gb|ABA03260.1| cytochrome c oxidase subunit 3 [Pantholops hodgsonii]
          Length = 261

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 74/196 (37%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +      +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRIPMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|294679508|gb|ADF29551.1| cytochrome c oxidase subunit III [Pseudorca crassidens]
 gi|325511661|gb|ADZ22993.1| cytochrome c oxidase subunit III [Pseudorca crassidens]
 gi|325511675|gb|ADZ23006.1| cytochrome c oxidase subunit III [Pseudorca crassidens]
          Length = 261

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 81/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               +     G   G  ++++S+ L F  FF  +  + L      G +            
Sbjct: 68  QGHHTPTVQKGLRYGMILFILSEVLFFTGFFWAFYHSSLAPTPELGGSWPPTGIRPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  LL+T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MLQALLITIVLGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +     S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFMATGFHGLHVIIGSTFLIVCFMRQMMFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|68989235|ref|YP_254706.1| cytochrome c oxidase subunit III [Cervus nippon yakushimae]
 gi|67625642|dbj|BAD99593.1| Cytochrome c oxidase subunit3 [Cervus nippon yakushimae]
          Length = 261

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|299829096|ref|YP_003735111.1| cytochrome c oxidase subunit III [Hydrolagus lemures]
 gi|298110908|gb|ADI57859.1| cytochrome c oxidase subunit III [Hydrolagus lemures]
          Length = 261

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 83/199 (41%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK---------NYAAGPAPIDVF 69
               +     G   G  +++ S+ L F  FF  +                  G  P+D F
Sbjct: 68  QGHHTPPVQKGMRWGMILFITSEVLFFLGFFWAFYHSSLAPTPELGNCWPPTGIHPLDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T +LL S ++ ++A  +        +    L +T   G+ F +++  E+   
Sbjct: 128 NVP--LLNTAILLASGVTITWAHHSLMEGT-RKEMTQALTLTVILGVYFTLLQAMEY--- 181

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + S+FF   G HGLHV  G  +L V +++ ++    S +       + +
Sbjct: 182 YEAPFTISDGIYGSTFFVATGFHGLHVIIGTTFLLVCLMRQIQYHFTSMHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYVSIYWWG 260


>gi|145315421|gb|ABP62982.1| cytochrome c oxidase subunit III [Osteolaemus tetraspis]
          Length = 262

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 40/195 (20%), Positives = 75/195 (38%), Gaps = 9/195 (4%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDISG 73
              +     G   G  +++ S+ L F  FF  +     +          P  I   D   
Sbjct: 70  GHHTPPVQKGLRYGMILFITSEVLFFLGFFWAFYHSSLSPTPELGGQWPPTGITTLDPFE 129

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           + +    +LL+S         S  K      +  L++T   G+ F  ++  E+       
Sbjct: 130 VPLLNTAVLLASGVTVTWAHHSLMKADRKSAIHALMLTIILGLYFTALQAMEY---YEAP 186

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
                S++ S+FF   G HGLHV  G  +L   + + +     S +       + +WHF+
Sbjct: 187 FTIADSSYGSTFFVATGFHGLHVIIGSTFLTACLYRQIMYHFTSNHHFGFEAAAWYWHFV 246

Query: 194 DLIWICVFSFVYLMG 208
           D++W+ ++  +Y  G
Sbjct: 247 DVVWLFLYISIYWWG 261


>gi|300508208|dbj|BAJ10943.1| cytochrome c oxidase subunit 3 [Rana holsti]
          Length = 246

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 42/196 (21%), Positives = 76/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYA----AGPAPIDVFDIS 72
               +     G   G  +++ S+   F  FF  Y  A L           PA I  F+  
Sbjct: 53  QGHHTPPVQTGLRYGMILFITSEVFFFIGFFWAYYNASLAPTPEVGECWPPAGITPFNPF 112

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            I +    +LL+S         S  +      +  L +T   G+ F +++  E+      
Sbjct: 113 EIPLLNTAVLLASGVSVTWAHHSIMQADRKGALQALAITITLGLYFTLLQAMEY---YEA 169

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + ++FF   G HGLHV  G  +L +  ++ L     S +       + +WHF
Sbjct: 170 PFTIADGIYGTTFFVATGFHGLHVIIGSAFLIMCFLRQLYFHFTSQHHFGFEAAAWYWHF 229

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 230 VDVVWLFLYVSIYWWG 245


>gi|5921886|sp|O47686|COX3_TRAOR RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2707245|gb|AAB92237.1| cytochrome oxidase subunit III [Tragelaphus oryx]
          Length = 261

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 41/196 (20%), Positives = 76/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               + V   G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPVVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGHRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|13172|emb|CAA28459.1| unnamed protein product [Oenothera berteroana]
          Length = 265

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 42/199 (21%), Positives = 83/199 (41%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFF--VTYAVLGKNYAAG----PAPIDVFDIS 72
           +   + V   G   G  ++++S+ +    FF   +++ L      G    P  I V D  
Sbjct: 71  EGHHTKVVQLGLRYGSILFIVSEVMFLFAFFRASSHSSLAPTVEIGGIWPPKGIGVLDPW 130

Query: 73  -GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +LL S  + ++A  A    +   + V  L+ T    ++F   +  E+     
Sbjct: 131 EIPFLNTPILLSSGAAVTWAHHAILAGKEK-RAVYALVATVSLAIVFTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                  S + S+F+   G HG HV  G ++  +  I+     L   +       + +WH
Sbjct: 187 APPTISDSIYGSTFYLATGFHGFHVIIGTLFSIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ + +F  +Y  G +
Sbjct: 247 FVDVVRLFLFVSIYWWGGI 265


>gi|332886937|dbj|BAK23049.1| cytochrome c oxidase subunit III [Luciosoma bleekeri]
          Length = 261

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 41/197 (20%), Positives = 81/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  +++ S+ L F  FF  +                PA +   D  
Sbjct: 68  QGHHTPPVQKGLRYGMILFITSEVLFFLGFFWAFYHSSLAPTPELGGCWPPAGVTTLDPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S ++ ++A  +    +  ++ +  L +T   G+ F  ++  E+     
Sbjct: 128 EVPLLNTAVLLASGVTVTWAHHSIMEGK-RNQAIQSLTLTILLGLYFTALQAMEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V +++ +     S +       + +WH
Sbjct: 184 APFTVADGVYGSTFFVATGFHGLHVIIGSTFLAVCLMRQVLHHFTSEHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|325914850|ref|ZP_08177185.1| cytochrome bo3 quinol oxidase subunit 3 [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325538941|gb|EGD10602.1| cytochrome bo3 quinol oxidase subunit 3 [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 210

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 100/182 (54%), Positives = 126/182 (69%), Gaps = 1/182 (0%)

Query: 29  GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSC 88
            T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL+SSLS 
Sbjct: 30  NTVFGFWVYLMSDCLLFAGLFATYAVLSGATVDGPTAKELFDLKFVLVETFLLLISSLSF 89

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            FAM+A+  +++      WL VTA  G+ F+ ME++EF HLI   A P RSAFLS+FF L
Sbjct: 90  GFAMIAAHKRKM-GGLYGWLAVTALLGIGFLCMEVWEFNHLIHEGAGPGRSAFLSAFFTL 148

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           VG HGLHV  GL+W+ VLVIQI K GL + N  RL CLS+FWHFLD+IWI VF+ VYL+G
Sbjct: 149 VGTHGLHVASGLLWMAVLVIQISKNGLTARNSTRLACLSLFWHFLDIIWIGVFTVVYLLG 208

Query: 209 VV 210
            +
Sbjct: 209 AL 210


>gi|207559903|gb|ACI24503.1| cytochrome c oxidase subunit 3 [Damaliscus pygargus]
          Length = 261

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTSAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNPMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSTHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|148559948|ref|YP_001258490.1| cytochrome c oxidase subunit III [Brucella ovis ATCC 25840]
 gi|148371205|gb|ABQ61184.1| cytochrome c oxidase, subunit III [Brucella ovis ATCC 25840]
          Length = 439

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 45/206 (21%), Positives = 86/206 (41%), Gaps = 19/206 (9%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMF---------AVFFV--TYAVLGKNY---AAGP 63
            +   + V       G  +++ S+ + F         A  F    + V    +      P
Sbjct: 82  HEGHHTRVVSLHLRYGMIMFIASEVMFFVAWFWAFFDASLFPNEVHQVARAEFTGGVWPP 141

Query: 64  APIDVFDI-SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIME 122
             I+V D       +T++LLLS  + ++A  A          ++ L +T   G++F  ++
Sbjct: 142 KGIEVLDPLHLPLYNTVILLLSGTTLTWAHHALL-HNDRKGMITGLAITVALGVLFSCVQ 200

Query: 123 IYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRR 182
            YE+   I      + S + ++FF   G HG HV  G I+L V + + +           
Sbjct: 201 AYEY---IHAPFAFKDSIYGATFFMATGFHGFHVLIGTIFLLVCLFRAIGGDFTPKQHFG 257

Query: 183 LICLSMFWHFLDLIWICVFSFVYLMG 208
               + +WHF+D++W+ +F  +Y+ G
Sbjct: 258 FEAAAWYWHFVDVVWLFLFFAIYVWG 283


>gi|325511689|gb|ADZ23019.1| cytochrome c oxidase subunit III [Peponocephala electra]
 gi|325511703|gb|ADZ23032.1| cytochrome c oxidase subunit III [Peponocephala electra]
          Length = 261

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 81/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               +     G   G  ++++S+ L F  FF  +  + L      G +            
Sbjct: 68  QGHHTPTVQKGLRYGMILFILSEVLFFTGFFWAFYHSSLAPTPELGGSWPPTGIRPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  LL+T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MLQALLITITLGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +     S +       + +WH
Sbjct: 184 APFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFMRQMMFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|86264084|gb|ABC87778.1| cytochrome c oxidase subunit 3 [Ovis aries]
 gi|158187284|gb|ABW22899.1| cytochrome c oxidase subunit 3 [Ovis aries]
          Length = 261

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 41/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   D  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLDPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRYHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|255506403|ref|YP_003097157.1| cytochrome c oxidase subunit III [Budorcas taxicolor]
 gi|197107931|gb|ACH42508.1| cytochrome c oxidase subunit 3 [Budorcas taxicolor]
          Length = 261

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 39/196 (19%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +         G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKSLRYGMILFIVSEVLFFTGFFWAFYHSSLAPTPELGSCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITITLGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V  ++ LK    S +       + +WHF
Sbjct: 185 PFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFLRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|148543108|ref|YP_001260505.1| cytochrome c oxidase subunit III [Ammotragus lervia]
 gi|126742202|gb|ABO27121.1| cytochrome c oxidase subunit 3 [Ammotragus lervia]
          Length = 261

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRNHMLQALFITIALGIYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|114770414|ref|ZP_01447952.1| Cytochrome c oxidase, aa3-type, subunit III [alpha proteobacterium
           HTCC2255]
 gi|114549251|gb|EAU52134.1| Cytochrome c oxidase, aa3-type, subunit III [alpha proteobacterium
           HTCC2255]
          Length = 280

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 49/206 (23%), Positives = 91/206 (44%), Gaps = 14/206 (6%)

Query: 14  LFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA----------VLGKNYAAGP 63
           +F  +    + V   G   G  +++MS+ + F  +F ++               +    P
Sbjct: 77  VFDSEAGDHTPVVVIGLRYGVIMFIMSEVMFFVAWFWSFFKNAMYPMGPMSPAVDGVWPP 136

Query: 64  APIDVFDIS-GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIME 122
             I+ FD      ++T++LL S    ++A  A A        V  L+     G IF + +
Sbjct: 137 VGIETFDPWHLPLINTLILLCSGCFATWAHHALAHDNDRKGLVWGLVGAIVLGAIFTVFQ 196

Query: 123 IYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRR 182
           +YE+ H        + + + ++FF   G HG HV  G I+L V +++ LK          
Sbjct: 197 VYEYGH---AAFSFRDNVYGANFFMATGFHGFHVVVGTIFLAVCLLRALKGHFTQERHVG 253

Query: 183 LICLSMFWHFLDLIWICVFSFVYLMG 208
               + +WHF+D++W+ +F+ VY+ G
Sbjct: 254 FEAAAWYWHFVDVVWLFLFAAVYIWG 279


>gi|62736200|ref|YP_227588.1| cytochrome c oxidase subunit III [Cervus nippon yesoensis]
 gi|30314643|dbj|BAC76079.1| cytochrome c oxidase subunit 3 [Cervus nippon yesoensis]
 gi|62241300|dbj|BAD93676.1| cytochrome c oxidase subunit 3 [Cervus nippon yesoensis]
          Length = 261

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 39/196 (19%), Positives = 74/196 (37%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +         G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKSLRYGMILFIVSEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|148922593|ref|YP_001293625.1| cytochrome c oxidase subunit III [Mammut americanum]
 gi|148540935|gb|ABQ86185.1| cytochrome c oxidase subunit III [Mammut americanum]
          Length = 261

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 42/196 (21%), Positives = 79/196 (40%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA------AGPAPIDVFDIS 72
               + +   G   G  ++++S+ L F  FF  +       A        P  I   +  
Sbjct: 68  QGHHTPIVQKGLRYGMILFIVSEVLFFTGFFWAFYHSSLAPAPELGSYWPPVGIYPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +      +  LL+T   G  F +++I+E+      
Sbjct: 128 EVPLLNTSVLLASGVTITWAHHSLMEGNRKNMLQALLITILLGAYFTLLQIFEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L +  I+ L+    S +       + +WHF
Sbjct: 185 SFTISDGIYGSTFFVTTGFHGLHVIIGSTFLLICFIRQLEFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYLSIYWWG 260


>gi|161524384|ref|YP_001579396.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           multivorans ATCC 17616]
 gi|189350861|ref|YP_001946489.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           multivorans ATCC 17616]
 gi|160341813|gb|ABX14899.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia
           multivorans ATCC 17616]
 gi|189334883|dbj|BAG43953.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           multivorans ATCC 17616]
          Length = 202

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 101/195 (51%), Positives = 131/195 (67%), Gaps = 7/195 (3%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            D          +  GFW+YLM+DC++FA  F T+AVLG  YA GP   D+FDI G+ + 
Sbjct: 13  HDDHPP----SHSVFGFWLYLMTDCVIFAALFATFAVLGNQYAGGPTAKDLFDIPGVAIE 68

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T  LLLSS++  FAMLA+  K+     ++WL VT   G  F+ ME+ EF+HLI+  A PQ
Sbjct: 69  TAALLLSSITYGFAMLAA-YKQRRGALLAWLAVTFVLGAAFLAMELREFSHLIAGGAGPQ 127

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLICLSMFWHFLDL 195
           RSAFLS+FF LVG HGLHV  GL+W+ VL  QI+ +G  L   + RRL CLS+FWHFLD+
Sbjct: 128 RSAFLSAFFTLVGTHGLHVTAGLLWMIVLAGQIVARGGDLTDRDLRRLTCLSLFWHFLDI 187

Query: 196 IWICVFSFVYLMGVV 210
           +WICVF+FVYL  V+
Sbjct: 188 VWICVFTFVYLASVI 202


>gi|307941662|ref|ZP_07657017.1| cytoChrome c oxidase subunit 3 [Roseibium sp. TrichSKD4]
 gi|307775270|gb|EFO34476.1| cytoChrome c oxidase subunit 3 [Roseibium sp. TrichSKD4]
          Length = 288

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 41/206 (19%), Positives = 78/206 (37%), Gaps = 17/206 (8%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA--------------VLGKNYAAG 62
             +   + V       G  +++ S+ + F  +F  Y               V        
Sbjct: 85  AHEGHHTRVVSLHLRYGMIMFIASEVMFFVAWFWAYFDASLFAGEAINYARVEATGGQWP 144

Query: 63  PAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIME 122
           P  I+ FD   + +   ++LL S +       +            L+ T   G++F I +
Sbjct: 145 PVGIETFDPWHLPLLNTLILLLSGTTVTWAHHALLHDDREGLKWGLIFTVILGILFSICQ 204

Query: 123 IYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRR 182
            YE+ H          + + ++F+   G HG HV  G I+L V + + L           
Sbjct: 205 AYEYGH---AAFDFSGNIYGATFYMATGFHGFHVIVGTIFLAVCLFRALAGHFTPKQHFG 261

Query: 183 LICLSMFWHFLDLIWICVFSFVYLMG 208
               + +WHF+D++W+ +F  +Y+ G
Sbjct: 262 FEAAAWYWHFVDVVWLFLFVAIYIWG 287


>gi|291612365|ref|YP_003540792.1| cytochrome c oxidase subunit III [Hypsiglena ochrorhyncha klauberi]
 gi|189164421|gb|ACD77361.1| cytochrome c oxidase subunit III [Hypsiglena ochrorhyncha klauberi]
          Length = 261

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 40/198 (20%), Positives = 75/198 (37%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF     +             P  I   D
Sbjct: 66  TYQGHHTKGVQKNMRYGMILFITSEVFFFLGFFWALYHVSLVPTPELGAEWPPTGIIPLD 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +  K    +    L+ T   G+ F  +++ E+   +
Sbjct: 126 PMEVPLLNTTVLLSSGATITWSHHTMMKGNKKEATYALMATIVLGVYFTALQMSEY---L 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L V +++++K    + +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMIGTSFLAVCILRLIKHHFTTTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDIVWLFLYISVYWWG 260


>gi|88766333|ref|YP_398760.2| cytochrome c oxidase subunit III [Mammuthus primigenius]
 gi|93204564|sp|Q38PR6|COX3_MAMPR RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
          Length = 261

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 45/197 (22%), Positives = 84/197 (42%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               + V  +G   G  +++ S+ L F  FF  +  + L      G     V        
Sbjct: 68  QGHHTPVVQEGLRYGMILFITSEVLFFTGFFWAFYHSSLAPTPELGSYWPPVGVYPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S ++ ++A  +       +  +  LL+T   G+ F +++++E+     
Sbjct: 128 EVPLLNTSVLLASGVTITWAHHSLMEGNRKN-MLQALLITILLGVYFTLLQMFEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L    I+ LK    S +       + +WH
Sbjct: 184 ASFTISDGIYGSTFFVTTGFHGLHVIIGSTFLLTCFIRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYLSIYWWG 260


>gi|207559819|gb|ACI24425.1| cytochrome c oxidase subunit 3 [Budorcas taxicolor]
          Length = 261

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 39/196 (19%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +         G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKSLRYGMILFIVSEVLFFTGFFWAFYHSSLAPTPELGSCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITITLGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V  ++ LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFLRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|86264082|gb|ABC87777.1| cytochrome c oxidase subunit 3 [Ovis aries]
 gi|126565915|gb|ABO20826.1| cytochrome c oxidase subunit 3 [Ovis aries]
 gi|126565917|gb|ABO20827.1| cytochrome c oxidase subunit 3 [Ovis aries]
 gi|126565921|gb|ABO20829.1| cytochrome c oxidase subunit 3 [Ovis aries]
 gi|151573890|gb|ABS18249.1| cytochrome oxidase subunit 3 [Ovis aries]
 gi|151573892|gb|ABS18250.1| cytochrome oxidase subunit 3 [Ovis aries]
 gi|151573894|gb|ABS18251.1| cytochrome oxidase subunit 3 [Ovis aries]
 gi|151573896|gb|ABS18252.1| cytochrome oxidase subunit 3 [Ovis aries]
 gi|151573898|gb|ABS18253.1| cytochrome oxidase subunit 3 [Ovis aries]
 gi|151573900|gb|ABS18254.1| cytochrome oxidase subunit 3 [Ovis aries]
 gi|151573902|gb|ABS18255.1| cytochrome oxidase subunit 3 [Ovis aries]
 gi|151573904|gb|ABS18256.1| cytochrome oxidase subunit 3 [Ovis aries]
 gi|158187242|gb|ABW22860.1| cytochrome c oxidase subunit 3 [Ovis aries]
 gi|158187256|gb|ABW22873.1| cytochrome c oxidase subunit 3 [Ovis aries]
 gi|158187270|gb|ABW22886.1| cytochrome c oxidase subunit 3 [Ovis aries]
 gi|158187298|gb|ABW22912.1| cytochrome c oxidase subunit 3 [Ovis aries]
 gi|158187312|gb|ABW22925.1| cytochrome c oxidase subunit 3 [Ovis aries]
 gi|298110628|gb|ADI57599.1| cytochrome c oxidase subunit III [Ovis aries]
 gi|298110642|gb|ADI57612.1| cytochrome c oxidase subunit III [Ovis aries]
 gi|298110656|gb|ADI57625.1| cytochrome c oxidase subunit III [Ovis aries]
 gi|298110670|gb|ADI57638.1| cytochrome c oxidase subunit III [Ovis aries]
 gi|298110684|gb|ADI57651.1| cytochrome c oxidase subunit III [Ovis aries]
 gi|298110698|gb|ADI57664.1| cytochrome c oxidase subunit III [Ovis aries]
 gi|298110712|gb|ADI57677.1| cytochrome c oxidase subunit III [Ovis aries]
 gi|298110726|gb|ADI57690.1| cytochrome c oxidase subunit III [Ovis aries]
 gi|298110768|gb|ADI57729.1| cytochrome c oxidase subunit III [Ovis aries musimon]
 gi|298110782|gb|ADI57742.1| cytochrome c oxidase subunit III [Ovis aries musimon]
 gi|298110796|gb|ADI57755.1| cytochrome c oxidase subunit III [Ovis vignei]
 gi|298110810|gb|ADI57768.1| cytochrome c oxidase subunit III [Ovis vignei]
 gi|298110838|gb|ADI57794.1| cytochrome c oxidase subunit III [Ovis vignei]
          Length = 261

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRYHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|83415383|gb|ABC17884.1| cytochrome c oxidase subunit III [Mammuthus primigenius]
          Length = 261

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 45/197 (22%), Positives = 84/197 (42%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               + V  +G   G  +++ S+ L F  FF  +  + L      G     V        
Sbjct: 68  QGHHTPVVQEGLRYGMILFITSEVLFFTGFFWAFYHSSLAPTPELGSYWPPVGVYPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S ++ ++A  +       +  +  LL+T   G+ F +++++E+     
Sbjct: 128 EVPLLNTSVLLASGVTITWAHHSLMEGNRKN-MLQALLITILLGVYFTLLQMFEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L    I+ LK    S +       + +WH
Sbjct: 184 ASFTISDGIYGSTFFVTTGFHGLHVIIGSTFLLTCFIRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYLSIYWWG 260


>gi|170743801|ref|YP_001772456.1| cytochrome o ubiquinol oxidase subunit III [Methylobacterium sp.
           4-46]
 gi|168198075|gb|ACA20022.1| cytochrome o ubiquinol oxidase, subunit III [Methylobacterium sp.
           4-46]
          Length = 208

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 105/203 (51%), Positives = 142/203 (69%), Gaps = 1/203 (0%)

Query: 8   KSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPID 67
             P  +     + +E      GT LGFW+YLM DCL+FAV F T+ VLG+NYAAGP+  D
Sbjct: 6   APPGATAPVFYETEEHAHGDGGTLLGFWVYLMGDCLIFAVLFATFGVLGRNYAAGPSGAD 65

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
           +FD+  + ++T +LLLSS++  FAML    K  +  T  WL++T  FG  F+++E+YEF 
Sbjct: 66  LFDLRLVALNTSLLLLSSITYGFAMLE-MDKDRLDMTRRWLIITGLFGAGFLMIELYEFG 124

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
           HLI   A PQRSAFLS+FF LVG HGLHV FG++WL  L+ Q+ + GL++  +R L+CLS
Sbjct: 125 HLIHEGATPQRSAFLSAFFTLVGTHGLHVTFGIVWLLTLLAQLRRYGLVAETRRGLLCLS 184

Query: 188 MFWHFLDLIWICVFSFVYLMGVV 210
           MFWHFLD++WI VF+FVYLMG +
Sbjct: 185 MFWHFLDVVWIGVFTFVYLMGAM 207


>gi|189164509|gb|ACD77442.1| cytochrome c oxidase subunit III [Hypsiglena ochrorhyncha klauberi]
          Length = 261

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 40/198 (20%), Positives = 75/198 (37%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF     +             P  I   D
Sbjct: 66  TYQGHHTKGVQKNMRYGMILFITSEVFFFLGFFWALYHVSLVPTPELGAEWPPTGIIPLD 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +  K    +    L+ T   G+ F  +++ E+   +
Sbjct: 126 PMEVPLLNTTVLLSSGATITWSHHTMMKGNKKEATYALMATIVLGVYFTALQMSEY---L 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L V +++++K    + +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMIGTSFLTVCILRLIKHHFTTTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDIVWLFLYISVYWWG 260


>gi|291612309|ref|YP_003540740.1| cytochrome c oxidase subunit III [Hypsiglena ochrorhyncha
           ochrorhyncha]
 gi|189164365|gb|ACD77309.1| cytochrome c oxidase subunit III [Hypsiglena ochrorhyncha
           ochrorhyncha]
          Length = 261

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 40/198 (20%), Positives = 75/198 (37%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF     +             P  I   D
Sbjct: 66  TYQGHHTKGVQKNMRYGMILFITSEVFFFLGFFWALYHVSLVPTPELGAEWPPTGIIPLD 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +  K    +    L+ T   G+ F  +++ E+   +
Sbjct: 126 PMEVPLLNTTVLLSSGATITWSHHTMMKGNKKEATYALMATIVLGVYFTALQMSEY---L 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L V +++++K    + +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMIGTSFLTVCILRLIKHHFTTTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDIVWLFLYISVYWWG 260


>gi|254419944|ref|ZP_05033668.1| cytochrome o ubiquinol oxidase, subunit III [Brevundimonas sp.
           BAL3]
 gi|196186121|gb|EDX81097.1| cytochrome o ubiquinol oxidase, subunit III [Brevundimonas sp.
           BAL3]
          Length = 207

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 109/184 (59%), Positives = 139/184 (75%), Gaps = 1/184 (0%)

Query: 27  HDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSL 86
              T LGFW+YLMSDCL+FA+ F  + VLG NYAAGP P ++FD+  + V+T +LL SS+
Sbjct: 24  GSSTMLGFWLYLMSDCLIFAMLFAVFGVLGGNYAAGPGPKELFDLELVAVNTAMLLFSSI 83

Query: 87  SCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFF 146
           +  FAMLA   K    +T+ WL +T  FG+ F+ +E+YEFAHLI   A PQRSAFLS+FF
Sbjct: 84  TYGFAMLA-MDKNNRTQTLIWLAITGLFGLAFLGIELYEFAHLIHEGATPQRSAFLSAFF 142

Query: 147 ALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
            LVG HGLHV FG+IWL  L++Q+  KGLI  N+RRL+CLSMFWHFLD+IWI VF+FVYL
Sbjct: 143 TLVGTHGLHVTFGIIWLVTLMVQVSWKGLIPANKRRLMCLSMFWHFLDVIWIGVFTFVYL 202

Query: 207 MGVV 210
           +G+V
Sbjct: 203 LGMV 206


>gi|2459615|gb|AAB71760.1| cytochrome c-oxidase subunit three [Ovis aries]
          Length = 267

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRYHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYMSIYWWG 260


>gi|164454833|dbj|BAF96958.1| cytochrome oxidase c subunit III [Mammuthus primigenius]
          Length = 262

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 45/197 (22%), Positives = 84/197 (42%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               + V  +G   G  +++ S+ L F  FF  +  + L      G     V        
Sbjct: 68  QGHHTPVVQEGLRYGMILFITSEVLFFTGFFWAFYHSSLAPTPELGSYWPPVGVYPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S ++ ++A  +       +  +  LL+T   G+ F +++++E+     
Sbjct: 128 EVPLLNTSVLLASGVTITWAHHSLMEGNRKN-MLQALLITILLGVYFTLLQMFEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L    I+ LK    S +       + +WH
Sbjct: 184 ASFTISDGIYGSTFFVTTGFHGLHVIIGSTFLLTCFIRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYLSIYWWG 260


>gi|5921865|sp|O47694|COX3_DAMLU RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|2731896|gb|AAB93598.1| cytochrome oxidase subunit III [Damaliscus lunatus]
          Length = 261

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTSAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSTHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|254721544|ref|ZP_05183333.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A1055]
          Length = 207

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 59/192 (30%), Positives = 105/192 (54%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++ +  ++GFW++L  + ++FA  F TY  L  +   GP   ++F +  +F+ T
Sbjct: 15  EPEKATLEGENKFVGFWLFLGGETVLFASLFGTYLALKNSTNGGPTSQEMFQMPLVFIMT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           ++LL SSL+  +AM            +  L+                + +    +   + 
Sbjct: 75  MLLLTSSLTSVYAMYHMKNFNFKKMQLWLLVTVLLGLGFLGFEIYEFYHYAHEFKHTMRS 134

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF S+F+ALVG HGLHV FGL W+  L+ +  K+GL   N  +    S++WHF+D++W+
Sbjct: 135 SAFGSAFYALVGTHGLHVLFGLCWILTLIFRNAKRGLNLYNAPKFYVASIYWHFIDVVWV 194

Query: 199 CVFSFVYLMGVV 210
            +F+ VYLMG+V
Sbjct: 195 FIFTVVYLMGMV 206


>gi|319945342|ref|ZP_08019604.1| cytochrome o ubiquinol oxidase subunit III [Lautropia mirabilis
           ATCC 51599]
 gi|319741912|gb|EFV94337.1| cytochrome o ubiquinol oxidase subunit III [Lautropia mirabilis
           ATCC 51599]
          Length = 210

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 94/197 (47%), Positives = 136/197 (69%), Gaps = 4/197 (2%)

Query: 14  LFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISG 73
            F++ +        +GT LGFW++L+ D L+FA  F  YAVLG++YA G +  D+FD+  
Sbjct: 17  QFHLTEAHPPE---NGTMLGFWLFLIGDLLLFACLFAAYAVLGRSYATGFSGADIFDLKL 73

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           + +ST +LL +S S    ++A       H T+ WL +T  FG+ F+ +EI+ F H+I M 
Sbjct: 74  VALSTALLLCASFSGGHGVVAMQDSE-KHATLGWLALTGLFGLTFLGIEIHAFNHMIGMG 132

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
           A PQRSAFLS+FFALVG+HGLHV FGL+WL  L++Q+ + GLI  N+RR+ CL++FWHFL
Sbjct: 133 ATPQRSAFLSAFFALVGIHGLHVAFGLVWLITLLVQVGQHGLIPANRRRIRCLTLFWHFL 192

Query: 194 DLIWICVFSFVYLMGVV 210
           D++W+ VFS VYL+G +
Sbjct: 193 DVVWVAVFSLVYLIGSL 209


>gi|189164463|gb|ACD77400.1| cytochrome c oxidase subunit III [Hypsiglena chlorophaea
           chlorophaea]
          Length = 261

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 40/198 (20%), Positives = 75/198 (37%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF     +             P  I   D
Sbjct: 66  TYQGHHTKGVQKNMRYGMILFITSEVFFFLGFFWALYHVSLVPTPELGAEWPPTGIIPLD 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +  K    +    L+ T   G+ F  +++ E+   +
Sbjct: 126 PMEVPLLNTTVLLSSGATITWSHHTMMKGNKKEATYALMATIMLGVYFTALQMSEY---L 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L V +++++K    + +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMIGTSFLIVCILRLIKHHFTTTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDIVWLFLYISVYWWG 260


>gi|325292155|ref|YP_004278019.1| cytochrome c oxidase subunit III [Agrobacterium sp. H13-3]
 gi|325060008|gb|ADY63699.1| cytochrome c oxidase subunit III [Agrobacterium sp. H13-3]
          Length = 291

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/206 (20%), Positives = 86/206 (41%), Gaps = 17/206 (8%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG--------------KNYAAG 62
             +   + V       G  +++ S+ + F  +F  Y                        
Sbjct: 81  ANEGSHTRVVSLHLRYGMIMFIASEVMFFVAWFWAYFDASLYPHEAIQASRLEYTGGQWP 140

Query: 63  PAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIME 122
           P  I+V D   + +   V+LL S +C      +         ++ L++T   G++F  ++
Sbjct: 141 PKGIEVIDPWHLPLYNTVILLLSGTCVTWAHHALLHNDRKGLITGLVLTVALGVLFSTVQ 200

Query: 123 IYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRR 182
           +YE+ H        + S + ++FF   G HG HVF G ++L V +++ +  G        
Sbjct: 201 VYEYMH---APFDFKNSIYGATFFMATGFHGFHVFVGTVFLLVCLLRAIAGGFTPKQHFG 257

Query: 183 LICLSMFWHFLDLIWICVFSFVYLMG 208
               + +WHF+D++W+ +F  +Y+ G
Sbjct: 258 FEAAAWYWHFVDVVWLFLFFAIYIWG 283


>gi|325511633|gb|ADZ22967.1| cytochrome c oxidase subunit III [Feresa attenuata]
 gi|325511647|gb|ADZ22980.1| cytochrome c oxidase subunit III [Feresa attenuata]
          Length = 261

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 42/197 (21%), Positives = 81/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               +     G   G  ++++S+ L F  FF  +  + L      G +            
Sbjct: 68  QGHHTPTVQKGLRYGMILFILSEVLFFTGFFWAFYHSSLAPTPELGGSWPPTGIHPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  LL+T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MLQALLITITLGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L +  ++ +     S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIICFMRQMMFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|91176223|ref|YP_537164.1| cytochrome c oxidase subunit III [Verasper variegatus]
 gi|90287786|gb|ABD92806.1| cytochrome c oxidase subunit III [Verasper variegatus]
          Length = 261

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 42/199 (21%), Positives = 83/199 (41%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPIDVF 69
               +     G   G  +++ S+ L F  FF  +                 AG  P+D F
Sbjct: 68  QGHHTLPVQKGLRYGMILFITSEVLFFLGFFWAFYHSSLAPTPELGGFWPPAGITPLDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  +    +   + +  L +T   G  F  ++  E+   
Sbjct: 128 EVP--LLNTAVLLASGVTVTWAHHSIMEGK-RKQAIQALALTILLGGYFTFLQALEYH-- 182

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + ++FF   G HGLHV  G  +L V +++ +     S +       + +
Sbjct: 183 -EAPFTIADGVYGATFFVATGFHGLHVLIGSSFLAVCLLRQILHHFTSNHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYISIYWWG 260


>gi|416824|sp|P32808|COX3_HELAN RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|443843|emb|CAA40865.1| cytochrome-c oxidase [Helianthus annuus]
          Length = 265

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/199 (21%), Positives = 82/199 (41%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFF--VTYAVLGKNYAAG----PAPIDVFDI- 71
           +   + V   G   GF ++++S+ +     F   +++ L      G    P  I V D  
Sbjct: 71  EGHHTKVVQLGPRYGFILFIVSEVMFLFALFRASSHSSLAPTVEIGGIWPPKGIAVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T + L S  + ++A  A    +   + V  L+ T    ++F   +  E+     
Sbjct: 131 EIPFLNTPIPLSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVFTAFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++  V  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFLATGFHGFHVIIGTLFSIVCGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|38707541|ref|NP_944743.1| cytochrome c oxidase subunit III [Lagenorhynchus albirostris]
 gi|38602564|emb|CAD88020.1| cytochrome c oxidase polypeptide III [Lagenorhynchus albirostris]
          Length = 261

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 82/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               +     G   G  ++++S+ L F  FF  +  + L      G +            
Sbjct: 68  QGHHTPTVQKGLRYGMILFILSEVLFFTGFFWAFYHSSLAPTPELGGSWPPTGIHPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  LL+T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MLQALLITIMLGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L +  ++ +     S +   L   + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIICFVRQMMFHFTSNHHFGLEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|148262490|ref|YP_001229196.1| cytochrome c oxidase, subunit III [Geobacter uraniireducens Rf4]
 gi|146395990|gb|ABQ24623.1| cytochrome c oxidase, subunit III [Geobacter uraniireducens Rf4]
          Length = 196

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 46/194 (23%), Positives = 89/194 (45%), Gaps = 5/194 (2%)

Query: 19  DKKESCVDH---DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDV-FDISGI 74
            K  +       +   LG W +L ++ L+F   F  Y VL            +  +    
Sbjct: 4   TKHTTEQQGAALETAKLGIWAFLATEVLLFGGLFTAYTVLRVGDPQMFHTEYLKLNRLFG 63

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            ++T+VL+ SSL+ +  + A    +        LL+T      F+ ++  E+A   +   
Sbjct: 64  AINTVVLITSSLTVALGIAAIREGKTGT-LKRCLLLTILLAAAFLGIKYAEYAEHFARGE 122

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
           +P+ + F S ++ + GLH +HVF G+  L  +++   +    +     +    ++WHF+D
Sbjct: 123 LPRTNNFFSLYYMMTGLHAIHVFAGMAALATMLVMAGRGKFSAEEHTPVEITGLYWHFVD 182

Query: 195 LIWICVFSFVYLMG 208
           L+WI +F  +YL+G
Sbjct: 183 LVWIYLFPLLYLIG 196


>gi|224588091|ref|YP_002640616.1| cytochrome c oxidase subunit III [Viridovipera stejnegeri
           stejnegeri]
 gi|224037281|gb|ACN37852.1| cytochrome c oxidase subunit 3 [Viridovipera stejnegeri stejnegeri]
          Length = 261

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 40/198 (20%), Positives = 77/198 (38%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF T   +             P  I+  +
Sbjct: 66  TYQGHHTLGVQKNMRYGMILFITSEVFFFLGFFWTLYHVSLVPTPELGAEWPPTGINPLN 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +  K    ++V  L +T   G  F  +++ E+    
Sbjct: 126 PMDVPLLNTAVLLSSGATITWSHHTMMKGNKKESVYALTITIILGAYFTALQVSEYM--- 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L V ++++++    + +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMIGTSFLLVCLMRLIQSHFTTTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDVVWLFLYVSVYWWG 260


>gi|223471668|ref|YP_002587105.1| cytochrome c oxidase subunit III [Grampus griseus]
 gi|170027004|gb|ACB06055.1| cytochrome c oxidase subunit III [Grampus griseus]
          Length = 261

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 81/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               +     G   G  ++++S+ L F  FF  +  + L      G +            
Sbjct: 68  QGHHTPTVQKGLRYGMILFILSEVLFFTGFFWAFYHSSLAPTPELGGSWPPTGIHPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  LL+T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MLQALLITITLGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +     S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFMRQMMFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|28881990|ref|NP_795800.1| cytochrome c oxidase subunit III [Nansenia ardesiaca]
 gi|28804919|dbj|BAC58205.1| cytochrome c oxidase subunit III [Nansenia ardesiaca]
          Length = 261

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 39/199 (19%), Positives = 80/199 (40%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK---------NYAAGPAPIDVF 69
           +   +     G   G  +++ S+   F   F  +                  G  P+D F
Sbjct: 68  EGDHTPPVQKGLRYGMILFITSEVFFFLGLFWAFYHASLAPTPELGGCWPPTGITPLDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  +        + +  L +T   G  F  ++  E+   
Sbjct: 128 EVP--LLNTAVLLASGVTVTWAHHSIMEGA-RKQAIQSLTLTIILGFYFTFLQGMEY--- 181

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + ++FF   G HGLHV  G  +L V +++  +    S +       + +
Sbjct: 182 YEAPFTIADGVYGATFFVATGFHGLHVIIGSTFLAVCLLRQAQYHFTSEHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYVSIYWWG 260


>gi|66044394|ref|YP_234235.1| cytochrome c oxidase, subunit III [Pseudomonas syringae pv.
           syringae B728a]
 gi|63255101|gb|AAY36197.1| Cytochrome c oxidase, subunit III [Pseudomonas syringae pv.
           syringae B728a]
          Length = 210

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 95/181 (52%), Positives = 124/181 (68%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLM+DC++FA FF  YAV+  + A GP+  D+F +  + V T  LL+SS++  
Sbjct: 31  TVYGFWLYLMTDCVLFASFFAVYAVMVNSVAGGPSGQDIFLLPFVAVETAFLLVSSITYG 90

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAMLA   K    + + WL +T   G  FI MEIYEF HLI     P RS FLS+FFALV
Sbjct: 91  FAMLAL-YKGNKSQVLGWLALTFLCGAAFIGMEIYEFHHLIEEGYGPSRSGFLSAFFALV 149

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           GLHG HV  GLIW+ +++ Q+ KKGL + N+ RL CLS+FWHFLD++WI VF+ VYLMG 
Sbjct: 150 GLHGAHVTSGLIWMAIMMFQVQKKGLTNTNKTRLSCLSLFWHFLDVVWIGVFTVVYLMGA 209

Query: 210 V 210
           +
Sbjct: 210 L 210


>gi|291612351|ref|YP_003540779.1| cytochrome c oxidase subunit III [Hypsiglena ochrorhyncha
           nuchalata]
 gi|189164407|gb|ACD77348.1| cytochrome c oxidase subunit III [Hypsiglena ochrorhyncha
           nuchalata]
          Length = 261

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 40/198 (20%), Positives = 75/198 (37%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF     +             P  I   D
Sbjct: 66  TYQGHHTKGVQKNMRYGMILFITSEVFFFLGFFWALYHVSLVPTPELGAEWPPTGIIPLD 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +  K    +    L+ T   G+ F  +++ E+   +
Sbjct: 126 PMEVPLLNTTVLLSSGATITWSHHTMMKGNKKEATYALMATIMLGVYFTALQMSEY---L 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L V +++++K    + +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMIGTSFLTVCILRLIKHHFTTTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDIVWLFLYISVYWWG 260


>gi|42783037|ref|NP_980284.1| cytochrome c oxidase, subunit III [Bacillus cereus ATCC 10987]
 gi|47565817|ref|ZP_00236856.1| cytochrome c oxidase subunit III [Bacillus cereus G9241]
 gi|52141547|ref|YP_085283.1| cytochrome c oxidase, subunit III [Bacillus cereus E33L]
 gi|75762088|ref|ZP_00741994.1| Cytochrome c oxidase polypeptide III [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|163941681|ref|YP_001646565.1| cytochrome c oxidase subunit III [Bacillus weihenstephanensis
           KBAB4]
 gi|206971235|ref|ZP_03232186.1| cytochrome c oxidase, subunit III [Bacillus cereus AH1134]
 gi|206978408|ref|ZP_03239278.1| cytochrome c oxidase, subunit III [Bacillus cereus H3081.97]
 gi|217961427|ref|YP_002339995.1| cytochrome c oxidase, subunit III [Bacillus cereus AH187]
 gi|218235434|ref|YP_002368742.1| cytochrome c oxidase, subunit III [Bacillus cereus B4264]
 gi|218899098|ref|YP_002447509.1| cytochrome c oxidase, subunit III [Bacillus cereus G9842]
 gi|222097390|ref|YP_002531447.1| cytochrome c oxidase, subunit iii [Bacillus cereus Q1]
 gi|228902448|ref|ZP_04066602.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis IBL 4222]
 gi|228909768|ref|ZP_04073591.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis IBL 200]
 gi|228922693|ref|ZP_04085992.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228954218|ref|ZP_04116246.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228960203|ref|ZP_04121860.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228966963|ref|ZP_04128001.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228974035|ref|ZP_04134608.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228980627|ref|ZP_04140935.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis Bt407]
 gi|228987085|ref|ZP_04147210.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229013147|ref|ZP_04170291.1| Cytochrome c oxidase subunit 3 [Bacillus mycoides DSM 2048]
 gi|229019144|ref|ZP_04175978.1| Cytochrome c oxidase subunit 3 [Bacillus cereus AH1273]
 gi|229031572|ref|ZP_04187572.1| Cytochrome c oxidase subunit 3 [Bacillus cereus AH1271]
 gi|229047627|ref|ZP_04193216.1| Cytochrome c oxidase subunit 3 [Bacillus cereus AH676]
 gi|229071441|ref|ZP_04204663.1| Cytochrome c oxidase subunit 3 [Bacillus cereus F65185]
 gi|229075698|ref|ZP_04208680.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock4-18]
 gi|229081194|ref|ZP_04213704.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock4-2]
 gi|229098412|ref|ZP_04229357.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock3-29]
 gi|229104504|ref|ZP_04235171.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock3-28]
 gi|229111412|ref|ZP_04240964.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock1-15]
 gi|229117438|ref|ZP_04246814.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock1-3]
 gi|229129219|ref|ZP_04258192.1| Cytochrome c oxidase subunit 3 [Bacillus cereus BDRD-Cer4]
 gi|229134750|ref|ZP_04263559.1| Cytochrome c oxidase subunit 3 [Bacillus cereus BDRD-ST196]
 gi|229140670|ref|ZP_04269218.1| Cytochrome c oxidase subunit 3 [Bacillus cereus BDRD-ST26]
 gi|229146513|ref|ZP_04274884.1| Cytochrome c oxidase subunit 3 [Bacillus cereus BDRD-ST24]
 gi|229152140|ref|ZP_04280334.1| Cytochrome c oxidase subunit 3 [Bacillus cereus m1550]
 gi|229157519|ref|ZP_04285596.1| Cytochrome c oxidase subunit 3 [Bacillus cereus ATCC 4342]
 gi|229168681|ref|ZP_04296403.1| Cytochrome c oxidase subunit 3 [Bacillus cereus AH621]
 gi|229180217|ref|ZP_04307561.1| Cytochrome c oxidase subunit 3 [Bacillus cereus 172560W]
 gi|229192150|ref|ZP_04319118.1| Cytochrome c oxidase subunit 3 [Bacillus cereus ATCC 10876]
 gi|229198058|ref|ZP_04324770.1| Cytochrome c oxidase subunit 3 [Bacillus cereus m1293]
 gi|296504436|ref|YP_003666136.1| cytochrome c oxidase polypeptide III [Bacillus thuringiensis
           BMB171]
 gi|42738964|gb|AAS42892.1| cytochrome c oxidase, subunit III [Bacillus cereus ATCC 10987]
 gi|47557097|gb|EAL15426.1| cytochrome c oxidase subunit III [Bacillus cereus G9241]
 gi|51975016|gb|AAU16566.1| cytochrome c oxidase, subunit III [Bacillus cereus E33L]
 gi|74490422|gb|EAO53732.1| Cytochrome c oxidase polypeptide III [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|163863878|gb|ABY44937.1| cytochrome c oxidase subunit III [Bacillus weihenstephanensis
           KBAB4]
 gi|206734007|gb|EDZ51178.1| cytochrome c oxidase, subunit III [Bacillus cereus AH1134]
 gi|206743388|gb|EDZ54825.1| cytochrome c oxidase, subunit III [Bacillus cereus H3081.97]
 gi|217067304|gb|ACJ81554.1| cytochrome c oxidase, subunit III [Bacillus cereus AH187]
 gi|218163391|gb|ACK63383.1| cytochrome c oxidase, subunit III [Bacillus cereus B4264]
 gi|218541319|gb|ACK93713.1| cytochrome c oxidase, subunit III [Bacillus cereus G9842]
 gi|221241448|gb|ACM14158.1| cytochrome c oxidase, subunit III [Bacillus cereus Q1]
 gi|228585416|gb|EEK43522.1| Cytochrome c oxidase subunit 3 [Bacillus cereus m1293]
 gi|228591357|gb|EEK49208.1| Cytochrome c oxidase subunit 3 [Bacillus cereus ATCC 10876]
 gi|228603426|gb|EEK60903.1| Cytochrome c oxidase subunit 3 [Bacillus cereus 172560W]
 gi|228614837|gb|EEK71940.1| Cytochrome c oxidase subunit 3 [Bacillus cereus AH621]
 gi|228625969|gb|EEK82719.1| Cytochrome c oxidase subunit 3 [Bacillus cereus ATCC 4342]
 gi|228631332|gb|EEK87967.1| Cytochrome c oxidase subunit 3 [Bacillus cereus m1550]
 gi|228637146|gb|EEK93605.1| Cytochrome c oxidase subunit 3 [Bacillus cereus BDRD-ST24]
 gi|228642742|gb|EEK99025.1| Cytochrome c oxidase subunit 3 [Bacillus cereus BDRD-ST26]
 gi|228648796|gb|EEL04822.1| Cytochrome c oxidase subunit 3 [Bacillus cereus BDRD-ST196]
 gi|228654456|gb|EEL10321.1| Cytochrome c oxidase subunit 3 [Bacillus cereus BDRD-Cer4]
 gi|228666048|gb|EEL21514.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock1-3]
 gi|228672028|gb|EEL27320.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock1-15]
 gi|228678946|gb|EEL33156.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock3-28]
 gi|228685029|gb|EEL38962.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock3-29]
 gi|228702238|gb|EEL54714.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock4-2]
 gi|228707474|gb|EEL59665.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock4-18]
 gi|228711732|gb|EEL63685.1| Cytochrome c oxidase subunit 3 [Bacillus cereus F65185]
 gi|228723721|gb|EEL75077.1| Cytochrome c oxidase subunit 3 [Bacillus cereus AH676]
 gi|228729861|gb|EEL80841.1| Cytochrome c oxidase subunit 3 [Bacillus cereus AH1271]
 gi|228742160|gb|EEL92326.1| Cytochrome c oxidase subunit 3 [Bacillus cereus AH1273]
 gi|228748097|gb|EEL97958.1| Cytochrome c oxidase subunit 3 [Bacillus mycoides DSM 2048]
 gi|228772679|gb|EEM21120.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228779095|gb|EEM27354.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis Bt407]
 gi|228785671|gb|EEM33677.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228792697|gb|EEM40261.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228799471|gb|EEM46431.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228805538|gb|EEM52129.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228836967|gb|EEM82309.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228850057|gb|EEM94888.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis IBL 200]
 gi|228857192|gb|EEN01698.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis IBL 4222]
 gi|296325488|gb|ADH08416.1| cytochrome c oxidase polypeptide III [Bacillus thuringiensis
           BMB171]
 gi|324327842|gb|ADY23102.1| cytochrome c oxidase, subunit III [Bacillus thuringiensis serovar
           finitimus YBT-020]
 gi|326941714|gb|AEA17610.1| cytochrome c oxidase polypeptide III [Bacillus thuringiensis
           serovar chinensis CT-43]
          Length = 207

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 59/192 (30%), Positives = 104/192 (54%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++    ++GFW++L  + ++FA  F TY  L  +   GP   ++F +  +F+ T
Sbjct: 15  EPEKATLEGKNKFVGFWLFLGGETVLFASLFGTYLALKNSTNGGPTSQEMFQMPLVFIMT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           ++LL SSL+  +AM            +  L+                + +    +   + 
Sbjct: 75  MLLLTSSLTSVYAMYHMKNFNFKKMQLWLLVTVLLGLGFLGFEIYEFYHYTHEFKHTMRS 134

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF S+F+ALVG HGLHV FGL W+  L+ +  K+GL   N  +    S++WHF+D++W+
Sbjct: 135 SAFGSAFYALVGTHGLHVLFGLCWILTLIFRNAKRGLNLYNAPKFYVASIYWHFIDVVWV 194

Query: 199 CVFSFVYLMGVV 210
            +F+ VYLMG+V
Sbjct: 195 FIFTVVYLMGMV 206


>gi|127511302|ref|YP_001092499.1| cytochrome c oxidase, subunit III [Shewanella loihica PV-4]
 gi|126636597|gb|ABO22240.1| cytochrome c oxidase, subunit III [Shewanella loihica PV-4]
          Length = 208

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 94/193 (48%), Positives = 129/193 (66%), Gaps = 3/193 (1%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            ++       + T LGFWIYLM+DC++FA  F TYAVL  N   G +  DVF++  + + 
Sbjct: 18  HEEHHDT--GENTLLGFWIYLMTDCILFASAFATYAVLYMNTDGGVSGKDVFELDFVLIE 75

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T  LLLSS++   A L  A +     T++WL VT   G +FI ME+ EF HLI     PQ
Sbjct: 76  TAALLLSSITYGLA-LIFAKRHHKGATLAWLAVTFALGCVFIGMEVNEFHHLILEGNGPQ 134

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
           RSAFLS+FFALVG+HGLHV  GL+W+ +++++++K+G       RL CLS+FWHFLD++W
Sbjct: 135 RSAFLSAFFALVGMHGLHVSAGLVWMAIMMLEVVKRGTGGRTLTRLNCLSLFWHFLDIVW 194

Query: 198 ICVFSFVYLMGVV 210
           ICVF+ VYLMGV+
Sbjct: 195 ICVFTVVYLMGVL 207


>gi|38707471|ref|NP_944769.1|COX3_17487 cytochrome c oxidase subunit III [Phocoena phocoena]
 gi|38602592|emb|CAD88046.1| cytochrome c oxidase polypeptide III [Phocoena phocoena]
          Length = 261

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 45/197 (22%), Positives = 83/197 (42%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S+ L F  FF  +             +  PA I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFILSEVLFFTGFFWAFYHSSLAPTPELGGSWPPAGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H T+  LL+T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-TLQALLITIMLGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L +  ++ L     S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIICFMRQLTFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|209808984|ref|YP_002264522.1| cytochrome o ubiquinol oxidase subunit III [Aliivibrio salmonicida
           LFI1238]
 gi|208010546|emb|CAQ80915.1| cytochrome o ubiquinol oxidase subunit III [Aliivibrio salmonicida
           LFI1238]
          Length = 202

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 97/179 (54%), Positives = 124/179 (69%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
            GFWIYLMSDC++F   F TYAVL    A GP+  D+F++  +FV T++LLLSS++  F 
Sbjct: 25  YGFWIYLMSDCILFGSLFATYAVLVNATAGGPSGKDIFELPFVFVETMLLLLSSITFGFG 84

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           ++A   +  +     WLL+TA  G+ FI ME+YEF HLI     PQRSAFLS+FF LVG 
Sbjct: 85  IIAMKRED-LAGLKRWLLITALLGLGFISMEVYEFNHLIGEGFGPQRSAFLSAFFTLVGT 143

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HGLHV FGLIWL V   Q+  KGL    + R  CLS+FWHFLD++WICVF+ VYL+GV+
Sbjct: 144 HGLHVTFGLIWLSVCYFQLNTKGLNDLMKGRFYCLSLFWHFLDIVWICVFTIVYLLGVI 202


>gi|56421992|ref|YP_149310.1| cytochrome aa3 quinol oxidase subunit III [Geobacillus kaustophilus
           HTA426]
 gi|56381834|dbj|BAD77742.1| cytochrome aa3 quinol oxidase subunit III [Geobacillus kaustophilus
           HTA426]
          Length = 204

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 75/179 (41%), Positives = 115/179 (64%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++  +FA  F TY VL +   +GP   ++F++  + + T++LL SS +C  A
Sbjct: 26  LGFWIFLGAEVALFATLFATYLVLFQRTGSGPTAGELFEVKDVLIETLLLLTSSFTCGLA 85

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +      R+    ++WLLVT   G+ FI  EI EF H +   A  Q SAFLSSFF LVG 
Sbjct: 86  IFEMRRGRIS-GLIAWLLVTLLLGVGFITFEIREFIHYVHEGATMQTSAFLSSFFVLVGT 144

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+ W+ +++IQ+L++G      R++  +S++WHFLD++WI +F+ VYL+G+V
Sbjct: 145 HGAHVSVGIGWMILIIIQLLQRGFTPKTARKVFIVSLYWHFLDVVWIFIFTLVYLLGMV 203


>gi|229174609|ref|ZP_04302138.1| Cytochrome c oxidase subunit 3 [Bacillus cereus MM3]
 gi|228608861|gb|EEK66154.1| Cytochrome c oxidase subunit 3 [Bacillus cereus MM3]
          Length = 207

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 59/192 (30%), Positives = 104/192 (54%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++    ++GFW++L  + ++FA  F TY  L  +   GP   ++F +  +F+ T
Sbjct: 15  EPEKATLEGKNKFVGFWLFLGGETVLFASLFGTYLALKNSTNGGPTSQEMFQMPLVFIMT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           ++LL SSL+  +AM            +  L+                + +    +   + 
Sbjct: 75  MLLLTSSLTSVYAMYHMKNFNFKKMQLWLLVTVLLGLGFLAFEIYEFYHYTHEFKHTMRS 134

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF S+F+ALVG HGLHV FGL W+  L+ +  K+GL   N  +    S++WHF+D++W+
Sbjct: 135 SAFGSAFYALVGTHGLHVLFGLCWILTLIFRNAKRGLNLYNAPKFYVASIYWHFIDVVWV 194

Query: 199 CVFSFVYLMGVV 210
            +F+ VYLMG+V
Sbjct: 195 FIFTVVYLMGMV 206


>gi|170676088|ref|YP_001742111.1| cytochrome c oxidase subunit III [Spilogale putorius]
 gi|155368576|emb|CAM98591.1| cytochrome c oxidase subunit III [Spilogale putorius]
          Length = 261

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 42/199 (21%), Positives = 82/199 (41%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK---------NYAAGPAPIDVF 69
               + +   G   G  ++++S+   FA FF  +                  G  P++  
Sbjct: 68  QGHHTPIVQKGLRYGMVLFILSEVFSFAGFFWAFYHSSLAPTPDLGGCWPPTGILPLNPL 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           D+    ++T VLL S ++ ++A  +       H  +  L +T   G+ F  ++  E+   
Sbjct: 128 DVP--LLNTSVLLASGVTITWAHHSLMEGNRKH-MLQALFITISLGLYFTALQASEY--- 181

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + S+FF   G HGLHV  G  +L +  ++ L     S +       + +
Sbjct: 182 YETSFTISDGVYGSTFFMATGFHGLHVIIGSTFLIICFLRQLNYHFTSSHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYVSIYWWG 260


>gi|84623174|ref|YP_450546.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|84367114|dbj|BAE68272.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
          Length = 208

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 100/182 (54%), Positives = 125/182 (68%), Gaps = 1/182 (0%)

Query: 29  GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSC 88
            T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL SSLS 
Sbjct: 28  NTVFGFWVYLMSDCLLFAGLFATYAVLSGATVDGPTAKELFDLKFVLVETFLLLFSSLSF 87

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            FAM+A+  +++      W+ VTA  G+ F+ MEI+EF HLI   A P RSAFLS+FF L
Sbjct: 88  GFAMIAAHKRKM-GGLYGWMAVTALLGIGFLCMEIWEFNHLIHEGAGPGRSAFLSAFFTL 146

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           VG HGLHV  GL+W+ VLVIQI K GL + N  RL CLS+FWHFLD+IWI VF+ VYL+G
Sbjct: 147 VGTHGLHVASGLLWMAVLVIQISKNGLTARNSTRLACLSLFWHFLDIIWIGVFTVVYLLG 206

Query: 209 VV 210
            +
Sbjct: 207 AL 208


>gi|330859962|emb|CBX70291.1| cytochrome o ubiquinol oxidase subunit 3 [Yersinia enterocolitica
           W22703]
          Length = 198

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 92/189 (48%), Positives = 124/189 (65%), Gaps = 1/189 (0%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIF 75
               +            GFWIYLMSDC++FA  F TYAVL    A GP+  D+FD++ + 
Sbjct: 11  VAHAEHGHHDAGATKVFGFWIYLMSDCILFATLFATYAVLVNGTAGGPSGRDIFDLNFVL 70

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           V T +LL SS++   AML    K   ++  +WL +T  FG+ F+ MEIYEF HLI+    
Sbjct: 71  VETFLLLFSSITYGIAML-GMNKGHKNQVNTWLGLTFLFGLGFVAMEIYEFHHLIAEGYG 129

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
           P RSAFLSSFFALV  HG+HV  GL+W+ +++IQ+ K+GL   N+ RL+CLS+FWHFLD+
Sbjct: 130 PDRSAFLSSFFALVATHGIHVTAGLVWIIIMMIQVAKRGLNETNRTRLMCLSLFWHFLDV 189

Query: 196 IWICVFSFV 204
           +WICVF+ V
Sbjct: 190 VWICVFTVV 198


>gi|294679522|gb|ADF29564.1| cytochrome c oxidase subunit III [Globicephala macrorhynchus]
 gi|326370283|gb|ADZ56121.1| cytochrome c oxidase subunit III [Globicephala macrorhynchus]
 gi|326370297|gb|ADZ56134.1| cytochrome c oxidase subunit III [Globicephala macrorhynchus]
 gi|326370309|gb|ADZ56145.1| cytochrome c oxidase subunit III [Globicephala macrorhynchus]
          Length = 261

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 81/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               +     G   G  ++++S+ L F  FF  +  + L      G +            
Sbjct: 68  QGHHTPTVQKGLRYGMILFILSEILFFTGFFWAFYHSSLAPTPELGGSWPPTGIRPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  LL+T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMQGNRKH-MLQALLITITLGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +     S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFMRQMLFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|154090914|ref|YP_001403161.1| cytochrome c oxidase subunit III [Reinhardtius hippoglossoides]
 gi|153581803|emb|CAO79727.1| cytochrome oxidase subunit III [Reinhardtius hippoglossoides]
 gi|153581817|emb|CAO79740.1| cytochrome oxidase subunit III [Reinhardtius hippoglossoides]
 gi|153581831|emb|CAO79753.1| cytochrome oxidase subunit III [Reinhardtius hippoglossoides]
 gi|153581845|emb|CAO79766.1| cytochrome oxidase subunit III [Reinhardtius hippoglossoides]
          Length = 261

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/199 (21%), Positives = 85/199 (42%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPIDVF 69
               +     G   G  +++ S+ L F  FF  +                 AG  P+D F
Sbjct: 68  QGHHTPPVQMGLRYGMILFITSEVLFFLGFFWAFYHSSLAPTPELGGFWPPAGITPLDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  +    +   +T+  L +T   G  F  ++  E+   
Sbjct: 128 EVP--LLNTAVLLASGVTVTWAHHSIMEGK-RKQTIQSLALTILLGGYFTFLQGLEY--- 181

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
           +          + ++FF   G HGLHV  G  +L V +++ +     S +       + +
Sbjct: 182 VEAPFTIADGVYGATFFVATGFHGLHVLIGTSFLAVCLLRQILHHFTSNHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYISIYWWG 260


>gi|113867093|ref|YP_725582.1| bo3-type quinol oxidase, subunit III [Ralstonia eutropha H16]
 gi|113525869|emb|CAJ92214.1| bo3-type quinol oxidase, subunit III [Ralstonia eutropha H16]
          Length = 214

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 91/180 (50%), Positives = 122/180 (67%), Gaps = 1/180 (0%)

Query: 29  GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSC 88
            T  GFWIYLMSDC++FA  F  +AVL    A GP+  ++F+++ + V T +LL SS++ 
Sbjct: 34  NTVYGFWIYLMSDCIIFAGLFAAFAVLRGELAGGPSAKELFELNYVLVETFILLFSSITY 93

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
             AM++    R + +   WL VT   G  F+ MEI EF HLI+  A P RSAFLSSFF L
Sbjct: 94  GMAMISLQ-NRSLSRVQVWLGVTFLLGAAFMAMEINEFHHLIAEGAGPGRSAFLSSFFTL 152

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           VG HGLHV  G++W+ VL+ Q+ KKG+     +RL+CLS+FWHFLD++WI VF+ VYLMG
Sbjct: 153 VGTHGLHVASGMLWMIVLMWQLSKKGITPTLSKRLMCLSLFWHFLDVVWIGVFTVVYLMG 212


>gi|298110740|gb|ADI57703.1| cytochrome c oxidase subunit III [Ovis aries]
 gi|298110754|gb|ADI57716.1| cytochrome c oxidase subunit III [Ovis aries]
          Length = 261

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGSRYHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|158337735|ref|YP_001518911.1| cytochrome c oxidase subunit III [Acaryochloris marina MBIC11017]
 gi|158307976|gb|ABW29593.1| cytochrome c oxidase subunit III [Acaryochloris marina MBIC11017]
          Length = 208

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 48/193 (24%), Positives = 87/193 (45%), Gaps = 5/193 (2%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPA-PIDVFDISGIF 75
           V+  +      D    GF ++L+S+ ++F   FV Y          P    +  ++    
Sbjct: 19  VETAEHHSEHPDLRLFGFIVFLVSESMLFLGLFVAYFAFRVVTPEWPPEGTEELELMLPG 78

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           ++TI+L+ SS     A  A      +     W  +T   G  F+  ++YE+ H   +   
Sbjct: 79  INTIILISSSFVIHKADTAIKQSGDVKAARLWFAITIAMGATFLAGQVYEYNH---LGFG 135

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILK-KGLISGNQRRLICLSMFWHFLD 194
              + F S+F+ L G HGLHVF GL+ +  ++ +          +   +    ++WHF+D
Sbjct: 136 LTTNLFASTFYLLTGFHGLHVFVGLLLMSAVLWRSRVPGHYSETSHFGIEATEVYWHFVD 195

Query: 195 LIWICVFSFVYLM 207
           +IWI +F  +YL+
Sbjct: 196 VIWIVLFLILYLL 208


>gi|30264013|ref|NP_846390.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. Ames]
 gi|47529450|ref|YP_020799.1| cytochrome c oxidase subunit III [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49186852|ref|YP_030104.1| cytochrome c oxidase subunit III [Bacillus anthracis str. Sterne]
 gi|49478458|ref|YP_038004.1| cytochrome c oxidase subunit III [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|65321337|ref|ZP_00394296.1| COG1845: Heme/copper-type cytochrome/quinol oxidase, subunit 3
           [Bacillus anthracis str. A2012]
 gi|118479159|ref|YP_896310.1| cytochrome c oxidase, subunit III [Bacillus thuringiensis str. Al
           Hakam]
 gi|165872133|ref|ZP_02216772.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0488]
 gi|167633499|ref|ZP_02391823.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0442]
 gi|167640968|ref|ZP_02399225.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0193]
 gi|170688794|ref|ZP_02879998.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0465]
 gi|170705795|ref|ZP_02896258.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0389]
 gi|177654276|ref|ZP_02936205.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0174]
 gi|190565931|ref|ZP_03018850.1| cytochrome c oxidase, subunit III [Bacillus anthracis
           Tsiankovskii-I]
 gi|196035910|ref|ZP_03103312.1| cytochrome c oxidase, subunit III [Bacillus cereus W]
 gi|196038642|ref|ZP_03105950.1| cytochrome c oxidase, subunit III [Bacillus cereus NVH0597-99]
 gi|196045939|ref|ZP_03113168.1| cytochrome c oxidase, subunit III [Bacillus cereus 03BB108]
 gi|218905073|ref|YP_002452907.1| cytochrome c oxidase, subunit III [Bacillus cereus AH820]
 gi|225865924|ref|YP_002751302.1| cytochrome c oxidase, subunit III [Bacillus cereus 03BB102]
 gi|227816716|ref|YP_002816725.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. CDC 684]
 gi|228916579|ref|ZP_04080145.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228928989|ref|ZP_04092021.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228935257|ref|ZP_04098083.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228947661|ref|ZP_04109951.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|229092991|ref|ZP_04224122.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock3-42]
 gi|229123463|ref|ZP_04252662.1| Cytochrome c oxidase subunit 3 [Bacillus cereus 95/8201]
 gi|229604758|ref|YP_002868242.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0248]
 gi|254683709|ref|ZP_05147569.1| cytochrome c oxidase, subunit III [Bacillus anthracis str.
           CNEVA-9066]
 gi|254736054|ref|ZP_05193760.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. Western
           North America USA6153]
 gi|254743945|ref|ZP_05201628.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. Kruger
           B]
 gi|254754276|ref|ZP_05206311.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. Vollum]
 gi|254758033|ref|ZP_05210060.1| cytochrome c oxidase, subunit III [Bacillus anthracis str.
           Australia 94]
 gi|301055433|ref|YP_003793644.1| cytochrome c oxidase subunit III [Bacillus anthracis CI]
 gi|30258658|gb|AAP27876.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. Ames]
 gi|47504598|gb|AAT33274.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49180779|gb|AAT56155.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. Sterne]
 gi|49330014|gb|AAT60660.1| cytochrome c oxidase, subunit III [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|118418384|gb|ABK86803.1| cytochrome c oxidase, subunit III [Bacillus thuringiensis str. Al
           Hakam]
 gi|164712080|gb|EDR17618.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0488]
 gi|167511018|gb|EDR86407.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0193]
 gi|167530905|gb|EDR93592.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0442]
 gi|170129335|gb|EDS98199.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0389]
 gi|170667310|gb|EDT18069.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0465]
 gi|172080766|gb|EDT65847.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0174]
 gi|190562850|gb|EDV16816.1| cytochrome c oxidase, subunit III [Bacillus anthracis
           Tsiankovskii-I]
 gi|195991559|gb|EDX55525.1| cytochrome c oxidase, subunit III [Bacillus cereus W]
 gi|196023379|gb|EDX62057.1| cytochrome c oxidase, subunit III [Bacillus cereus 03BB108]
 gi|196030365|gb|EDX68964.1| cytochrome c oxidase, subunit III [Bacillus cereus NVH0597-99]
 gi|218537730|gb|ACK90128.1| cytochrome c oxidase, subunit III [Bacillus cereus AH820]
 gi|225788326|gb|ACO28543.1| cytochrome c oxidase, subunit III [Bacillus cereus 03BB102]
 gi|227005165|gb|ACP14908.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. CDC 684]
 gi|228659950|gb|EEL15591.1| Cytochrome c oxidase subunit 3 [Bacillus cereus 95/8201]
 gi|228690362|gb|EEL44148.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock3-42]
 gi|228812181|gb|EEM58512.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228824422|gb|EEM70228.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228830796|gb|EEM76401.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228843158|gb|EEM88240.1| Cytochrome c oxidase subunit 3 [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|229269166|gb|ACQ50803.1| cytochrome c oxidase, subunit III [Bacillus anthracis str. A0248]
 gi|300377602|gb|ADK06506.1| cytochrome c oxidase, subunit III [Bacillus cereus biovar anthracis
           str. CI]
          Length = 207

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 59/192 (30%), Positives = 104/192 (54%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++    ++GFW++L  + ++FA  F TY  L  +   GP   ++F +  +F+ T
Sbjct: 15  EPEKATLEGKNKFVGFWLFLGGETVLFASLFGTYLALKNSTNGGPTSQEMFQMPLVFIMT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           ++LL SSL+  +AM            +  L+                + +    +   + 
Sbjct: 75  MLLLTSSLTSVYAMYHMKNFNFKKMQLWLLVTVLLGLGFLGFEIYEFYHYAHEFKHTMRS 134

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF S+F+ALVG HGLHV FGL W+  L+ +  K+GL   N  +    S++WHF+D++W+
Sbjct: 135 SAFGSAFYALVGTHGLHVLFGLCWILTLIFRNAKRGLNLYNAPKFYVASIYWHFIDVVWV 194

Query: 199 CVFSFVYLMGVV 210
            +F+ VYLMG+V
Sbjct: 195 FIFTVVYLMGMV 206


>gi|166713086|ref|ZP_02244293.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 210

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 101/182 (55%), Positives = 125/182 (68%), Gaps = 1/182 (0%)

Query: 29  GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSC 88
            T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL SSLS 
Sbjct: 30  NTVFGFWVYLMSDCLLFAGLFATYAVLSGATVDGPTAKELFDLKFVLVETFLLLFSSLSF 89

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            FAM+A+  +++      WL VTA  G+ F+ MEI+EF HLI   A P RSAFLS+FF L
Sbjct: 90  GFAMIAAHKRKM-GGLYGWLAVTALLGIGFLCMEIWEFNHLIHEGAGPGRSAFLSAFFTL 148

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           VG HGLHV  GL+W+ VLVIQI K GL + N  RL CLS+FWHFLD+IWI VF+ VYL+G
Sbjct: 149 VGTHGLHVASGLLWMAVLVIQISKNGLTARNSTRLACLSLFWHFLDIIWIGVFTVVYLLG 208

Query: 209 VV 210
            +
Sbjct: 209 AL 210


>gi|94502578|ref|YP_588406.1| cytochrome c oxidase subunit 3 [Zea mays subsp. mays]
 gi|114151570|ref|YP_740377.1| cytochrome c oxidase subunit 3 [Zea perennis]
 gi|114151602|ref|YP_740446.1| cytochrome c oxidase subunit 3 [Zea luxurians]
 gi|114151636|ref|YP_740413.1| cytochrome c oxidase subunit 3 [Zea mays subsp. parviglumis]
 gi|115278538|ref|YP_762331.1| cytochrome c oxidase subunit 3 [Sorghum bicolor]
 gi|115278608|ref|YP_762504.1| cytochrome c oxidase subunit 3 [Tripsacum dactyloides]
 gi|117070|sp|P14852|COX3_ORYSI RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|100867|pir||S20801 cytochrome-c oxidase (EC 1.9.3.1) chain III - maize mitochondrion
 gi|13217|emb|CAA34898.1| unnamed protein product [Oryza sativa Indica Group]
 gi|14296|emb|CAA37222.1| cytochrome oxidase subunit 3 [Zea mays]
 gi|804815|gb|AAA66048.1| cytochrome oxidase subunit III [Oryza sativa Indica Group]
 gi|40795017|gb|AAR91061.1| cytochrome c oxidase subunit 3 [Zea mays]
 gi|93116046|gb|ABE98679.1| cytochrome c oxidase subunit 3 [Zea mays subsp. mays]
 gi|93116090|gb|ABE98722.1| cytochrome c oxidase subunit 3 [Zea mays subsp. mays]
 gi|93116135|gb|ABE98766.1| cytochrome c oxidase subunit 3 [Zea mays subsp. mays]
 gi|102567904|gb|ABF70821.1| cytochrome c oxidase subunit 3 [Zea perennis]
 gi|102567969|gb|ABF70853.1| cytochrome c oxidase subunit 3 [Zea mays subsp. parviglumis]
 gi|102579639|gb|ABF70919.1| cytochrome c oxidase subunit 3 [Zea mays subsp. mays]
 gi|110287598|gb|ABG65644.1| cytochrome c oxidase subunit 3 [Zea luxurians]
 gi|114309659|gb|ABI60876.1| cytochrome c oxidase subunit 3 [Sorghum bicolor]
 gi|114432099|gb|ABI74648.1| cytochrome c oxidase subunit 3 [Tripsacum dactyloides]
          Length = 265

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 79/199 (39%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDIS 72
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPW 130

Query: 73  -GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPLLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVLLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++L V  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFLATGFHGFHVIIGTLFLIVCGIRQYLGHLTKKHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|56713972|gb|AAW23979.1| cytochrome c oxidase subunit III [Ovis aries]
          Length = 261

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRYHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYXSIYWWG 260


>gi|51979792|gb|AAU20467.1| cytochrome c oxidase subunit III [Hydromantes italicus]
          Length = 261

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 83/197 (42%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               +     G   G  +++ S+ L F  FF  +  + L   +  G              
Sbjct: 68  QGHHTTPVQKGLRYGMILFITSEVLFFGGFFWAFYNSSLSPTFELGETWPPTGISPLDPF 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S ++ ++A  +        +T+  LL+T   G+ F  ++  E+     
Sbjct: 128 EVPLLNTAVLLTSGVTVTWAHHSIMVGN-RKETIQSLLLTTILGLYFTALQAMEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
              V     + S+FF   G HGLHV  G ++L V +I+ +     S +       + +WH
Sbjct: 184 APFVIADGIYGSTFFIATGFHGLHVIIGSLFLLVCLIRQINFHFTSSHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|78046865|ref|YP_363040.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
 gi|78035295|emb|CAJ22940.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
          Length = 208

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 100/182 (54%), Positives = 125/182 (68%), Gaps = 1/182 (0%)

Query: 29  GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSC 88
            T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL SSLS 
Sbjct: 28  NTVFGFWVYLMSDCLLFAGLFATYAVLSGATVDGPTAKELFDLKFVLVETFLLLFSSLSF 87

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            FAM+A+  +++      WL VTA  G+ F+ ME++EF HLI   A P RSAFLS+FF L
Sbjct: 88  GFAMIAAHKRKM-GGLYGWLAVTALLGIGFLCMEVWEFNHLIHEGAGPGRSAFLSAFFTL 146

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           VG HGLHV  GL+W+ VLVIQI K GL + N  RL CLS+FWHFLD+IWI VF+ VYL+G
Sbjct: 147 VGTHGLHVASGLLWMAVLVIQISKNGLTARNSTRLACLSLFWHFLDIIWIGVFTVVYLLG 206

Query: 209 VV 210
            +
Sbjct: 207 AL 208


>gi|309253117|gb|ADO60520.1| cytochrome c oxidase subunit III [Lycus dentipes]
          Length = 281

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 42/193 (21%), Positives = 87/193 (45%), Gaps = 9/193 (4%)

Query: 22  ESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA------AGPAPIDVFDISGIF 75
            +    +G   G  +++ S+ L F  FF +Y     + +        P  I  F+ + I 
Sbjct: 71  HTKKVVNGLKWGMILFITSEVLFFVSFFWSYFHSSLSPSIEIGLLWPPQEILTFNPTEIP 130

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           +   ++L+SS         S  +  + + +  L++T   G+ F I++ +E+   +     
Sbjct: 131 LLNTIVLISSGISVTWAHHSLMENDLKQAIYSLIITVALGIYFTILQGFEY---LESAFS 187

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
              S + S+FF   G HG+HV  G  +L +++I+       S +       + +WHF+D+
Sbjct: 188 IADSVYGSTFFMTTGFHGIHVIIGTSFLLIILIRTYLNHFSSKHHFGFEAAAWYWHFVDV 247

Query: 196 IWICVFSFVYLMG 208
           +W+ ++  +Y  G
Sbjct: 248 VWLFLYISIYWWG 260


>gi|330011526|ref|ZP_08307112.1| cytochrome o ubiquinol oxidase, subunit III [Klebsiella sp. MS
           92-3]
 gi|328534143|gb|EGF60778.1| cytochrome o ubiquinol oxidase, subunit III [Klebsiella sp. MS
           92-3]
          Length = 181

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 99/179 (55%), Positives = 124/179 (69%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
            GFWIYLMSDC++FA  F TYAVL    A GP   D+F++  + V T +LL SS++   A
Sbjct: 4   FGFWIYLMSDCIIFATLFATYAVLVNGTAGGPTGKDIFELPFVLVETALLLFSSITYGMA 63

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
            +A   K    + VSWL +T  FG  FI MEIYEF HLI     P RS FLS+FFALVG 
Sbjct: 64  AIA-MYKNNKSQVVSWLALTWLFGAGFIGMEIYEFHHLIMEGFGPDRSGFLSAFFALVGT 122

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HGLHV  GLIW+ VL+ Q+ ++GL S N+ R++CLS+FWHFLD++WICVFS VYLMG +
Sbjct: 123 HGLHVTSGLIWMAVLMFQVSRRGLTSTNRTRILCLSLFWHFLDVVWICVFSVVYLMGAM 181


>gi|294664344|ref|ZP_06729708.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
 gi|292605884|gb|EFF49171.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
          Length = 208

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 100/182 (54%), Positives = 125/182 (68%), Gaps = 1/182 (0%)

Query: 29  GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSC 88
            T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL SSLS 
Sbjct: 28  NTVFGFWVYLMSDCLLFAGLFATYAVLSGATVDGPTAKELFDLKFVLVETFLLLFSSLSF 87

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            FAM+A+  +++      WL VTA  G+ F+ ME++EF HLI   A P RSAFLS+FF L
Sbjct: 88  GFAMIAAHKRKM-GGLYGWLAVTALLGIGFLCMEVWEFNHLIHEGAGPGRSAFLSAFFTL 146

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           VG HGLHV  GL+W+ VLVIQI K GL + N  RL CLS+FWHFLD+IWI VF+ VYL+G
Sbjct: 147 VGTHGLHVASGLLWMAVLVIQISKNGLTARNSTRLACLSLFWHFLDIIWIGVFTVVYLLG 206

Query: 209 VV 210
            +
Sbjct: 207 AL 208


>gi|256985329|ref|YP_003162765.1| cytochrome c oxidase subunit III [Psetta maxima]
 gi|166065508|gb|ABY79841.1| cytochrome oxidase subunit 3 [Scophthalmus maximus]
          Length = 261

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 41/196 (20%), Positives = 82/196 (41%), Gaps = 15/196 (7%)

Query: 22  ESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPIDVFDIS 72
            +     G   G  +++ S+ L F  FF  +                 AG  P+D F++ 
Sbjct: 71  HTPPVQKGLRYGMILFIASEVLFFLGFFWAFYHSSLAPTPELGGFWPPAGITPLDPFEVP 130

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
              ++T VLL S ++ ++A  +        + +  L +T   G  F  ++  E+      
Sbjct: 131 --LLNTTVLLASGVTVTWAHHSIIEGE-RKQAIQALTLTILLGGYFTFLQAMEYC---EA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + ++FF   G HGLHV  G  +L +  ++ ++    S +       + +WHF
Sbjct: 185 PFTIADGVYGATFFVATGFHGLHVLIGSTFLGICHLRQVQNHFTSTHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLLLYISIYWWG 260


>gi|222839824|ref|YP_002587040.1| cytochrome c oxidase subunit III [Sousa chinensis]
 gi|170026948|gb|ACB06003.1| cytochrome c oxidase subunit III [Sousa chinensis]
          Length = 261

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 81/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               +     G   G  ++++S+ L F  FF  +  + L      G +            
Sbjct: 68  QGHHTPTVQKGLRYGMILFILSEVLFFTGFFWAFYHSSLAPTPELGGSWPPTGIHPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  LL+T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MLQALLITIMLGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +     S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFMRQMMFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|326370395|gb|ADZ56225.1| cytochrome c oxidase subunit III [Steno bredanensis]
          Length = 261

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 81/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               +     G   G  ++++S+ L F  FF  +  + L      G +            
Sbjct: 68  QGHHTPTVQKGLRYGMILFILSEVLFFTGFFWAFYHSSLAPTPELGGSWPPTGIHPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  LL+T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MLQALLITIMLGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +     S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFMRQMMFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|38707577|ref|NP_944756.1| cytochrome c oxidase subunit III [Monodon monoceros]
 gi|38602578|emb|CAD88033.1| cytochrome c oxidase polypeptide III [Monodon monoceros]
          Length = 261

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 45/197 (22%), Positives = 82/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               +     G   G  ++++S+ L F  FF  +  + L      G +            
Sbjct: 68  QGHHTPTVQKGLRYGMILFILSEALFFMGFFWAFYHSSLAPTPELGGSWPPTGIHPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H T+  LL+T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-TLQALLITIMLGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ L     S +       + +WH
Sbjct: 184 ASFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFMRQLTFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYISIYWWG 260


>gi|22653449|gb|AAN04067.1| cytochrome c oxidase subunit 3 [Amoebidium parasiticum]
          Length = 262

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 45/196 (22%), Positives = 89/196 (45%), Gaps = 10/196 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
           + + +     G   G  ++++S+ ++F  FF  Y     +          P  I+V +  
Sbjct: 68  EGQHTLEVQRGLKEGMILFIVSEAMLFFAFFWAYFHSSLSPSVELGAVWPPTGIEVLNPW 127

Query: 73  -GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +LL S  + ++A  A   +R   +T+  L +T   G IF  ++  E+     
Sbjct: 128 HVPLLNTAILLSSGATVTWAHHALIARRSRAETIQGLGLTILLGFIFTGLQGMEY---YE 184

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                  S + ++F++  GLHG+HV  G ++L V   ++L     + +   L    ++WH
Sbjct: 185 ASFTIADSVYGATFYSTTGLHGIHVIIGTLFLTVCFFRLLNYHYTTNHHLGLEAAILYWH 244

Query: 192 FLDLIWICVFSFVYLM 207
           F+D +W+ VF   Y+ 
Sbjct: 245 FVDYVWLLVFICYYVW 260


>gi|322383504|ref|ZP_08057279.1| cytochrome caa3 oxidase-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321152216|gb|EFX45047.1| cytochrome caa3 oxidase-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 193

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 66/192 (34%), Positives = 114/192 (59%), Gaps = 1/192 (0%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++     LGFW++L  + ++F   F TY  L  +   G    ++F +  I ++T
Sbjct: 2   EPEKATLEGKNKVLGFWLFLGGETVLFGCLFATYLALRNSVGDGKTSDELFQLPMIALAT 61

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
            +LL SSL+  FA++A    R +   + WL ++   G+ F+ +EIYEF   +        
Sbjct: 62  FLLLTSSLTSVFAVMALHRHR-LQSMLRWLAISVVLGLAFLGLEIYEFVEYVHEGHGFTT 120

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF +SF++LVG HG HV FG++W+ +L+IQ  KKGL +    +    +++WHF+D++W+
Sbjct: 121 SAFSTSFYSLVGFHGAHVLFGILWISLLIIQGSKKGLTTVTAPKFYIAALYWHFIDVVWV 180

Query: 199 CVFSFVYLMGVV 210
            +F+ VYLMG V
Sbjct: 181 FIFTVVYLMGKV 192


>gi|90409891|ref|ZP_01217908.1| cytochrome o ubiquinol oxidase, subunit III [Photobacterium
           profundum 3TCK]
 gi|90329244|gb|EAS45501.1| cytochrome o ubiquinol oxidase, subunit III [Photobacterium
           profundum 3TCK]
          Length = 211

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 97/184 (52%), Positives = 123/184 (66%), Gaps = 1/184 (0%)

Query: 27  HDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSL 86
            +    GFWIYLMSDC++FA  F TYAVL    A GP+  D+FD+  +F  T++LL SS+
Sbjct: 29  GETKQFGFWIYLMSDCILFASLFATYAVLVNGIAGGPSGKDIFDLPFVFTETMLLLFSSI 88

Query: 87  SCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFF 146
           +  F ++A      +     WL +T  FG+ FI ME++EF HLI+    PQRSAFLS+FF
Sbjct: 89  TFGFGIIAMKRND-VAGLKRWLAITFLFGLSFIAMELWEFHHLINEGFGPQRSAFLSAFF 147

Query: 147 ALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
            LVG HGLHV  GLIWL V   Q+  KGL S  Q R  CLS+FWHFLD++WICVF+ VYL
Sbjct: 148 TLVGTHGLHVTAGLIWLSVCYYQVSTKGLTSMMQTRFYCLSLFWHFLDIVWICVFTIVYL 207

Query: 207 MGVV 210
           +GVV
Sbjct: 208 LGVV 211


>gi|30022030|ref|NP_833661.1| cytochrome c oxidase polypeptide III [Bacillus cereus ATCC 14579]
 gi|29897586|gb|AAP10862.1| Cytochrome c oxidase polypeptide III [Bacillus cereus ATCC 14579]
          Length = 207

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 58/192 (30%), Positives = 103/192 (53%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++    ++GFW++L  + ++FA  F TY  L  +   GP   ++F +  +F+ T
Sbjct: 15  EPEKATLEGKNKFVGFWLFLGGETVLFASLFGTYLALKNSTNGGPTSQEMFQMPLVFIMT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           ++LL SSL+  +AM            +  L+                + +    +   + 
Sbjct: 75  MLLLTSSLTSVYAMYHMKNFNFKKMQLWLLVTVLLGLGFLGFEIYEFYHYTHEFKHTMRS 134

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF  +F+ALVG HGLHV FGL W+  L+ +  K+GL   N  +    S++WHF+D++W+
Sbjct: 135 SAFGYAFYALVGTHGLHVLFGLCWILTLIFRNAKRGLNLYNAPKFYVASIYWHFIDVVWV 194

Query: 199 CVFSFVYLMGVV 210
            +F+ VYLMG+V
Sbjct: 195 FIFTVVYLMGMV 206


>gi|15987265|ref|NP_387478.1|COX3_15795 cytochrome c oxidase subunit III [Neoceratodus forsteri]
 gi|15810684|gb|AAL08594.1|AF302933_5 cytochrome oxidase subunit 3 [Neoceratodus forsteri]
          Length = 261

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/196 (19%), Positives = 73/196 (37%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  +++ S+ L F   F  +                P  I   D  
Sbjct: 68  QGHHTLPVQKGLRYGMILFITSEVLFFFGIFWAFYHSSLAPTPELGGCWPPTGIIPLDPF 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +    + +  L +T   G  F  ++  E+      
Sbjct: 128 EVPLVNTAVLLASGVTVTWAHHSLMEGKRKEAIQSLAITILLGFYFTALQAMEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V +++ ++    S +       + +WHF
Sbjct: 185 PFTIADGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQMQYHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|58581254|ref|YP_200270.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|58425848|gb|AAW74885.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas oryzae pv.
           oryzae KACC10331]
          Length = 210

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 100/182 (54%), Positives = 125/182 (68%), Gaps = 1/182 (0%)

Query: 29  GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSC 88
            T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL SSLS 
Sbjct: 30  NTVFGFWVYLMSDCLLFAGLFATYAVLSGATVDGPTAKELFDLKFVLVETFLLLFSSLSF 89

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            FAM+A+  +++      W+ VTA  G+ F+ MEI+EF HLI   A P RSAFLS+FF L
Sbjct: 90  GFAMIAAHKRKM-GGLYGWMAVTALLGIGFLCMEIWEFNHLIHEGAGPGRSAFLSAFFTL 148

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           VG HGLHV  GL+W+ VLVIQI K GL + N  RL CLS+FWHFLD+IWI VF+ VYL+G
Sbjct: 149 VGTHGLHVASGLLWMAVLVIQISKNGLTARNSTRLACLSLFWHFLDIIWIGVFTVVYLLG 208

Query: 209 VV 210
            +
Sbjct: 209 AL 210


>gi|291612421|ref|YP_003540890.1| cytochrome c oxidase subunit III [Hypsiglena chlorophaea
           deserticola]
 gi|189164491|gb|ACD77426.1| cytochrome c oxidase subunit III [Hypsiglena chlorophaea
           deserticola]
          Length = 261

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 40/198 (20%), Positives = 75/198 (37%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF     +             P  I   D
Sbjct: 66  TYQGHHTKGVQKNMRYGMILFITSEVFFFLGFFWALYHVSLVPTPELGAEWPPTGIIPLD 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +  K    +    L+ T   G+ F  +++ E+   +
Sbjct: 126 PMEVPLLNTTVLLSSGATITWSHHTMMKGNKKEATYALMATIMLGVYFTALQMSEY---L 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L V +++++K    + +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMIGTSFLMVCILRLIKHHFTTTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDIVWLFLYISVYWWG 260


>gi|238866939|ref|YP_002929418.1| cytochrome c oxidase subunit III [Elaphe poryphyracea]
 gi|238626010|gb|ACR48293.1| cytochrome c oxidase subunit 3 [Elaphe poryphyracea]
          Length = 261

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 39/198 (19%), Positives = 75/198 (37%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF     +             P  I   +
Sbjct: 66  TYQGHHTKGVQKNMRYGMILFITSEVFFFLGFFWALYHVSLVPTPELGAEWPPTGITPLN 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +  K    +  + L++T   G+ F +++  E+    
Sbjct: 126 PMEVPLLNTAVLLSSGATITWSHHTMMKGNKKEATNALMLTIILGVYFTVLQASEYM--- 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L + +I++ K    + +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMIGTTFLMICMIRLNKHHFTTTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDIVWLFLYISVYWWG 260


>gi|116014317|ref|YP_788136.1| cytochrome c oxidase subunit III [Verasper moseri]
 gi|115498276|gb|ABI98719.1| cytochrome c oxidase subunit III [Verasper moseri]
          Length = 261

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 42/199 (21%), Positives = 83/199 (41%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPIDVF 69
               +     G   G  +++ S+ L F  FF  +                 AG  P+D F
Sbjct: 68  QGHHTLPVQKGLRYGMILFITSEVLFFLGFFWAFYHSSLAPTPELGGFWPPAGITPLDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  +    +   + +  L +T   G  F  ++  E+   
Sbjct: 128 EVP--LLNTAVLLASGVTVTWAHHSIMEGK-RKQAIHSLALTILLGGYFTFLQALEYH-- 182

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + ++FF   G HGLHV  G  +L V +++ +     S +       + +
Sbjct: 183 -EAPFTIADGVYGATFFVATGFHGLHVLIGSSFLAVCLLRQILHHFTSNHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYISIYWWG 260


>gi|291612267|ref|YP_003540701.1| cytochrome c oxidase subunit III [Hypsiglena chlorophaea
           chlorophaea]
 gi|189164565|gb|ACD77494.1| cytochrome c oxidase subunit III [Hypsiglena chlorophaea
           chlorophaea]
          Length = 261

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 40/198 (20%), Positives = 75/198 (37%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF     +             P  I   D
Sbjct: 66  TYQGHHTKGVQKNMRYGMILFITSEVFFFLGFFWALYHVSLVPTPELGAEWPPTGIIPLD 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +  K    +    L+ T   G+ F  +++ E+   +
Sbjct: 126 PMEVPLLNTTVLLSSGATITWSHHTMMKGNKKEATYALMATIMLGIYFTALQMSEY---L 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L V +++++K    + +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMIGTSFLMVCILRLIKHHFTTTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDIVWLFLYISVYWWG 260


>gi|172061020|ref|YP_001808672.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia ambifaria
           MC40-6]
 gi|171993537|gb|ACB64456.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia ambifaria
           MC40-6]
          Length = 202

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 103/195 (52%), Positives = 131/195 (67%), Gaps = 7/195 (3%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            D          +  GFW+YLM+DC++FA  F T+AVLG  YA GP   D+FDI G+ V 
Sbjct: 13  HDDHPP----SHSVFGFWLYLMTDCVIFAALFATFAVLGNQYAGGPTAKDLFDIPGVAVE 68

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T  LLLSS++  FAMLA+  K+     ++WL VT   G  F+ ME+ EF+HLI+  A PQ
Sbjct: 69  TAALLLSSITYGFAMLAA-YKQRRGALLAWLAVTFALGAAFLAMELREFSHLIADGAGPQ 127

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLICLSMFWHFLDL 195
           RSAFLS+FF LVG HGLHV  GL+W+ VL  QI+ +G  L   + RRL CLS+FWHFLD+
Sbjct: 128 RSAFLSAFFTLVGTHGLHVTAGLLWMIVLAAQIVLRGGDLTDRDLRRLTCLSLFWHFLDI 187

Query: 196 IWICVFSFVYLMGVV 210
           +WICVFSFVYL  V+
Sbjct: 188 VWICVFSFVYLASVI 202


>gi|156878377|ref|YP_001434507.1| cytochrome c oxidase subunit III [Pantherophis slowinskii]
 gi|94537524|gb|ABF29853.1| cytochrome c oxidase subunit 3 [Pantherophis slowinskii]
          Length = 261

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 38/198 (19%), Positives = 75/198 (37%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF     +             P  I   +
Sbjct: 66  TYQGHHTKGVQKNMRYGMILFITSEVFFFLGFFWALYHVSLVPTPELGAEWPPTGITPLN 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
            + + +    +LLSS +       +       ++   L++T   G+ F  ++  E+    
Sbjct: 126 PTEVPLLNTAVLLSSGATITWSHHTMMSGNKKESTYALIITIILGVYFTALQASEYM--- 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L + +I+++K    + +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMIGTTFLMICMIRLIKHHFTTTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDIVWLFLYISVYWWG 260


>gi|167589185|ref|ZP_02381573.1| cytochrome c oxidase, subunit III [Burkholderia ubonensis Bu]
          Length = 204

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 101/198 (51%), Positives = 127/198 (64%), Gaps = 5/198 (2%)

Query: 14  LFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISG 73
           + +  D          +  GFW+YLM+DC++FA  F T+AVLG  YA GP   D+FDI G
Sbjct: 11  VGHADDHDHPP---SHSVFGFWLYLMTDCVIFAALFATFAVLGNQYAGGPTAKDLFDIPG 67

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           + V T  LLLSS++  FAML +        T+ WL VT   G  F+ ME+ EFAHLI+  
Sbjct: 68  VAVETAALLLSSITYGFAMLGAHR-GKRGVTLVWLAVTFVLGAAFLAMELREFAHLIAEG 126

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG-LISGNQRRLICLSMFWHF 192
           A PQRSAFLS+FF LVG HGLHV  GL+W+ VL  Q+     L   + RRL CLS+FWHF
Sbjct: 127 AGPQRSAFLSAFFTLVGTHGLHVSAGLVWMIVLAAQVAFGRELTERDIRRLTCLSLFWHF 186

Query: 193 LDLIWICVFSFVYLMGVV 210
           LD++WICVFSFVYL  V+
Sbjct: 187 LDIVWICVFSFVYLASVI 204


>gi|57282273|emb|CAD32365.1| cytochrome oxidase subunit 3 [Xerophyllum tenax]
          Length = 265

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 80/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L  T    ++    +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALAATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF+  G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFSATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|289670392|ref|ZP_06491467.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas campestris
           pv. musacearum NCPPB4381]
          Length = 210

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 100/182 (54%), Positives = 125/182 (68%), Gaps = 1/182 (0%)

Query: 29  GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSC 88
            T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL SSLS 
Sbjct: 30  NTVFGFWVYLMSDCLLFAGLFATYAVLSGATVDGPTAKELFDLKFVLVETFLLLFSSLSF 89

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            FAM+A+  +++      WL VTA  G+ F+ ME++EF HLI   A P RSAFLS+FF L
Sbjct: 90  GFAMIAAHKRKM-GGLYGWLAVTALLGIGFLCMEVWEFNHLIHEGAGPSRSAFLSAFFTL 148

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           VG HGLHV  GL+W+ VLVIQI K GL + N  RL CLS+FWHFLD+IWI VF+ VYL+G
Sbjct: 149 VGTHGLHVASGLLWMAVLVIQISKNGLTARNSTRLACLSLFWHFLDIIWIGVFTVVYLLG 208

Query: 209 VV 210
            +
Sbjct: 209 AL 210


>gi|289678124|ref|ZP_06499014.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. syringae FF5]
          Length = 210

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 94/181 (51%), Positives = 125/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLM+DC++FA FF  YAV+  + A GP+  D+F +  + V T  LL+SS++  
Sbjct: 31  TVYGFWLYLMTDCVLFASFFAVYAVMVNSVAGGPSGQDIFLLPFVAVETAFLLVSSITYG 90

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAMLA   K    + + WL +T   G  FI ME+YEF HLI     P RS FLS+FFALV
Sbjct: 91  FAMLAL-YKGNKSQVLGWLALTFLCGAAFIGMEVYEFHHLIEEGFGPSRSGFLSAFFALV 149

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           GLHG+HV  GLIW+ +++ Q+ KKGL + N+ RL CLS+FWHFLD++WI VF+ VYLMG 
Sbjct: 150 GLHGVHVTSGLIWMAIMMFQVQKKGLTNTNKTRLSCLSLFWHFLDVVWIGVFTVVYLMGA 209

Query: 210 V 210
           +
Sbjct: 210 L 210


>gi|171318687|ref|ZP_02907831.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia ambifaria
           MEX-5]
 gi|171096122|gb|EDT41047.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia ambifaria
           MEX-5]
          Length = 202

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 103/195 (52%), Positives = 131/195 (67%), Gaps = 7/195 (3%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            D          +  GFW+YLM+DC++FA  F T+AVLG  YA GP   D+FDI G+ V 
Sbjct: 13  HDDHPP----SHSVFGFWLYLMTDCVIFAALFATFAVLGNQYAGGPTAKDLFDIPGVAVE 68

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T  LLLSS++  FAMLA+  K+     ++WL VT   G  F+ ME+ EF+HLI+  A PQ
Sbjct: 69  TAALLLSSITYGFAMLAA-YKQRRGALLAWLAVTFVLGAAFLAMELREFSHLIAEGAGPQ 127

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLICLSMFWHFLDL 195
           RSAFLS+FF LVG HGLHV  GL+W+ VL  QI+ +G  L   + RRL CLS+FWHFLD+
Sbjct: 128 RSAFLSAFFTLVGTHGLHVTAGLLWMIVLAGQIVLRGGDLTDRDLRRLTCLSLFWHFLDI 187

Query: 196 IWICVFSFVYLMGVV 210
           +WICVFSFVYL  V+
Sbjct: 188 VWICVFSFVYLASVI 202


>gi|28868535|ref|NP_791154.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|213968331|ref|ZP_03396475.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. tomato T1]
 gi|301383463|ref|ZP_07231881.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. tomato Max13]
 gi|302060280|ref|ZP_07251821.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. tomato K40]
 gi|302129917|ref|ZP_07255907.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. tomato NCPPB 1108]
 gi|28851773|gb|AAO54849.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|213926969|gb|EEB60520.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. tomato T1]
 gi|331015176|gb|EGH95232.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. lachrymans str. M302278PT]
          Length = 210

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 95/181 (52%), Positives = 125/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLM+DC++FA FF  YAV+  + A GP+  D+F +  + V T  LL+SS++  
Sbjct: 31  TVYGFWLYLMTDCVLFASFFAVYAVMVNSVAGGPSGQDIFLLPFVAVETAFLLVSSITYG 90

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAMLA   K    + + WL +T   G  FI MEIYEF HLI     P RS FLS+FFALV
Sbjct: 91  FAMLAL-YKGKKSQVLGWLALTFLCGAAFIGMEIYEFHHLIHEGYGPSRSGFLSAFFALV 149

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           GLHG+HV  GLIW+ +++ Q+ KKGL + N+ RL CLS+FWHFLD++WI VF+ VYLMG 
Sbjct: 150 GLHGVHVTSGLIWMAIMMFQVQKKGLTNTNKTRLSCLSLFWHFLDVVWIGVFTVVYLMGA 209

Query: 210 V 210
           +
Sbjct: 210 L 210


>gi|75914857|gb|ABA29790.1| cytochrome c oxidase subunit III [Mammuthus primigenius]
          Length = 269

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 45/197 (22%), Positives = 84/197 (42%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               + V  +G   G  +++ S+ L F  FF  +  + L      G     V        
Sbjct: 68  QGHHTPVVQEGLRYGMILFITSEVLFFTGFFWAFYHSSLAPTPELGSYWPPVGVYPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S ++ ++A  +       +  +  LL+T   G+ F +++++E+     
Sbjct: 128 EVPLLNTSVLLASGVTITWAHHSLMEGNRKN-MLQALLITILLGVYFTLLQMFEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L    I+ LK    S +       + +WH
Sbjct: 184 ASFTISDGIYGSTFFVTTGFHGLHVIIGSTFLLTCFIRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYLSIYWWG 260


>gi|70732059|ref|YP_261815.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas fluorescens
           Pf-5]
 gi|68346358|gb|AAY93964.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas
           fluorescens Pf-5]
          Length = 204

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 92/197 (46%), Positives = 128/197 (64%), Gaps = 2/197 (1%)

Query: 13  SLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDIS 72
            + +  ++            GFW+YLM+DC++FA  F +YAVL  + A GP+ +DVF++ 
Sbjct: 9   DIAHSHEQGHEDAGSL-RLFGFWVYLMTDCILFATLFASYAVLRDSVAGGPSTMDVFELP 67

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            +   T++LLLSS++  FAMLA   +    + + WL +TA  G+ F+ MEI EF  LIS 
Sbjct: 68  YVLAETLLLLLSSITYGFAMLA-MNRDQRTQVLRWLGLTALLGLGFVAMEINEFHQLISE 126

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
              P RS FLS+FF LVG HGLHV  GL+W+ VL+ Q+  +GL +    RL CLS+FWHF
Sbjct: 127 GHGPDRSGFLSAFFTLVGTHGLHVACGLVWMAVLMWQVHSRGLGAIQATRLSCLSLFWHF 186

Query: 193 LDLIWICVFSFVYLMGV 209
           LD+IWICVF+ VYL+GV
Sbjct: 187 LDVIWICVFTVVYLLGV 203


>gi|9695366|ref|NP_037588.1| cytochrome c oxidase subunit III [Paralichthys olivaceus]
 gi|6683100|dbj|BAA89039.1| cytochrome oxidase subunit-3 [Paralichthys olivaceus]
          Length = 261

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 83/199 (41%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPIDVF 69
               +     G   G  +++ S+ L F  FF  +                 AG  P+D F
Sbjct: 68  QGHHTPPVQKGLRYGMILFITSEVLFFLGFFWAFYHASLAPTPELGGFWPPAGITPLDPF 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S ++ ++A  +    +   + +  L +T   G  F  ++  E+   
Sbjct: 128 EVP--LLNTAVLLASGVTVTWAHHSIMEGK-RKQAIHSLFLTILLGGYFTFLQALEYH-- 182

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + ++FF   G HGLHV  G  +L V +++ +     + +       + +
Sbjct: 183 -EAPFTIADGVYGATFFVATGFHGLHVLIGSTFLAVCLLRQILHHFTANHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYISIYWWG 260


>gi|157367433|gb|ABV45568.1| cytochrome c oxidase subunit III [Mammuthus primigenius]
 gi|157367447|gb|ABV45581.1| cytochrome c oxidase subunit III [Mammuthus primigenius]
 gi|157367503|gb|ABV45633.1| cytochrome c oxidase subunit III [Mammuthus primigenius]
 gi|157367571|gb|ABV45675.1| cytochrome c oxidase subunit III [Mammuthus primigenius]
 gi|157367585|gb|ABV45688.1| cytochrome c oxidase subunit III [Mammuthus primigenius]
 gi|157367599|gb|ABV45701.1| cytochrome c oxidase subunit III [Mammuthus primigenius]
 gi|157367613|gb|ABV45714.1| cytochrome c oxidase subunit III [Mammuthus primigenius]
 gi|157367627|gb|ABV45727.1| cytochrome c oxidase subunit III [Mammuthus primigenius]
 gi|157367641|gb|ABV45740.1| cytochrome c oxidase subunit III [Mammuthus primigenius]
 gi|157367655|gb|ABV45753.1| cytochrome c oxidase subunit III [Mammuthus primigenius]
 gi|157367669|gb|ABV45766.1| cytochrome c oxidase subunit III [Mammuthus primigenius]
 gi|157367683|gb|ABV45779.1| cytochrome c oxidase subunit III [Mammuthus primigenius]
 gi|157367697|gb|ABV45792.1| cytochrome c oxidase subunit III [Mammuthus primigenius]
          Length = 269

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 45/197 (22%), Positives = 84/197 (42%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               + V  +G   G  +++ S+ L F  FF  +  + L      G     V        
Sbjct: 68  QGHHTPVVQEGLRYGMILFITSEVLFFTGFFWAFYHSSLAPTPELGSYWPPVGVYPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S ++ ++A  +       +  +  LL+T   G+ F +++++E+     
Sbjct: 128 EVPLLNTSVLLASGVTITWAHHSLMEGNRKN-MLQALLITILLGVYFTLLQMFEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L    I+ LK    S +       + +WH
Sbjct: 184 ASFTISDGIYGSTFFVTTGFHGLHVIIGSTFLLTCFIRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYLSIYWWG 260


>gi|148656389|ref|YP_001276594.1| cytochrome c oxidase subunit III [Roseiflexus sp. RS-1]
 gi|148568499|gb|ABQ90644.1| cytochrome c oxidase, subunit III [Roseiflexus sp. RS-1]
          Length = 202

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 58/195 (29%), Positives = 84/195 (43%), Gaps = 4/195 (2%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY---AAGPAPIDVFDIS 72
           +      + +  D   LG W ++ S+ L FA    TY V             P +  DI 
Sbjct: 9   HGAVAHHTSLGVDNRKLGVWAFIGSETLFFATLITTYFVFAPVNRARPDFQDPREFLDIE 68

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
              V   +LL SSL+   A+ AS        T   L      G+ FI  + YEF HL   
Sbjct: 69  LTTVLASILLASSLTMVLALSASRRGDRRSFTTWLLATVG-LGLAFIGGQAYEFNHLYHE 127

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                 S F ++FF L G HG HV  G+IWL  +  ++        N   +    ++WHF
Sbjct: 128 GLTLSSSLFGTTFFVLTGFHGTHVAIGVIWLLSVFFKVRAYPDSPENVMDVEIAGLYWHF 187

Query: 193 LDLIWICVFSFVYLM 207
           +DL+W+ +F  VYL+
Sbjct: 188 VDLVWVAIFVLVYLI 202


>gi|89280753|ref|YP_514631.1| cytochrome c oxidase subunit 3 [Oryza sativa Indica Group]
 gi|74100120|gb|AAZ99284.1| cytochrome c oxidase subunit 3 [Oryza sativa Indica Group]
          Length = 280

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 79/199 (39%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDIS 72
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 86  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPW 145

Query: 73  -GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 146 EIPLLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVLLALVSTGFQGMEY---YQ 201

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++L V  I+     L   +       + +WH
Sbjct: 202 APSTISDSIYGSTFFLATGFHGFHVIIGTLFLIVCGIRQYLGHLTKKHHVGFEAAAWYWH 261

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 262 FVDVVRLFPFVSIYWWGGI 280


>gi|164422225|gb|ABY55198.1| cox3 [Bambusa oldhamii]
 gi|291498601|gb|ADE08075.1| cox3-1 [Triticum aestivum]
 gi|291498602|gb|ADE08076.1| cox3-2 [Triticum aestivum]
          Length = 265

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 79/199 (39%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDIS 72
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPW 130

Query: 73  -GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPLLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++L V  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFLATGFHGFHVIIGTLFLIVCGIRQYLGHLTKKHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|325928655|ref|ZP_08189834.1| cytochrome bo3 quinol oxidase subunit 3 [Xanthomonas perforans
           91-118]
 gi|325540983|gb|EGD12546.1| cytochrome bo3 quinol oxidase subunit 3 [Xanthomonas perforans
           91-118]
          Length = 210

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 100/182 (54%), Positives = 125/182 (68%), Gaps = 1/182 (0%)

Query: 29  GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSC 88
            T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL SSLS 
Sbjct: 30  NTVFGFWVYLMSDCLLFAGLFATYAVLSGATVDGPTAKELFDLKFVLVETFLLLFSSLSF 89

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            FAM+A+  +++      WL VTA  G+ F+ ME++EF HLI   A P RSAFLS+FF L
Sbjct: 90  GFAMIAAHKRKM-GGLYGWLAVTALLGIGFLCMEVWEFNHLIHEGAGPGRSAFLSAFFTL 148

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           VG HGLHV  GL+W+ VLVIQI K GL + N  RL CLS+FWHFLD+IWI VF+ VYL+G
Sbjct: 149 VGTHGLHVASGLLWMAVLVIQISKNGLTARNSTRLACLSLFWHFLDIIWIGVFTVVYLLG 208

Query: 209 VV 210
            +
Sbjct: 209 AL 210


>gi|5835567|ref|NP_008412.1|COX3_13947 cytochrome c oxidase subunit III [Ovis aries]
 gi|5921883|sp|O21619|COX3_SHEEP RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|3366635|gb|AAD10108.1| cytochrome c-oxidase subunit 3 [Ovis aries]
          Length = 261

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRYHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYMSIYWWG 260


>gi|219560208|gb|ACL27333.1| cytochrome c oxidase subunit III [Globicephala melas]
 gi|294679536|gb|ADF29577.1| cytochrome c oxidase subunit III [Globicephala melas]
 gi|326370257|gb|ADZ56097.1| cytochrome c oxidase subunit III [Globicephala melas]
 gi|326370271|gb|ADZ56110.1| cytochrome c oxidase subunit III [Globicephala melas]
          Length = 261

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 42/197 (21%), Positives = 81/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               +     G   G  ++++S+ L F  FF  +  + L      G +            
Sbjct: 68  QGHHTPTVQKGLRYGMILFILSEALFFTGFFWAFYHSSLAPTPELGGSWPPTGIRPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  LL+T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMQGNRKH-MLQALLITITLGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L +  ++ +     S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIICFMRQMLFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|257487315|ref|ZP_05641356.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. tabaci ATCC 11528]
 gi|289623937|ref|ZP_06456891.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. aesculi str. NCPPB3681]
 gi|289646771|ref|ZP_06478114.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. aesculi str. 2250]
 gi|298485879|ref|ZP_07003955.1| Cytochrome O ubiquinol oxidase subunit III [Pseudomonas savastanoi
           pv. savastanoi NCPPB 3335]
 gi|298159568|gb|EFI00613.1| Cytochrome O ubiquinol oxidase subunit III [Pseudomonas savastanoi
           pv. savastanoi NCPPB 3335]
          Length = 210

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 95/181 (52%), Positives = 124/181 (68%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLM+DC++FA FF  YAV+  + A GP+  D+F +  + V T  LL+SS++  
Sbjct: 31  TVYGFWLYLMTDCVLFASFFAVYAVMVNSVAGGPSGQDIFLLPFVAVETAFLLVSSITYG 90

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAMLA   K    + + WL +T   G  FI MEIYEF HLI     P RS FLS+FFALV
Sbjct: 91  FAMLAL-YKGKKSQVLGWLALTFLCGAAFIGMEIYEFHHLIHEGYGPSRSGFLSAFFALV 149

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           GLHG HV  GLIW+ +++ Q+ KKGL + N+ RL CLS+FWHFLD++WI VF+ VYLMG 
Sbjct: 150 GLHGAHVTSGLIWMAIMMFQVQKKGLTNTNKTRLSCLSLFWHFLDVVWIGVFTVVYLMGA 209

Query: 210 V 210
           +
Sbjct: 210 L 210


>gi|109689602|ref|YP_659440.1| cytochrome c oxidase subunit III [Semnopithecus entellus]
 gi|88174239|gb|ABD39246.1| cytochrome c oxidase subunit III [Semnopithecus entellus]
          Length = 261

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 43/201 (21%), Positives = 84/201 (41%), Gaps = 15/201 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG---------KNYAAGPAPID 67
                 +     G   G  ++++S+  +FA FF  +                  G  P++
Sbjct: 66  TYQGHHTAPVQKGLRYGMILFIISEAFLFAGFFWAFYHSSLAPTPHLGGHWPPTGIIPLN 125

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
             ++    ++T VLL S ++ ++A  +        +T+  L +T   G+ F +++I E+ 
Sbjct: 126 PLEVP--LLNTSVLLASGVTITWAHHSLMENN-RKQTIQALFITILLGIYFTLLQISEY- 181

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
                        + S+FF   G HG HV  G  +L V  I+ L     S +       +
Sbjct: 182 --YEAPFTISDGIYGSTFFIATGFHGFHVIIGSTFLTVCFIRQLLYHFTSKHHFGFEAAA 239

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ ++  +Y  G
Sbjct: 240 WYWHFVDVVWLLLYISIYWWG 260


>gi|325511717|gb|ADZ23045.1| cytochrome c oxidase subunit III [Orcaella brevirostris]
          Length = 261

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 81/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               +     G   G  ++++S+ L F  FF  +  + L      G +            
Sbjct: 68  QGHHTPTVQKGLRYGMILFILSEVLFFTGFFWAFYHSSLAPTPELGGSWPPTGIHPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  LL+T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MLQALLITIMLGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +     S +       + +WH
Sbjct: 184 APFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFMRQVMFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|291612379|ref|YP_003540805.1| cytochrome c oxidase subunit III [Sibon nebulatus]
 gi|189164435|gb|ACD77374.1| cytochrome c oxidase subunit III [Sibon nebulatus]
          Length = 261

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 38/198 (19%), Positives = 77/198 (38%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYA----AGPAPIDVFD 70
                 +         G  +++ S+   F  FF    +  L           P  I   +
Sbjct: 66  TYQGHHTKGVQKNMRYGMILFITSEVFFFLGFFWALYHVSLVPTPELGAQWPPTGIIPLN 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +       +    L+ T F G+ F  +++ E+   +
Sbjct: 126 PMEVPLLNTTVLLSSGATITWSHHTMMCGNKKEATFALMTTIFLGVYFTALQMSEY---L 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
             +     S + S FF   G HGLHV  G  +L + ++++++    + +         +W
Sbjct: 183 ETQFTISDSVYGSLFFVATGFHGLHVIIGTTFLTICMLRLIRHHFTTTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDIVWLFLYISVYWWG 260


>gi|57281952|emb|CAD19463.1| cytochrome oxidase subunit 3 [Alstroemeria hybrid cultivar]
 gi|57282247|emb|CAD32352.1| cytochrome oxidase subunit 3 [Milligania stylosa]
 gi|57282251|emb|CAD32354.1| cytochrome oxidase subunit 3 [Doryanthes palmeri]
 gi|57282257|emb|CAD32357.1| cytochrome oxidase subunit 3 [Blandfordia punicea]
          Length = 265

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 81/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF+  G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFSATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|189164351|gb|ACD77296.1| cytochrome c oxidase subunit III [Hypsiglena chlorophaea
           chlorophaea]
          Length = 261

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 40/198 (20%), Positives = 75/198 (37%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF     +             P  I   D
Sbjct: 66  TYQGHHTKGVQKNMRYGMILFITSEVFFFLGFFWALYHVSLVPTPELGAEWPPTGIIPLD 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +  K    +    L+ T   G+ F  +++ E+   +
Sbjct: 126 PMEVPLLNTTVLLSSGATITWSHHTMMKGNKKEATYALMATIMLGVYFTALQMSEY---L 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L V +++++K    + +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMIGTSFLMVCILRLIKHHFTTTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDIVWLFLYISVYWWG 260


>gi|21325920|gb|AAM47526.1|AF280607_1 cytochrome oxidase subunit III [Solanum tuberosum]
          Length = 265

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 44/199 (22%), Positives = 83/199 (41%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDIS 72
           +   + V   G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKVVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPW 130

Query: 73  -GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++F   +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVFTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++L V  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFLATGFHGFHVIIGTLFLIVCGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ + +F  +Y  G +
Sbjct: 247 FVDVVRLFLFVSIYWWGGI 265


>gi|21622587|emb|CAD21712.2| cytochrome oxidase III [Odobenus rosmarus rosmarus]
          Length = 403

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 43/199 (21%), Positives = 81/199 (40%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPIDVF 69
               +     G   G  +++ S+             +    T  + G     G  P++  
Sbjct: 68  QGHHTPTVQKGLRYGMILFITSEVFFFAGFFWAFYHSSLAPTPELGGCWPPTGITPLNPL 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S +S ++A L        H  +  L +T   G+ F +++  E+   
Sbjct: 128 EVP--LLNTSVLLASGVSITWAHLCLMEGNRKH-MLQALFITILLGLYFTLLQASEY--- 181

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + S+FF   G HGLHV  G  +L V  ++ LK    S +       + +
Sbjct: 182 YETSFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFLRQLKFHFTSNHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYVSIYWWG 260


>gi|15888114|ref|NP_353795.1| cytochrome c oxidase subunit III [Agrobacterium tumefaciens str.
           C58]
 gi|15155746|gb|AAK86580.1| cytochrome c oxidase subunit III [Agrobacterium tumefaciens str.
           C58]
          Length = 291

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 44/206 (21%), Positives = 84/206 (40%), Gaps = 17/206 (8%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG--------------KNYAAG 62
             +   + V       G  +++ S+ + F  +F  Y                        
Sbjct: 81  ANEGSHTRVVSLHLRYGMIMFIASEVMFFVAWFWAYFDASLFPHEAIQASRLEYTGGQWP 140

Query: 63  PAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIME 122
           P  I+V D   + +   V+LL S +C      +         +S L +T   G++F  ++
Sbjct: 141 PKGIEVIDPWHLPLYNTVILLLSGTCVTWAHHALLHNDRKGLISGLALTVALGVLFSTVQ 200

Query: 123 IYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRR 182
           +YE+   I      + S + ++FF   G HG HVF G ++L V + + +  G        
Sbjct: 201 VYEY---IHAPFDFKNSIYGATFFMATGFHGFHVFVGTVFLLVCLFRAIAGGFTPKQHFG 257

Query: 183 LICLSMFWHFLDLIWICVFSFVYLMG 208
               + +WHF+D++W+ +F  +Y+ G
Sbjct: 258 FEAAAWYWHFVDVVWLFLFFAIYIWG 283


>gi|163857013|ref|YP_001631311.1| cytochrome o ubiquinol oxidase subunit III [Bordetella petrii DSM
           12804]
 gi|163260741|emb|CAP43043.1| cytochrome o ubiquinol oxidase subunit III [Bordetella petrii]
          Length = 203

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 102/193 (52%), Positives = 130/193 (67%), Gaps = 3/193 (1%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
                   D   T  GFWIYLMSD L+F+V F T+AVL K  A GP   ++FD+S + V 
Sbjct: 14  HAGHH--DDGSKTVFGFWIYLMSDLLIFSVLFATFAVLSKATAGGPTGAELFDLSFVLVE 71

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T++LL+SS +   AML     R   + + WL VT  FG  FI MEIYEF HLI+  A PQ
Sbjct: 72  TMLLLISSFTFGMAMLNLHAGRAR-RVIGWLCVTFLFGAGFIGMEIYEFHHLITEGAGPQ 130

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
           RSA+LS+FF L+G HGLHV FGL+W+ V+V  + + GL S N RRL CLS+FWHFLD++W
Sbjct: 131 RSAYLSAFFTLIGTHGLHVTFGLVWIAVMVDMVRRHGLDSVNVRRLSCLSLFWHFLDIVW 190

Query: 198 ICVFSFVYLMGVV 210
           ICVF+FVYL+G +
Sbjct: 191 ICVFTFVYLLGAL 203


>gi|332290094|ref|YP_004420946.1| cytochrome o ubiquinol oxidase subunit III [Gallibacterium anatis
           UMN179]
 gi|330432990|gb|AEC18049.1| cytochrome o ubiquinol oxidase subunit III [Gallibacterium anatis
           UMN179]
          Length = 202

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 94/194 (48%), Positives = 124/194 (63%), Gaps = 3/194 (1%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
           V               GFWIYLMSD ++F+  F TY VL    A  P+  D+F++  + V
Sbjct: 11  VHQGHHDTGPIK--VFGFWIYLMSDLILFSCLFATYIVLLPGTAGAPSGKDIFELPYVLV 68

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
            T +LL SS++  FA+LA        + + WL+VT  FG  F+ MEI EF HLI+    P
Sbjct: 69  ETFLLLFSSITYGFAVLAMNRNNAK-QVLLWLVVTFLFGAAFVGMEINEFHHLIAQGVGP 127

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
            RS FLS FF LVG HGLHV  GLIW+ V++IQ++ +GL + N+ RL+CLS+FWHFLD++
Sbjct: 128 DRSGFLSGFFTLVGTHGLHVTAGLIWMVVMMIQVVTRGLSAVNRTRLMCLSLFWHFLDIV 187

Query: 197 WICVFSFVYLMGVV 210
           WICVFS VYLMGV+
Sbjct: 188 WICVFSVVYLMGVL 201


>gi|294627030|ref|ZP_06705620.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
 gi|292598692|gb|EFF42839.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
          Length = 208

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 100/182 (54%), Positives = 125/182 (68%), Gaps = 1/182 (0%)

Query: 29  GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSC 88
            T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL SSLS 
Sbjct: 28  NTVFGFWVYLMSDCLLFAGLFATYAVLSGATVNGPTAKELFDLKFVLVETFLLLFSSLSF 87

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            FAM+A+  +++      WL VTA  G+ F+ ME++EF HLI   A P RSAFLS+FF L
Sbjct: 88  GFAMIAAHKRKM-GGLYGWLAVTALLGIGFLCMEVWEFNHLIHEGAGPGRSAFLSAFFTL 146

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           VG HGLHV  GL+W+ VLVIQI K GL + N  RL CLS+FWHFLD+IWI VF+ VYL+G
Sbjct: 147 VGTHGLHVASGLLWMAVLVIQISKNGLTARNSTRLACLSLFWHFLDIIWIGVFTVVYLLG 206

Query: 209 VV 210
            +
Sbjct: 207 AL 208


>gi|209886946|ref|YP_002290798.1| cytochrome c oxidase subunit III [Daboia russellii]
 gi|194395450|gb|ACF60286.1| cytochrome c oxidase subunit III [Daboia russellii]
          Length = 261

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 41/198 (20%), Positives = 76/198 (38%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF T   +             P  I   +
Sbjct: 66  TYQGHHTMGVQKNMRYGMILFITSEVFFFLGFFWTLYHVSLVPTPELGAEWPPTGISPLN 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +  K    +    LL+T   G+ F  +++ E+    
Sbjct: 126 PMDVPLLNTAVLLSSGATITWSHHTMMKGNKKEATYALLITIILGIYFTALQVSEYMD-- 183

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L + +I+++K    + +         +W
Sbjct: 184 -TPFTISDSVYGSLFFVATGFHGLHVMIGTSFLLICLIRLIKYHFTTTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDVVWLFLYISVYWWG 260


>gi|76780586|emb|CAD92023.1| cytochrome oxidase subunit 3 [Xeronema callistemon]
          Length = 265

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 81/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTPILPSSEAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF+  G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFSATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|170701548|ref|ZP_02892498.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia ambifaria
           IOP40-10]
 gi|170133542|gb|EDT01920.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia ambifaria
           IOP40-10]
          Length = 202

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 102/195 (52%), Positives = 131/195 (67%), Gaps = 7/195 (3%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            D          +  GFW+YLM+DC++FA  F T+AVLG  +A GP   D+FDI G+ V 
Sbjct: 13  HDDHPP----SHSVFGFWLYLMTDCVIFAALFATFAVLGNQHAGGPTAKDLFDIPGVAVE 68

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T  LLLSS++  FAMLA+  K+     ++WL VT   G  F+ ME+ EF+HLI+  A PQ
Sbjct: 69  TAALLLSSITYGFAMLAA-YKQRRGALLAWLAVTFVLGAAFLAMELREFSHLIADGAGPQ 127

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLICLSMFWHFLDL 195
           RSAFLS+FF LVG HGLHV  GL+W+ VL  QI+ +G  L   + RRL CLS+FWHFLD+
Sbjct: 128 RSAFLSAFFTLVGTHGLHVTAGLLWMIVLAGQIVLRGGDLTDRDLRRLTCLSLFWHFLDI 187

Query: 196 IWICVFSFVYLMGVV 210
           +WICVFSFVYL  V+
Sbjct: 188 VWICVFSFVYLASVI 202


>gi|239906127|ref|YP_002952866.1| cytochrome o ubiquinol oxidase subunit III [Desulfovibrio
           magneticus RS-1]
 gi|239795991|dbj|BAH74980.1| cytochrome o ubiquinol oxidase subunit III [Desulfovibrio
           magneticus RS-1]
          Length = 210

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 89/210 (42%), Positives = 123/210 (58%), Gaps = 1/210 (0%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA 60
           M+  +    P            S    +    GFW+YLMSD ++F+  F TY V+  NYA
Sbjct: 1   MTTAQTAHLPGAPGHEAHGGNGSHDMGEIQAFGFWLYLMSDLIVFSALFATYVVMAHNYA 60

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
            GP P D+F++  + V T++LL SS +   AM+A     L       L+     G+ F++
Sbjct: 61  GGPTPKDLFELPAVLVETMLLLTSSAAYGLAMVAMHKGDLRS-VRLGLVAAFALGLGFLV 119

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
           ME+ EF H I + A P RS FLS+FF LVG HGLHV FGL+W+ V++ Q+  KGL +  +
Sbjct: 120 MELAEFHHFIGIGAGPDRSGFLSAFFTLVGTHGLHVTFGLLWIVVMLAQLASKGLTAPVK 179

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
            RL  L MFWHFLD++WI VF+ VYL+GVV
Sbjct: 180 GRLTRLGMFWHFLDIVWIGVFTVVYLLGVV 209


>gi|76780584|emb|CAD92022.1| cytochrome oxidase subunit 3 [Eriospermum flagelliforme]
          Length = 265

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 80/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTPILPSSEAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|32490898|ref|NP_871152.1| hypothetical protein WGLp149 [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|25166104|dbj|BAC24295.1| cyoC [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 205

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 90/192 (46%), Positives = 122/192 (63%), Gaps = 1/192 (0%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
              ES        LGFW+YLMSDC++FA  F TY VL  N A GP+  ++F+I  +F+ T
Sbjct: 14  HNNESNNHEKTKILGFWVYLMSDCILFATLFATYFVLKDNVANGPSGKEIFEIPLVFLET 73

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           I+LL SS++CS A  +        KT  WL +T   G+IFI +EI EF  LI     P R
Sbjct: 74  IILLSSSMTCSIASFSIKKNN-KIKTNIWLFITVILGIIFINIEISEFYSLICKNYGPDR 132

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAFLS FF +VG HG+HV  G+IW+ V++IQI   G    N+ RL  LS+FW+FL++IWI
Sbjct: 133 SAFLSIFFTIVGTHGVHVISGIIWMIVIMIQIYFYGCDKINKIRLKLLSLFWYFLEIIWI 192

Query: 199 CVFSFVYLMGVV 210
            VF+ +YL+G++
Sbjct: 193 FVFNVIYLLGII 204


>gi|91775646|ref|YP_545402.1| cytochrome c oxidase, subunit III [Methylobacillus flagellatus KT]
 gi|91709633|gb|ABE49561.1| cytochrome bo3 quinol oxidase subunit 3 [Methylobacillus
           flagellatus KT]
          Length = 205

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 96/179 (53%), Positives = 125/179 (69%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
            GFWIYLM+D ++FA  F TYAVL  ++A GP   D+F++  + + T +LL SS++  FA
Sbjct: 28  FGFWIYLMTDLILFATLFATYAVLSTSFAGGPTGKDIFELDYVLIETFLLLFSSITYGFA 87

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           M+A   K      ++WL +T  FG+ FI+ME+ EF HLI     P RSAFLS+FF LVG 
Sbjct: 88  MIA-QHKGNKQAVLNWLAITFLFGLGFIVMEVNEFHHLIHQGFGPDRSAFLSAFFTLVGT 146

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HGLHV  GLIW+ VL+ QI  KGL   N  RL+CLS+FWHFLD++WICVF+ VYLMGV+
Sbjct: 147 HGLHVTCGLIWMAVLMAQIWTKGLTETNNTRLMCLSLFWHFLDIVWICVFTVVYLMGVL 205


>gi|134296074|ref|YP_001119809.1| cytochrome c oxidase subunit III [Burkholderia vietnamiensis G4]
 gi|134139231|gb|ABO54974.1| cytochrome bo3 quinol oxidase subunit 3 [Burkholderia vietnamiensis
           G4]
          Length = 202

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 102/195 (52%), Positives = 128/195 (65%), Gaps = 7/195 (3%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            D          +  GFW+YLM+DC++FA  F T+AVLG   A GP   D+FDI G+ V 
Sbjct: 13  HDDHPP----SHSVFGFWLYLMTDCVIFAALFATFAVLGNQTAGGPTAKDLFDIPGVAVE 68

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T  LLLSS++  FAMLA   K+     + WL VT   G  F+ ME+ EF+HLI+  A PQ
Sbjct: 69  TAALLLSSITYGFAMLA-GYKQRRGALLGWLAVTFVLGAAFLAMELREFSHLIADGAGPQ 127

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLICLSMFWHFLDL 195
           RSAFLS+FF LVG HGLHV  GL+W+ VL  QI+ +G  L   + RRL CLS+FWHFLD+
Sbjct: 128 RSAFLSAFFTLVGTHGLHVTAGLLWMIVLAGQIVLRGGDLTDRDLRRLTCLSLFWHFLDI 187

Query: 196 IWICVFSFVYLMGVV 210
           +WICVFSFVYL  V+
Sbjct: 188 VWICVFSFVYLASVI 202


>gi|209886960|ref|YP_002290824.1| cytochrome c oxidase subunit III [Bungarus fasciatus]
 gi|170774100|gb|ACB36671.1| cytochrome c oxidase subunit III [Bungarus fasciatus]
          Length = 261

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 38/196 (19%), Positives = 75/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +         G  +++ S+ L F  FF     +             P  I+  +  
Sbjct: 68  QGHHTEGVQKNMRYGMILFITSEVLFFLGFFWALYHVSLVPTPELGAEWPPTGINPLNPM 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LLSS +       +       +    L++T   G+ F  +++ E+      
Sbjct: 128 EVPLLNTAVLLSSGATITWSHHTMMNGNKKEATYALMITIMLGIYFTALQLSEYK---ET 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                 S + S FF   G HG HV  G  +L + +I+++K    + +         +WHF
Sbjct: 185 PFTISDSVYGSLFFVTTGFHGFHVMIGTSFLLICLIRLIKHHFTTTHHFGYEAAIWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  VY  G
Sbjct: 245 VDVVWLFLYISVYWWG 260


>gi|107122079|ref|YP_626373.1| cytochrome c oxidase subunit III [Elephas maximus]
 gi|93204562|sp|Q2I3G8|COX3_ELEMA RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|83415397|gb|ABC17897.1| cytochrome c oxidase subunit III [Elephas maximus]
 gi|148283470|gb|ABQ57317.1| cytochrome c oxidase subunit III [Elephas maximus]
          Length = 261

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 84/197 (42%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               + +  +    G  +++ S+ L F  FF  +  + L      G     V        
Sbjct: 68  QGHHTPIVQESLRYGMILFITSEVLFFTGFFWAFYHSSLAPTPELGSYWPPVGVYPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S ++ ++A  +       +  +  LL+T   G+ F +++++E+     
Sbjct: 128 EVPLLNTSVLLASGVTITWAHHSLMEGSRKN-MLQALLITILLGVYFTLLQMFEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L +  I+ LK    S +       + +WH
Sbjct: 184 ASFTISDGIYGSTFFVTTGFHGLHVIIGSTFLLICFIRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYLSIYWWG 260


>gi|118196971|emb|CAL69863.1| cytochrome oxidase subunit 3 [Pantherophis guttatus guttatus]
          Length = 261

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 38/198 (19%), Positives = 74/198 (37%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF     +             P  I   +
Sbjct: 66  TYQGHHTKGVQKNMRYGMILFITSEVFFFLGFFWALYHVSLVPTPELGAEWPPTGITPLN 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
            + + +    +LLSS +       +       ++   L++T   G+ F  ++  E+    
Sbjct: 126 PTEVPLLNTAVLLSSGATITWSHHTMMSGNKKESTYALIITIMLGIYFTALQASEYM--- 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L + +I+++K      +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMIGTTFLMICMIRLMKHHFTITHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDIVWLFLYISVYWWG 260


>gi|85373377|ref|YP_457439.1| cytochrome C oxidase subunit III [Erythrobacter litoralis HTCC2594]
 gi|84786460|gb|ABC62642.1| cytochrome C oxidase subunit III [Erythrobacter litoralis HTCC2594]
          Length = 287

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 40/216 (18%), Positives = 75/216 (34%), Gaps = 27/216 (12%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAA--------------- 61
                 + V       G  +++ S+ + F  +F  +       A                
Sbjct: 68  AHRGDHTPVVQLHMRYGMILFIASEVMFFVGWFWAFFDFALFPAPIRELSDNVWENLIGQ 127

Query: 62  ---------GPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTA 112
                     P  I+V D   + +   ++LL S +       +            L  T 
Sbjct: 128 EGAAALATFPPEGIEVLDPFSLPLLNTLILLCSGTTVTWAHHALLHGDRDGLKKGLWATV 187

Query: 113 FFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILK 172
             G +F  ++ YE+            + + S+F+   G HG HV  G I+L V +++  K
Sbjct: 188 ALGALFTAIQAYEYG---LAPFGFGGNTYSSAFYMATGFHGFHVLVGTIFLIVCLVRAYK 244

Query: 173 KGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
                         + +WHF+D++W+ +F  VY+ G
Sbjct: 245 GHFTPRQHFGFEAAAWYWHFVDVVWLFLFVAVYIWG 280


>gi|1169061|sp|P09138|COX3_MAIZE RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|13912|emb|CAA31221.1| unnamed protein product [Zea mays]
          Length = 265

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 41/197 (20%), Positives = 79/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDIS 72
           +   +     G   G  ++++S+ + F +FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGPRYGSILFIVSEVMSFFLFFWASSHSSLAPTVEIGGIWPPKGIGVLDPW 130

Query: 73  -GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPLLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVLLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+F    G HG HV  G ++L V  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFLLATGFHGFHVIIGTLFLIVCGIRQYLGHLTKKHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++ +  F  +Y  G
Sbjct: 247 FVDVVRLFPFVSIYWWG 263


>gi|197104012|ref|YP_002129389.1| cytochrome c oxidase, subunit III [Phenylobacterium zucineum HLK1]
 gi|196477432|gb|ACG76960.1| cytochrome c oxidase, subunit III [Phenylobacterium zucineum HLK1]
          Length = 289

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 47/213 (22%), Positives = 92/213 (43%), Gaps = 23/213 (10%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVL---------------GKNYAA 61
                 + V   G   G  +++ S+ + F  +F  +  +                  +A 
Sbjct: 72  ANAGDHTPVVSIGLRYGMILFIASEVMFFVAWFWMFFEMALFNDVRAASSIEEVRNAWAT 131

Query: 62  GPAP--IDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFI 119
            P      V       V+T++LLLS  + ++A  A   +         L++T   G +F 
Sbjct: 132 WPPQGVETVPAWELPLVNTLILLLSGTTVTWAHHALQ-QGDRKGAKMGLILTVILGALFT 190

Query: 120 IMEIYEFAHLISMEAVP-----QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG 174
            ++ YE+ H++S +            + S+FF   G HG HV  G I+L V +I++++ G
Sbjct: 191 AIQAYEYHHILSHQYFFSEEAANSGLYGSTFFMATGFHGFHVLIGTIFLLVCLIRLMRGG 250

Query: 175 LISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
                       + +WHF+D++W+ +F+F+Y++
Sbjct: 251 FTPQKHFGFEAAAWYWHFVDVVWLFLFAFIYVV 283


>gi|310815262|ref|YP_003963226.1| cytochrome c oxidase, subunit III [Ketogulonicigenium vulgare Y25]
 gi|308753997|gb|ADO41926.1| cytochrome c oxidase, subunit III [Ketogulonicigenium vulgare Y25]
          Length = 290

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 48/206 (23%), Positives = 90/206 (43%), Gaps = 13/206 (6%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------------AAGPA 64
             + + + V   G    F +++ S+ ++FA FF  +     +                PA
Sbjct: 79  ANEGEHTPVVQIGVRYSFILFITSEVMVFATFFWAFFKYALHPMAVDGTFPLNYGVWPPA 138

Query: 65  PIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIY 124
            ++      + +   +LLLSS + +     +       KT   L +    G IF + + Y
Sbjct: 139 GVETLSPWHLPLVNTILLLSSGAAATWAHHAIVHGDRKKTAIGLAIAIGLGWIFTLCQAY 198

Query: 125 EFAHLISME-AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRL 183
           E+  ++  E      + + + FF   GLHG HV  G I+L V +I+IL+  + +      
Sbjct: 199 EYYEIVHTEAFSFSGNVYGAVFFMATGLHGAHVLIGSIFLLVCLIRILRGAMSAKQHVGF 258

Query: 184 ICLSMFWHFLDLIWICVFSFVYLMGV 209
              + +WHF+D++W+ +F  VY+ G 
Sbjct: 259 EMAAWYWHFVDVVWLFLFVAVYIWGA 284


>gi|37496454|emb|CAD21992.1| cytochrome oxidase subunit III [Elephas maximus]
          Length = 261

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 84/197 (42%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               + +  +    G  +++ S+ L F  FF  +  + L      G     V        
Sbjct: 68  QGHHTPIVQESLRYGMILFITSEVLFFTGFFWAFYHSSLAPTPELGSYWPPVGVYPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S ++ ++A  +       +  +  LL+T   G+ F +++++E+     
Sbjct: 128 EVPLLNTSVLLASGVTITWAHHSLMEGSRKN-MLQALLITILLGVYFTLLQMFEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L +  I+ LK    S +       + +WH
Sbjct: 184 ASFTISDGIYGSTFFVTTGFHGLHVIIGSTFLLICFIRQLKFHFTSHHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYLSIYWWG 260


>gi|291612239|ref|YP_003540675.1| cytochrome c oxidase subunit III [Hypsiglena jani texana]
 gi|189164551|gb|ACD77481.1| cytochrome c oxidase subunit III [Hypsiglena jani texana]
          Length = 261

 Score =  128 bits (323), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 39/198 (19%), Positives = 74/198 (37%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF     +             P  I   D
Sbjct: 66  TYQGHHTKGVQKNMRYGMILFITSEVFFFLGFFWALYHVSLVPTPELGAEWPPTGIIPLD 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +  K    +    L+ T   G+ F  +++ E+   +
Sbjct: 126 PMEVPLLNTTVLLSSGATITWSHHTMMKGNKKEATYALMTTIMLGVYFTALQMSEY---L 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L V +++++     + +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMIGTSFLMVCMLRLINHHFTTTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDIVWLFLYISVYWWG 260


>gi|289065040|ref|YP_003433851.1| cytochrome c oxidase subunit 3 [Oryza rufipogon]
 gi|74100175|gb|AAZ99338.1| cytochrome c oxidase subunit 3 [Oryza sativa Japonica Group]
 gi|74100229|gb|AAZ99391.1| cytochrome c oxidase subunit 3 [Oryza sativa Japonica Group]
 gi|285026122|dbj|BAI67955.1| cytochrome c oxidase subunit 3 [Oryza rufipogon]
 gi|285026151|dbj|BAI67983.1| cytochrome c oxidase subunit 3 [Oryza sativa Indica Group]
          Length = 280

 Score =  128 bits (323), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 79/199 (39%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDIS 72
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 86  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPW 145

Query: 73  -GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 146 EIPLLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 201

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++L V  I+     L   +       + +WH
Sbjct: 202 APSTISDSIYGSTFFLATGFHGFHVIIGTLFLIVCGIRQYLGHLTKKHHVGFEAAAWYWH 261

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 262 FVDVVRLFPFVSIYWWGGI 280


>gi|226314760|ref|YP_002774656.1| quinol oxidase polypeptide III [Brevibacillus brevis NBRC 100599]
 gi|226097710|dbj|BAH46152.1| quinol oxidase polypeptide III [Brevibacillus brevis NBRC 100599]
          Length = 198

 Score =  128 bits (323), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 82/193 (42%), Positives = 118/193 (61%), Gaps = 1/193 (0%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
                      +     FWIYLM+D ++FA  F TY VL  +   GP P D+F +SGI+ 
Sbjct: 6   AGHHDHHPDQEELRTFAFWIYLMTDVILFATLFATYIVLQGSTDGGPGPKDLFQMSGIYA 65

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
           ST +LL SS +   A+LA   K      ++WL VT F G  F+ +EI EF H++S  A  
Sbjct: 66  STFILLTSSFTSGLAILA-MNKGNRLALMNWLGVTVFLGASFLFLEINEFIHMVSEGATI 124

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
             SAFL++F+ LVG HGLHV  G+ W+ ++++QI K G+    +R++  +S+FWHFLD++
Sbjct: 125 GTSAFLTAFYTLVGTHGLHVTLGMGWMIIVIMQIAKHGITPVTKRKVNIISLFWHFLDVV 184

Query: 197 WICVFSFVYLMGV 209
           WI VF+ VY+MGV
Sbjct: 185 WIFVFTIVYVMGV 197


>gi|17224968|gb|AAL37190.1|AF321090_2 cytochrome o ubiquinol oxidase C [Pseudomonas putida]
          Length = 201

 Score =  128 bits (323), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 93/188 (49%), Positives = 121/188 (64%), Gaps = 1/188 (0%)

Query: 23  SCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLL 82
           +      T  GFW+YLM+DC++FA  F  YAVL  N A GP+  ++F++  +   T +LL
Sbjct: 15  THDSGKMTVYGFWLYLMTDCILFASIFAVYAVLVNNVAGGPSGHEIFELPYVLGETALLL 74

Query: 83  LSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFL 142
            SS++  FAMLA   K      + WL +T   G  FI MEI EF  LIS    P RS FL
Sbjct: 75  FSSITYGFAMLAL-YKGKKQAVLGWLFMTFLLGAGFIAMEINEFHLLISEGFGPSRSGFL 133

Query: 143 SSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFS 202
           S+FF LVG HGLHV  GLIW+ +++ Q+ K GL S N+ RL CLS+FWHFLD++WICVF+
Sbjct: 134 SAFFTLVGTHGLHVSAGLIWMGIMMYQVNKHGLTSTNKTRLSCLSLFWHFLDVVWICVFT 193

Query: 203 FVYLMGVV 210
            VYLMG +
Sbjct: 194 VVYLMGTL 201


>gi|296533147|ref|ZP_06895776.1| cytochrome c oxidase, subunit III [Roseomonas cervicalis ATCC
           49957]
 gi|296266519|gb|EFH12515.1| cytochrome c oxidase, subunit III [Roseomonas cervicalis ATCC
           49957]
          Length = 212

 Score =  128 bits (323), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 98/179 (54%), Positives = 123/179 (68%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWIYLMSDC++FA  F TYAVL    A GP    +FD+  +F  T++LL SS++    
Sbjct: 35  LGFWIYLMSDCILFAGIFATYAVLSHATAGGPDGHALFDLPYVFTETMILLASSITYGMG 94

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           MLA+   R     +SWL +TA  G+ F+ ME+ EF H+I+  A P RSAFLS+FF LVG 
Sbjct: 95  MLAAVRGRRRVA-LSWLGLTALLGLAFLAMELNEFHHMIAEGAGPDRSAFLSAFFTLVGT 153

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HGLHV  GL+WL VL+ Q+  KGL   N  RL CLSMFWHFLD+IWI VF+ VYL+GV+
Sbjct: 154 HGLHVTAGLLWLGVLMAQVAVKGLSDTNLTRLNCLSMFWHFLDVIWIGVFTIVYLLGVL 212


>gi|229086506|ref|ZP_04218678.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock3-44]
 gi|228696823|gb|EEL49636.1| Cytochrome c oxidase subunit 3 [Bacillus cereus Rock3-44]
          Length = 207

 Score =  128 bits (323), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 59/192 (30%), Positives = 105/192 (54%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++    ++GFW++L  + ++FA  F TY  L  +   GP   ++F +  +F+ T
Sbjct: 15  EPEKATLEGKNKFVGFWLFLGGETVLFASLFGTYLALKNSTNGGPTSQEMFQMPLVFIMT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           ++LL SSL+  +AM            +  ++                + +    +   + 
Sbjct: 75  MLLLTSSLTSVYAMYHMKNFNFKQMQLWLIVTVLLGLGFLGFEIYEFYHYTHEFKHTMRS 134

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF S+F+ALVG HGLHV FGL+W+  LV +  K+GL   N  +    S++WHF+D++W+
Sbjct: 135 SAFGSAFYALVGTHGLHVLFGLLWILTLVFRNAKRGLNLYNAPKFYVASIYWHFIDVVWV 194

Query: 199 CVFSFVYLMGVV 210
            +F+ VYLMG+V
Sbjct: 195 FIFTVVYLMGMV 206


>gi|83309078|ref|YP_423955.1| cytochrome c oxidase subunit III [Lipotes vexillifer]
 gi|55274423|gb|AAV49117.1| cytochrome c oxidase subunit III [Lipotes vexillifer]
          Length = 261

 Score =  128 bits (323), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 83/197 (42%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               +     G   G  ++++S+ L F  FF  +  + L      G              
Sbjct: 68  QGHHTPTVQKGLRYGMILFIVSEALFFTGFFWAFYHSSLAPTPELGGTWPPTGIHPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +        +T+  L +T   G+ F ++++ E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGY-RKQTLQALFITIALGLYFTLLQVSEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G I+L V  ++ +K    S +       + +WH
Sbjct: 184 ASFTISDGIYGSTFFVTTGFHGLHVIIGSIFLIVCFMRQMKFHFTSSHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|307154506|ref|YP_003889890.1| cytochrome-c oxidase [Cyanothece sp. PCC 7822]
 gi|306984734|gb|ADN16615.1| Cytochrome-c oxidase [Cyanothece sp. PCC 7822]
          Length = 207

 Score =  128 bits (323), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 46/199 (23%), Positives = 85/199 (42%), Gaps = 6/199 (3%)

Query: 11  NFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPA-PIDVF 69
                   +        D    G  ++L+++ ++F   F  + +        P       
Sbjct: 12  ALDYHQSAEAHHHGGHPDHRMFGLVLFLIAEGMIFFGLFAAFVIYSSILPQWPPEGTPEL 71

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T +L+ SS        A            W  +TA  G++F++ + YE+ H 
Sbjct: 72  ELLLPGINTFILISSSFVMHLGQNAIKKNDEK-GLRLWFGITAIMGVLFLVGQGYEYTH- 129

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQIL-KKGLISGNQRRLICLSM 188
                    + F SSF+AL G HGLHV FGL+ +  ++ +   +    S +   +    +
Sbjct: 130 --TGFGLTTNLFTSSFYALTGFHGLHVTFGLLLILAVLWRSRSQGHYSSQSHFGVEAAEL 187

Query: 189 FWHFLDLIWICVFSFVYLM 207
           +WHF+D+IWI +F  VYL+
Sbjct: 188 YWHFVDVIWIILFILVYLL 206


>gi|115352156|ref|YP_773995.1| cytochrome c oxidase subunit III [Burkholderia ambifaria AMMD]
 gi|115282144|gb|ABI87661.1| cytochrome bo3 quinol oxidase subunit 3 [Burkholderia ambifaria
           AMMD]
          Length = 202

 Score =  128 bits (323), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 102/195 (52%), Positives = 131/195 (67%), Gaps = 7/195 (3%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            D          +  GFW+YLM+DC++FA  F T+AVLG  +A GP   D+FDI G+ V 
Sbjct: 13  HDDHPP----SHSVFGFWLYLMTDCVIFAALFATFAVLGNQHAGGPTAKDLFDIPGVAVE 68

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T  LLLSS++  FAMLA+  K+     ++WL VT   G  F+ ME+ EF+HLI+  A PQ
Sbjct: 69  TAALLLSSITYGFAMLAA-YKQRRGALLAWLAVTFVLGAAFLAMELREFSHLIADGAGPQ 127

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLICLSMFWHFLDL 195
           RSAFLS+FF LVG HGLHV  GL+W+ VL  QI+ +G  L   + RRL CLS+FWHFLD+
Sbjct: 128 RSAFLSAFFTLVGTHGLHVTAGLLWMIVLAAQIVMRGGDLTDRDLRRLTCLSLFWHFLDI 187

Query: 196 IWICVFSFVYLMGVV 210
           +WICVFSFVYL  V+
Sbjct: 188 VWICVFSFVYLASVI 202


>gi|21242013|ref|NP_641595.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas axonopodis
           pv. citri str. 306]
 gi|21107411|gb|AAM36131.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas axonopodis
           pv. citri str. 306]
          Length = 208

 Score =  128 bits (323), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 100/182 (54%), Positives = 125/182 (68%), Gaps = 1/182 (0%)

Query: 29  GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSC 88
            T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL SSLS 
Sbjct: 28  NTVFGFWVYLMSDCLLFACLFATYAVLSGATVDGPTAKELFDLKFVLVETFLLLFSSLSF 87

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            FAM+A+  +++      WL VTA  G+ F+ ME++EF HLI   A P RSAFLS+FF L
Sbjct: 88  GFAMIAAHKRKM-GGLYGWLAVTALLGIGFLCMEVWEFNHLIHEGAGPGRSAFLSAFFTL 146

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           VG HGLHV  GL+W+ VLVIQI K GL + N  RL CLS+FWHFLD+IWI VF+ VYL+G
Sbjct: 147 VGTHGLHVASGLLWMAVLVIQISKNGLTARNSTRLACLSLFWHFLDIIWIGVFTVVYLLG 206

Query: 209 VV 210
            +
Sbjct: 207 AL 208


>gi|222838749|ref|YP_002586981.1| cytochrome c oxidase subunit III [Stenella coeruleoalba]
 gi|222839867|ref|YP_002587092.1| cytochrome c oxidase subunit III [Delphinus capensis]
 gi|223471640|ref|YP_002586887.1| cytochrome c oxidase subunit III [Stenella attenuata]
 gi|223471654|ref|YP_002587066.1| cytochrome c oxidase subunit III [Tursiops truncatus]
 gi|170026976|gb|ACB06029.1| cytochrome c oxidase subunit III [Tursiops truncatus]
 gi|170026990|gb|ACB06042.1| cytochrome c oxidase subunit III [Delphinus capensis]
 gi|170027018|gb|ACB06068.1| cytochrome c oxidase subunit III [Stenella attenuata]
 gi|170027032|gb|ACB06081.1| cytochrome c oxidase subunit III [Stenella coeruleoalba]
 gi|219560194|gb|ACL27320.1| cytochrome c oxidase subunit III [Delphinus delphis]
 gi|219560222|gb|ACL27346.1| cytochrome c oxidase subunit III [Tursiops truncatus]
          Length = 261

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 42/197 (21%), Positives = 80/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               +     G   G  ++++S+ L F  FF  +  + L      G +            
Sbjct: 68  QGHHTPTVQKGLRYGMILFILSEVLFFTGFFWAFYHSSLAPTPELGGSWPPTGIHPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MLQALFITIMLGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +     S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFMRQMMFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|222839838|ref|YP_002587053.1| cytochrome c oxidase subunit III [Tursiops aduncus]
 gi|170026962|gb|ACB06016.1| cytochrome c oxidase subunit III [Tursiops aduncus]
          Length = 261

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 42/197 (21%), Positives = 80/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               +     G   G  ++++S+ L F  FF  +  + L      G +            
Sbjct: 68  QGHHTPTVQKGLRYGMILFILSEVLFFTGFFWAFYHSSLAPTPELGGSWPPTGIHPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRKH-MLQALFITIMLGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +     S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFMRQMMFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|190588350|gb|ACE79206.1| cytochrome c oxidase subunit 3 [Bambusa oldhamii]
 gi|190588352|gb|ACE79207.1| cytochrome c oxidase subunit 3 [Phyllostachys edulis]
          Length = 265

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 41/197 (20%), Positives = 78/197 (39%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDIS 72
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPW 130

Query: 73  -GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPLLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++L V  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFLATGFHGFHVIIGTLFLIVCGIRQYLGHLTKKHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++ +  F  +Y  G
Sbjct: 247 FVDVVRLFPFVSIYWWG 263


>gi|83943954|ref|ZP_00956411.1| cytochrome c oxidase, subunit III [Sulfitobacter sp. EE-36]
 gi|83954527|ref|ZP_00963238.1| cytochrome c oxidase, subunit III [Sulfitobacter sp. NAS-14.1]
 gi|83840811|gb|EAP79982.1| cytochrome c oxidase, subunit III [Sulfitobacter sp. NAS-14.1]
 gi|83845201|gb|EAP83081.1| cytochrome c oxidase, subunit III [Sulfitobacter sp. EE-36]
          Length = 267

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 50/200 (25%), Positives = 87/200 (43%), Gaps = 9/200 (4%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA--------VLGKNYAAGPAPIDVF 69
                + V   G   GF +++MS+ + F  +F T+             +    P  I V 
Sbjct: 67  HVGDHTNVVRIGLRYGFILFIMSEVMFFVAWFWTFFKEALYPMDEFPGSTYVQPDIIPVD 126

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
                 ++T++LLLS  + ++A  A   +      ++ L +    GM+F   + YE+  L
Sbjct: 127 AFHLPLINTLILLLSGCAVTWAHHALVHENNRKDLIAGLSIAIVLGMLFTAFQAYEYYEL 186

Query: 130 I-SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSM 188
           +   +       F SSFF   G HG HV  G I+L V + + +K              + 
Sbjct: 187 LAHDDWTFGGDLFFSSFFMATGFHGFHVVIGTIFLAVCLFRAMKGHFTQEQHVGFEAAAW 246

Query: 189 FWHFLDLIWICVFSFVYLMG 208
           +WHF+D++W+ +F  VY+ G
Sbjct: 247 YWHFVDVVWLFLFFAVYMWG 266


>gi|319778051|ref|YP_004134481.1| cytochrome c oxidase subunit iii [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317171770|gb|ADV15307.1| cytochrome c oxidase subunit III [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 228

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 84/178 (47%), Positives = 115/178 (64%), Gaps = 1/178 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
            GFWI+L+SD ++F+ FF  YAVL K  A GP   D+F+ + + V T +LL SS +   A
Sbjct: 50  YGFWIFLLSDIIIFSAFFAAYAVLAKATAGGPTGKDLFEPTRVAVQTGLLLTSSFTGGLA 109

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
            LA+  + +   T +WLLVT   G  F+ +E+ EFA +I  +A P RSAFLS+FFALVG 
Sbjct: 110 TLATHRRSM-AATQAWLLVTGLLGAAFLFLEVQEFAAMIGEQAGPSRSAFLSAFFALVGC 168

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           HG HV  GL+WL  ++ Q+  KG  S   RRL C  +FWH LD+IW+ +F+ VYL+G 
Sbjct: 169 HGTHVGLGLLWLGTMMAQLWVKGFRSDILRRLHCFGLFWHALDIIWVAIFTLVYLLGA 226


>gi|299065535|emb|CBJ36706.1| cytochrome o ubiquinol oxidase, subunit III [Ralstonia solanacearum
           CMR15]
          Length = 211

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 89/179 (49%), Positives = 119/179 (66%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
            GFW+YLMSD ++FA  F T+ VL    A GP   ++FD+S + + T +LL+SS++    
Sbjct: 34  FGFWVYLMSDLIIFASLFATFCVLRSATAGGPDGKELFDLSYVLIETGILLVSSITYGMV 93

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           M+     R   + + WL +T   G  F+ MEI EF HLI+  A P RSAFLSSFF LVG 
Sbjct: 94  MVGLQAGR-KDQVLLWLGITFLLGAAFVGMEINEFHHLIAEGAGPNRSAFLSSFFTLVGT 152

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HGLHV  GL+W+ VL+ QI +KGL + N  RL CLS+FWHFLD++WI VF+ VYL+G +
Sbjct: 153 HGLHVASGLLWIAVLMWQISRKGLTTTNSTRLACLSLFWHFLDVVWIGVFTVVYLLGAM 211


>gi|285017725|ref|YP_003375436.1| cytochrome o ubiquinol oxidase subunit III protein [Xanthomonas
           albilineans GPE PC73]
 gi|283472943|emb|CBA15448.1| probable cytochrome o ubiquinol oxidase subunit III protein
           [Xanthomonas albilineans]
          Length = 206

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 98/181 (54%), Positives = 122/181 (67%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL SSL   
Sbjct: 27  TVFGFWVYLMSDCLIFAGLFATYAVLAGATVDGPTAKELFDLKFVLVETFLLLFSSLGFG 86

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
            AM+A+  + +     +WL VTA  G+ F+ ME+YEF HLI   A P RSAFLS+FF LV
Sbjct: 87  LAMIAAHRRSM-GGLYAWLAVTAALGLGFLGMELYEFHHLIHEGAGPGRSAFLSAFFTLV 145

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GL+W+ VLVIQI + GL   N  RL CLS+FWHFLD+IWI VF+ VYL+G 
Sbjct: 146 GTHGLHVASGLLWMTVLVIQIARNGLTPRNSTRLACLSLFWHFLDVIWIGVFTIVYLLGA 205

Query: 210 V 210
           +
Sbjct: 206 L 206


>gi|152976356|ref|YP_001375873.1| cytochrome c oxidase subunit III [Bacillus cereus subsp. cytotoxis
           NVH 391-98]
 gi|152025108|gb|ABS22878.1| cytochrome c oxidase subunit III [Bacillus cytotoxicus NVH 391-98]
          Length = 207

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 59/192 (30%), Positives = 105/192 (54%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++    ++GFW++L  + ++FA  F TY  L  +   GP+  ++F +  +F+ T
Sbjct: 15  EPEKATLEGKNKFVGFWLFLGGETVLFASLFGTYLALKNSTNGGPSSQEMFQMPLVFIMT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           ++LL SSL+  +AM            +  L+                + +    +   + 
Sbjct: 75  MLLLTSSLTSVYAMYHMKNFHFKQMQLWLLVTVLLGLGFLGFEIYEFYHYAHEFKHTMRS 134

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF S+F+ALVG HGLHV FGL W+  L+ +  K+GL   N  +    S++WHF+D++W+
Sbjct: 135 SAFGSAFYALVGTHGLHVLFGLCWILTLIFRNAKRGLNLYNAPKFYVASIYWHFIDVVWV 194

Query: 199 CVFSFVYLMGVV 210
            +F+ VYLMG+V
Sbjct: 195 FIFTVVYLMGMV 206


>gi|229016030|ref|ZP_04172986.1| Quinol oxidase subunit 3 [Bacillus cereus AH1273]
 gi|229022249|ref|ZP_04178794.1| Quinol oxidase subunit 3 [Bacillus cereus AH1272]
 gi|228739052|gb|EEL89503.1| Quinol oxidase subunit 3 [Bacillus cereus AH1272]
 gi|228745263|gb|EEL95309.1| Quinol oxidase subunit 3 [Bacillus cereus AH1273]
          Length = 200

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 71/179 (39%), Positives = 110/179 (61%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C  A
Sbjct: 22  LGFWIFLGAEIMLFATLFASYLVLAGRTADGPTPAQLFEVKTLLIQTLLLLTSSFTCGIA 81

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +     +      ++W ++T   G  F+  EI EF   +   A  Q SAFLS+FF L+G 
Sbjct: 82  IHEMRKQNQK-GMLAWFILTLLLGAGFLFFEIEEFILYVGEGATIQTSAFLSAFFVLLGT 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+IW   ++IQILK+GL     R++  +S++WHFLDL+W+ +++ VYL G+V
Sbjct: 141 HGAHVTGGIIWATCVIIQILKRGLTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMV 199


>gi|88766332|ref|NP_009285.2| cytochrome c oxidase subunit III [Loxodonta africana]
 gi|93204563|sp|Q2I3F5|COX3_LOXAF RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|83415411|gb|ABC17910.1| cytochrome c oxidase subunit III [Loxodonta africana]
 gi|218783286|dbj|BAH03664.1| cytochrome c oxidase subunit III [Loxodonta africana]
          Length = 261

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 83/197 (42%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               + V  +    G  +++ S+ L F  FF  +  + L      G     V        
Sbjct: 68  QGHHTPVVQESLRYGMILFITSEVLFFTGFFWAFYHSSLAPTPELGSYWPPVGVYPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S ++ ++A  +       +  +  LL+T   G+ F +++++E+     
Sbjct: 128 EVPLLNTSVLLASGVTITWAHHSLMEGNRKN-MLQALLITILLGVYFTLLQMFEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L    I+ LK    S +       + +WH
Sbjct: 184 ASFTISDGIYGSTFFVTTGFHGLHVIIGSTFLLTCFIRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYLSIYWWG 260


>gi|302186054|ref|ZP_07262727.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. syringae 642]
          Length = 210

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 94/181 (51%), Positives = 125/181 (69%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLM+DC++FA FF  YAV+  + A GP+  D+F +  + V T  LL+SS++  
Sbjct: 31  TVYGFWLYLMTDCVLFASFFAVYAVMVNSVAGGPSGQDIFLLPFVAVETAFLLVSSITYG 90

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAMLA   K    + + WL +T   G  FI ME+YEF HLI     P RS FLS+FFALV
Sbjct: 91  FAMLAL-YKGNKSQVLGWLALTFLCGAAFIGMEVYEFHHLIHEGYGPSRSGFLSAFFALV 149

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           GLHG+HV  GLIW+ +++ Q+ KKGL + N+ RL CLS+FWHFLD++WI VF+ VYLMG 
Sbjct: 150 GLHGVHVTSGLIWMAIMMFQVQKKGLTNTNKTRLSCLSLFWHFLDVVWIGVFTVVYLMGA 209

Query: 210 V 210
           +
Sbjct: 210 L 210


>gi|23008830|ref|ZP_00050109.1| COG1845: Heme/copper-type cytochrome/quinol oxidase, subunit 3
           [Magnetospirillum magnetotacticum MS-1]
          Length = 285

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 45/208 (21%), Positives = 79/208 (37%), Gaps = 17/208 (8%)

Query: 15  FYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA-------------- 60
                   + V       G  +++ S+ + F  +F  Y       A              
Sbjct: 73  HEANSGDHTRVVQLHHRYGMIMFIASEVMFFVAWFWAYFEAALYTADPIQAQRVEFTGGV 132

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
             P  I+ FD   + +   ++LL+S +       +            L +T   G IF  
Sbjct: 133 WPPKGIEAFDPWHLPLLNTLILLTSGTTVTWAHHALLHGDRKGLKMGLWLTIILGAIFTA 192

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
            + YE+AH          S + S+FF   G HG HV  G I+L V +++  K        
Sbjct: 193 CQAYEYAH---AHFGFAGSIYSSTFFMATGFHGAHVIIGTIFLAVCLLRAYKGDFTPKQH 249

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMG 208
                 + +WHF+D++W+ +F+ +Y+ G
Sbjct: 250 LGFEFAAWYWHFVDVVWLFLFAAIYVWG 277


>gi|291612449|ref|YP_003541005.1| cytochrome c oxidase subunit III [Hypsiglena torquata]
 gi|189164537|gb|ACD77468.1| cytochrome c oxidase subunit III [Hypsiglena torquata]
          Length = 261

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 39/198 (19%), Positives = 73/198 (36%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF     +             P  I   D
Sbjct: 66  TYQGHHTKGVQKNMRYGMILFITSEVFFFLGFFWALYHVSLVPTPELGAEWPPTGIIPLD 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +       +    L+ T   G+ F  +++ E+   +
Sbjct: 126 PMEVPLLNTTVLLSSGATITWSHHTMMNGNKKEATYALMATIMLGIYFTALQMSEY---L 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L V +++++K      +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMIGTSFLTVCILRLIKHHFTMTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDIVWLFLYISVYWWG 260


>gi|76780572|emb|CAD92016.1| cytochrome oxidase subunit 3 [Borya septentrionalis]
          Length = 265

 Score =  128 bits (322), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 80/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAYYAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                  S + S+FF+  G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APFTISDSIYGSTFFSATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|74310593|ref|YP_313726.1| cytochrome c oxidase subunit III [Cylindrophis ruffus]
 gi|73760235|dbj|BAE20033.1| cytochrome oxidase subunit 3 [Cylindrophis ruffus]
          Length = 262

 Score =  128 bits (322), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 41/198 (20%), Positives = 78/198 (39%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK------NYAAGPAPIDVFD 70
                 +         G  ++++S+ L F  FF T   +             P  I   +
Sbjct: 67  TYQGHHTKGVQKNLRYGMMLFIVSEVLFFLGFFWTLYHVSLFPTPELGAEWPPTGITPLN 126

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +  K    ++   L++T   G+ F  +++ E+    
Sbjct: 127 PLEVPLLNTAVLLSSGATITWSHHTMMKGNKTESTYALMITIALGIYFTALQLSEYM--- 183

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L V + ++++    + +         +W
Sbjct: 184 ETPFTISDSVYGSIFFVATGFHGLHVMIGTTFLIVCLTRLIQYHFTTTHHFGYEAAIWYW 243

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ +F  VY  G
Sbjct: 244 HFVDVVWLFLFVSVYWWG 261


>gi|237642061|ref|YP_002894723.1| cytochrome c oxidase subunit III [Moschus berezovskii]
 gi|153799696|gb|ABS50576.1| cytochrome c oxidase subunit III [Moschus berezovskii]
          Length = 261

 Score =  128 bits (322), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 39/196 (19%), Positives = 74/196 (37%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  ++++S+ L    FF  +                P  I   +  
Sbjct: 68  QGHHTPTVQKGLRYGMILFIISEVLFLTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +   +  +  L +T   G+ F +++  E+      
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V   + LK    S +       + +WHF
Sbjct: 185 PFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYVSIYWWG 260


>gi|326370381|gb|ADZ56212.1| cytochrome c oxidase subunit III [Orcaella heinsohni]
          Length = 261

 Score =  128 bits (322), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 82/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               +     G   G  ++++S+ L F VFF  +  + L      G +            
Sbjct: 68  QGHHTPTVQKGLRYGMILFILSEVLFFTVFFWAFYHSSLAPTPELGGSWPPTGIHPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  LL+T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRKH-MLQALLITIMLGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +     S +       + +WH
Sbjct: 184 APFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFMRQMMFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|194289182|ref|YP_002005089.1| cytochrome o ubiquinol oxidase subunit iii [Cupriavidus taiwanensis
           LMG 19424]
 gi|193223017|emb|CAQ69022.1| cytochrome o ubiquinol oxidase, subunit III [Cupriavidus
           taiwanensis LMG 19424]
          Length = 214

 Score =  128 bits (322), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 91/180 (50%), Positives = 124/180 (68%), Gaps = 1/180 (0%)

Query: 29  GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSC 88
            T  GFWIYLMSDC++FA  F  +AVL    A GP+  ++F+++ + V T +LL SS++ 
Sbjct: 34  NTVYGFWIYLMSDCIIFAGLFAAFAVLRGELAGGPSAKELFELNYVLVETFILLFSSITY 93

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
             AM++   + L H   +WL +T   G+ F+ MEI EF HLI+  A P RSAFLSSFF L
Sbjct: 94  GMAMISLQNRSLKH-VQTWLGITFLLGLAFMAMEINEFHHLIAEGAGPGRSAFLSSFFTL 152

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           VG HGLHV  G++W+ VL+ Q+ KKG+     +RL+CLS+FWHFLD++WI VF+ VYLMG
Sbjct: 153 VGTHGLHVASGMLWMIVLMWQLGKKGITPTLSKRLMCLSLFWHFLDVVWIGVFTVVYLMG 212


>gi|84501693|ref|ZP_00999865.1| Cytochrome c oxidase, aa3-type, subunit III [Oceanicola batsensis
           HTCC2597]
 gi|84390314|gb|EAQ02873.1| Cytochrome c oxidase, aa3-type, subunit III [Oceanicola batsensis
           HTCC2597]
          Length = 266

 Score =  128 bits (322), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 49/202 (24%), Positives = 96/202 (47%), Gaps = 14/202 (6%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA----------VLGKNYAAGPAPID 67
           K    + V   G   GF +++MS+ + F+ +F T+             G +    PA I+
Sbjct: 67  KAGDHTPVVMIGLRYGFILFIMSEVMFFSAWFWTFFKHAMYPMGPESPGVDGQWPPAGIE 126

Query: 68  VFDIS-GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEF 126
            FD      ++T++LL S  + ++A  A   +         L++    G++F + + YE+
Sbjct: 127 TFDPWHLPLINTLILLCSGAAATWAHHALVHEENRQDMKWGLMLAIGLGIVFTLFQAYEY 186

Query: 127 AHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICL 186
           +H          + + ++FF   G HG HV  G I+LFV ++++      + +       
Sbjct: 187 SH---AAFGFSGNIYGATFFMATGFHGAHVIIGTIFLFVCLLRVYAGDFTAKSHVGFEMA 243

Query: 187 SMFWHFLDLIWICVFSFVYLMG 208
           + +WHF+D++W+ +F+ VY+ G
Sbjct: 244 AWYWHFVDVVWLFLFAAVYIWG 265


>gi|77460867|ref|YP_350374.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas
           fluorescens Pf0-1]
 gi|77384870|gb|ABA76383.1| cytochrome bo3 quinol oxidase subunit 3 [Pseudomonas fluorescens
           Pf0-1]
          Length = 208

 Score =  128 bits (322), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 93/184 (50%), Positives = 122/184 (66%), Gaps = 1/184 (0%)

Query: 27  HDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSL 86
            + T  GFW+YLM+DC++FA  F  YAVL  N A GP+  D+F++  +   T +LL SS+
Sbjct: 26  GEMTVYGFWLYLMTDCILFASIFAVYAVLVNNVAGGPSGHDIFELPYVLGETALLLFSSI 85

Query: 87  SCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFF 146
           +  FAMLA   K    + + WL +T   G  FI MEI EF  LIS    P RS FLS+FF
Sbjct: 86  TYGFAMLAL-YKGKKQQVLGWLFMTFLLGAGFIAMEINEFHLLISEGFGPSRSGFLSAFF 144

Query: 147 ALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
            LVG HGLHV  GLIW+ +++ Q+ K GL + N+ RL CLS+FWHFLD++WICVF+ VYL
Sbjct: 145 TLVGTHGLHVSAGLIWMGIMMYQVNKHGLTATNKTRLSCLSLFWHFLDVVWICVFTVVYL 204

Query: 207 MGVV 210
           MG +
Sbjct: 205 MGTL 208


>gi|228992678|ref|ZP_04152604.1| Cytochrome c oxidase subunit 3 [Bacillus pseudomycoides DSM 12442]
 gi|228998722|ref|ZP_04158309.1| Cytochrome c oxidase subunit 3 [Bacillus mycoides Rock3-17]
 gi|229006224|ref|ZP_04163910.1| Cytochrome c oxidase subunit 3 [Bacillus mycoides Rock1-4]
 gi|228755065|gb|EEM04424.1| Cytochrome c oxidase subunit 3 [Bacillus mycoides Rock1-4]
 gi|228761190|gb|EEM10149.1| Cytochrome c oxidase subunit 3 [Bacillus mycoides Rock3-17]
 gi|228767010|gb|EEM15647.1| Cytochrome c oxidase subunit 3 [Bacillus pseudomycoides DSM 12442]
          Length = 207

 Score =  128 bits (322), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 60/192 (31%), Positives = 105/192 (54%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++    ++GFW++L  + ++FA  F TY  L  +   GP   ++F +  +F+ T
Sbjct: 15  EPEKATLEGKNKFVGFWLFLGGETVLFASLFGTYLALKNSTNGGPTSQEMFQMPLVFIMT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           ++LL SSL+  +AM            +  L+                + +    +   + 
Sbjct: 75  MLLLTSSLTSVYAMYHMKNFNFKQMQLWLLVTVLLGLGFLGFEIYEFYHYTHEFKHTMRS 134

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF S+F+ALVG HGLHV FGL+W+  LV +  K+GL   N  +    S++WHF+D++W+
Sbjct: 135 SAFGSAFYALVGTHGLHVLFGLLWILTLVFRNAKRGLNLYNAPKFYVASIYWHFIDVVWV 194

Query: 199 CVFSFVYLMGVV 210
            +F+ VYLMG+V
Sbjct: 195 FIFTVVYLMGMV 206


>gi|57282277|emb|CAD32367.1| cytochrome oxidase subunit 3 [Lapageria rosea]
          Length = 265

 Score =  128 bits (322), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 81/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF+  G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFSATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|262042466|ref|ZP_06015625.1| quinol oxidase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|259040170|gb|EEW41282.1| quinol oxidase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
          Length = 181

 Score =  128 bits (322), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 98/179 (54%), Positives = 123/179 (68%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
            GFWIYLMSDC++FA  F TYAVL    A GP   D+F++  + V T +LL SS++   A
Sbjct: 4   FGFWIYLMSDCIIFATLFATYAVLVNGTAGGPTGKDIFELPFVLVETALLLFSSITYGMA 63

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
            +A   K    + VSWL +T  FG  FI MEIYEF HLI       RS FLS+FFALVG 
Sbjct: 64  AIA-MYKNNKSQVVSWLALTWLFGAGFIGMEIYEFHHLIMEGFGLDRSGFLSAFFALVGT 122

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HGLHV  GLIW+ VL+ Q+ ++GL S N+ R++CLS+FWHFLD++WICVFS VYLMG +
Sbjct: 123 HGLHVTSGLIWMAVLMFQVSRRGLTSTNRTRILCLSLFWHFLDVVWICVFSVVYLMGAM 181


>gi|317129344|ref|YP_004095626.1| cytochrome-c oxidase [Bacillus cellulosilyticus DSM 2522]
 gi|315474292|gb|ADU30895.1| Cytochrome-c oxidase [Bacillus cellulosilyticus DSM 2522]
          Length = 205

 Score =  128 bits (322), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 69/185 (37%), Positives = 105/185 (56%), Gaps = 1/185 (0%)

Query: 24  CVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLL 83
            ++    ++GFW +L  + ++FA  F TY  L      GP P D+F +  +F+ T++LL 
Sbjct: 19  TLEGRNKFMGFWFFLGGETVLFASLFGTYLGLRGGTMNGPGPSDLFHLDLVFIMTMILLT 78

Query: 84  SSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLS 143
           SSL+  FA+++          ++W+ VT   G+ F+ MEIYEF            SAF S
Sbjct: 79  SSLTSVFAVISMKKGNFK-GLLAWMSVTVLLGLAFLGMEIYEFYDYYHKGLGYSTSAFAS 137

Query: 144 SFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           SF+ LVG HG HV FG+ W+  L+I+  K GL   N  +     ++WHF+D++W+ +FS 
Sbjct: 138 SFYTLVGTHGAHVAFGIGWITTLIIRYRKSGLTLTNAPKFYTAVLYWHFIDVVWVFIFSV 197

Query: 204 VYLMG 208
           VYLMG
Sbjct: 198 VYLMG 202


>gi|222839612|ref|YP_002587007.1| cytochrome c oxidase subunit III [Pseudolabrus eoethinus]
 gi|170292922|gb|ACB12505.1| cytochrome c oxidase subunit 3 [Pseudolabrus eoethinus]
          Length = 261

 Score =  128 bits (322), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 37/196 (18%), Positives = 72/196 (36%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +     G   G  +++ S+   F  F   +                P  I   D  
Sbjct: 68  QGHHTPPVQKGLRYGMILFITSEVFFFLGFSWAFYHSSLAPTPELGGCWPPTGITTLDPF 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LL+S         S  +    + +  L +T   G  F  ++  E+      
Sbjct: 128 EVPLLNTAVLLASGVTVTWAHHSIMEAARKEAIQSLALTILLGFYFTFLQGLEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                   + S+FF   G HGLHV  G  +L V +++ ++    S +       + +WHF
Sbjct: 185 PFTIADGVYGSTFFVATGFHGLHVIIGSSFLAVCLLRQIQYHFTSSHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ ++  +Y  G
Sbjct: 245 VDVVWLFLYISIYWWG 260


>gi|5852110|emb|CAA12144.1| cytochrome oxidase c subunit III [Loxodonta africana]
          Length = 262

 Score =  128 bits (322), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 83/197 (42%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               + V  +    G  +++ S+ L F  FF  +  + L      G     V        
Sbjct: 68  QGHHTPVVQESLRYGMILFITSEVLFFTGFFWAFYHSSLAPTPELGSYWPPVGVYPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S ++ ++A  +       +  +  LL+T   G+ F +++++E+     
Sbjct: 128 EVPLLNTSVLLASGVTITWAHHSLMEGNRKN-MLQALLITILLGVYFTLLQMFEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L    I+ LK    S +       + +WH
Sbjct: 184 ASFTISDGIYGSTFFVTTGFHGLHVIIGSTFLLTCFIRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYLSIYWWG 260


>gi|57282279|emb|CAD32368.1| cytochrome oxidase subunit 3 [Rhipogonum elseyanum]
          Length = 265

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 81/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF+  G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFSATGFHGFHVIIGTLFLSICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|8954365|ref|NP_059354.1| cytochrome c oxidase subunit 3 [Cyanidioschyzon merolae]
 gi|3927869|dbj|BAA34657.1| cytochrome c oxidase polypeptide III [Cyanidioschyzon merolae
           strain 10D]
          Length = 272

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 44/201 (21%), Positives = 89/201 (44%), Gaps = 11/201 (5%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA------AGPAPIDVFD 70
             +   + +   G   G  +++ S+ ++F  FF  +     +          P  I +FD
Sbjct: 76  TYEGSHTVLVQLGLRYGIVLFIFSEVMLFISFFWAFFHSSLSPGVELGMIWPPQGISIFD 135

Query: 71  -ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
                F++TI+LLLS  + ++A  A          ++ +       ++F  ++ YE+   
Sbjct: 136 PCQVPFLNTIILLLSGCTVTWAHHAIIHGNRNQGILALVFT-ILLALLFTGLQFYEYKI- 193

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + S+FF   GLHGLHV  G ++L V ++++    + + +       + +
Sbjct: 194 --APFCLSDGIYGSTFFITTGLHGLHVIVGTLFLLVCLVRLYNYQITAQHHFGFEAAAWY 251

Query: 190 WHFLDLIWICVFSFVYLMGVV 210
           WHF+D++W+ +F  VY  G +
Sbjct: 252 WHFVDVVWLFLFVSVYWWGGI 272


>gi|57282281|emb|CAD32369.1| cytochrome oxidase subunit 3 [Smilax glauca]
          Length = 265

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 81/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF+  G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFSATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|310644020|ref|YP_003948778.1| transmembrane cytochrome o ubiquinol oxidase (subunit iii)
           oxidoreductase protein [Paenibacillus polymyxa SC2]
 gi|309248970|gb|ADO58537.1| Probable transmembrane cytochrome O ubiquinol oxidase (Subunit III)
           oxidoreductase protein [Paenibacillus polymyxa SC2]
          Length = 202

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 78/184 (42%), Positives = 118/184 (64%), Gaps = 1/184 (0%)

Query: 27  HDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSL 86
            +   LGFWI+L++D ++F+  F T+ VL  N A GP   ++F+++G+ + T +LL SS 
Sbjct: 20  QELKMLGFWIFLVTDVILFSTLFATFVVLRNNTAGGPGGAELFNMTGVIIETFLLLTSSF 79

Query: 87  SCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFF 146
           +   A+LA     +    +SWL+VTA  G+ FI  E+YEF  ++   A    SAFLS+FF
Sbjct: 80  TSGLAVLAMNKGSMK-GLISWLIVTAILGLGFIGFEVYEFVEMVHEGANFGTSAFLSAFF 138

Query: 147 ALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
            LVG HGLHV  GL+W+  L+ Q+ K+GL    + ++  LS++WHFLD +WI + + VYL
Sbjct: 139 TLVGTHGLHVSLGLVWMIGLMFQLKKRGLTPETKGKVSALSLYWHFLDAVWIFLLTVVYL 198

Query: 207 MGVV 210
           MGV+
Sbjct: 199 MGVM 202


>gi|229541705|ref|ZP_04430765.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus coagulans
           36D1]
 gi|229326125|gb|EEN91800.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus coagulans
           36D1]
          Length = 202

 Score =  128 bits (321), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 70/181 (38%), Positives = 108/181 (59%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW++L ++  +FA  F TY  L    A GP   D+F++ G+ + T VLL SS +C 
Sbjct: 22  TIFGFWVFLAAEITLFATLFATYFTLQHQTAGGPVQQDIFELKGVLIETFVLLTSSFTCG 81

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
            A+  +   R     + W +VT   G+ F+  EI EF   I   A    SAFLS+F+ L+
Sbjct: 82  IAIF-NMRNRNKGAMLGWFIVTLLLGLTFVGFEINEFVTYIHDGATLPTSAFLSAFYVLL 140

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HG HV  G++W   ++IQ++++GL     R+   +S++WHFLD++WI +F+FVYL G+
Sbjct: 141 GTHGCHVSLGILWGISIIIQLIRRGLTPMTARKFFVVSIYWHFLDVVWIFIFTFVYLGGL 200

Query: 210 V 210
           +
Sbjct: 201 M 201


>gi|153837577|ref|ZP_01990244.1| cytOchrome o ubiquinol oxidase, subunit III [Vibrio
           parahaemolyticus AQ3810]
 gi|149749074|gb|EDM59885.1| cytOchrome o ubiquinol oxidase, subunit III [Vibrio
           parahaemolyticus AQ3810]
          Length = 200

 Score =  128 bits (321), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 95/182 (52%), Positives = 120/182 (65%), Gaps = 1/182 (0%)

Query: 29  GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSC 88
               GFW+YLMSDC++FA  F TYAVL  N  AGP   ++F++  +FV T++LL SS++ 
Sbjct: 20  NKLFGFWVYLMSDCVLFATLFATYAVLSSNSIAGPTGKEIFELPFVFVETMLLLFSSITF 79

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            F ++A      +     W+LVT   G+ FI ME+YEF HLI     PQ SAFLS+FF L
Sbjct: 80  GFGIIAMKRND-VSGLKRWMLVTFALGLGFICMEVYEFHHLIKEGYGPQTSAFLSAFFTL 138

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           VG HGLHV FGLIWL V   Q+  KGL      R  CLS+FWHFLD++WICVF+ VYLMG
Sbjct: 139 VGTHGLHVTFGLIWLAVAYHQLSTKGLNDNMAMRFNCLSLFWHFLDIVWICVFTIVYLMG 198

Query: 209 VV 210
           V+
Sbjct: 199 VM 200


>gi|114767473|ref|ZP_01446256.1| Cytochrome c oxidase, subunit III [Pelagibaca bermudensis HTCC2601]
 gi|114540453|gb|EAU43535.1| Cytochrome c oxidase, subunit III [Roseovarius sp. HTCC2601]
          Length = 219

 Score =  128 bits (321), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 113/205 (55%), Positives = 135/205 (65%), Gaps = 1/205 (0%)

Query: 3   RQKIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAG 62
            + +   P       K  +++      T +GFWIYLMSDC++F   F TYAVLG NYA G
Sbjct: 13  VEPLADRPMHHAREAKPHEDAHAHSSPTPVGFWIYLMSDCVIFGALFATYAVLGGNYAGG 72

Query: 63  PAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIME 122
           PAP D+F+   I V T +LL SS++   AML +  K   + T+ WL VTA FG  FI ME
Sbjct: 73  PAPKDLFEPGFIAVETALLLFSSVTFGLAMLRA-GKSDTNGTLMWLAVTALFGAGFIGME 131

Query: 123 IYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRR 182
           IYEF HLI + A P RSAFLSSFFALVG HGLHV  GLIWL  L++QI   GLI  N +R
Sbjct: 132 IYEFNHLIHLGAGPDRSAFLSSFFALVGTHGLHVTGGLIWLITLMVQIRMHGLIGPNMQR 191

Query: 183 LICLSMFWHFLDLIWICVFSFVYLM 207
           L  LSMFWHFLDL+WI VFSFVYL+
Sbjct: 192 LGTLSMFWHFLDLVWIGVFSFVYLV 216


>gi|156139672|gb|ABU50890.1| cytochrome c oxidase subunit 3 [Nepenthes sp. 'Kosobe']
          Length = 252

 Score =  128 bits (321), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 40/193 (20%), Positives = 79/193 (40%), Gaps = 11/193 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAGPAPID-----VFDI 71
           +   + V   G   GF ++++S+ + F   F    ++ L      G          +   
Sbjct: 64  EGHHTKVVQLGLRYGFILFIVSEVMFFFALFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 123

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T++LL S  + ++A  A    +     V  L+ T    ++F   +  E+     
Sbjct: 124 EIPFLNTLILLSSGAAVTWAHHAILAGKEK-GAVYALVATVLLALVFTGFQGMEY---YQ 179

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                  S + S+FF   G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 180 APFTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYFGHLTKEHHVGFEAAAWYWH 239

Query: 192 FLDLIWICVFSFV 204
           F+D++W+ +F  +
Sbjct: 240 FVDVVWLFLFVSI 252


>gi|6730478|pdb|1QLE|C Chain C, Cryo-Structure Of The Paracoccus Denitrificans
           Four-Subunit Cytochrome C Oxidase In The Completely
           Oxidized State Complexed With An Antibody Fv Fragment
          Length = 273

 Score =  128 bits (321), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 50/201 (24%), Positives = 94/201 (46%), Gaps = 14/201 (6%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA--VLGKNYA--------AGPAPIDV 68
             + + V   G   GF +++MS+ + F  +F  +    L               P  I  
Sbjct: 75  TGEHTPVVRIGLQYGFILFIMSEVMFFVAWFWAFIKNALYPMGPDSPIKDGVWPPEGIVT 134

Query: 69  FDIS-GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
           FD      ++T++LLLS ++ ++A  A   +     T++ L+V    G+ F  ++ YE++
Sbjct: 135 FDPWHLPLINTLILLLSGVAVTWAHHAFVLEGDRKTTINGLIVAVILGVCFTGLQAYEYS 194

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
           H          + +  +F+   G HG HV  G I+LFV +I++LK  +           +
Sbjct: 195 H---AAFGLADTVYAGAFYMATGFHGAHVIIGTIFLFVCLIRLLKGQMTQKQHVGFEAAA 251

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ +F  +Y+ G
Sbjct: 252 WYWHFVDVVWLFLFVVIYIWG 272


>gi|300865035|ref|ZP_07109862.1| cytochrome c oxidase, subunit III [Oscillatoria sp. PCC 6506]
 gi|300336972|emb|CBN55012.1| cytochrome c oxidase, subunit III [Oscillatoria sp. PCC 6506]
          Length = 213

 Score =  128 bits (321), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 46/191 (24%), Positives = 87/191 (45%), Gaps = 6/191 (3%)

Query: 19  DKKESCVDHDGTY-LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
           D  ++  +H      G   +L S+ LMF  FF  Y +L       P      ++    ++
Sbjct: 24  DAAQNHEEHKDLRVFGLLTFLASESLMFGGFFAAYLLLRGATEVWPPEGTEVELLLPTIN 83

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           TI+L+ SS        A     +      W  VTA  G+IF+  + YE+   +++     
Sbjct: 84  TIILVSSSFVIHLGDTAVKKNDVK-GMRLWYAVTALMGIIFLGGQAYEY---LTLGYGLT 139

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILK-KGLISGNQRRLICLSMFWHFLDLI 196
            + F + F+ + G HGLHV  G+  +  ++ +  +     +     +    ++WHF+D+I
Sbjct: 140 ENVFANCFYLMTGFHGLHVLIGVCLILGVIWRSRREGHYSNVKHTGIEMAEIYWHFVDII 199

Query: 197 WICVFSFVYLM 207
           WI +F+ +Y++
Sbjct: 200 WIILFTLLYIL 210


>gi|291612337|ref|YP_003540766.1| cytochrome c oxidase subunit III [Hypsiglena sp. DGM2008]
 gi|189164393|gb|ACD77335.1| cytochrome c oxidase subunit III [Hypsiglena sp. DGM2008]
          Length = 261

 Score =  128 bits (321), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 40/198 (20%), Positives = 74/198 (37%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF     +             P  I   D
Sbjct: 66  TYQGHHTKGVQKNMRYGMILFITSEVFFFLGFFWALYHVSLVPTPELGAEWPPTGIIPLD 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +  K    +    L+ T   G+ F  +++ E+   +
Sbjct: 126 PMEVPLLNTTVLLSSGATITWSHHTMMKGNKKEATYALMATIMLGIYFTALQMSEY---L 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L V +++++K      +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMIGTSFLMVCILRLIKHHFTMTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDIVWLFLYISVYWWG 260


>gi|260459334|ref|ZP_05807589.1| cytochrome c oxidase subunit III [Mesorhizobium opportunistum
           WSM2075]
 gi|259034888|gb|EEW36144.1| cytochrome c oxidase subunit III [Mesorhizobium opportunistum
           WSM2075]
          Length = 228

 Score =  128 bits (321), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 84/178 (47%), Positives = 115/178 (64%), Gaps = 1/178 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
            GFWI+L+SD ++F+ FF  YAVL K  A GP   ++F+ + + V T +LL SS +   A
Sbjct: 50  YGFWIFLLSDIIIFSAFFAAYAVLAKATAGGPTGKELFEPTRVAVQTGLLLTSSFTGGLA 109

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
            LA   +R +  T +WLLVT   G  F+ +E+ EFA +I  +A P RSAFLS+FFALVG 
Sbjct: 110 TLA-TDRRSMAATQAWLLVTGLLGAAFLFLEVQEFAAMIGEQAGPSRSAFLSAFFALVGC 168

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           HG HV  GL+WL  ++ Q+  KG  S   RRL C  +FWH LD+IW+ +F+ VYL+G 
Sbjct: 169 HGTHVGLGLLWLGTMMAQLWVKGFRSDILRRLHCFGLFWHALDIIWVAIFTLVYLLGA 226


>gi|224365653|ref|YP_002608380.1| cytochrome c oxidase subunit 3 [Vitis vinifera]
 gi|147795136|emb|CAN65167.1| hypothetical protein VITISV_029401 [Vitis vinifera]
 gi|209954177|emb|CAQ77629.1| cytochrome c oxidase subunit 3 [Vitis vinifera]
 gi|239764721|gb|ACS15192.1| cytochrome c oxidase subunit 3 [Vitis vinifera]
          Length = 265

 Score =  128 bits (321), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 39/199 (19%), Positives = 79/199 (39%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFF--VTYAVLGKNYAAG----PAPIDVFDI- 71
           +   + V   G   G   +++S+ +     F   +++ L      G    P  I V D  
Sbjct: 71  EGHHTKVVQLGPRYGSIPFIVSEVMFLFALFRASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVLLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+F    G HG HV  G ++  +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFSLATGFHGFHVIIGTLFSIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ + +F  +Y  G +
Sbjct: 247 FVDVVRLFLFVSIYWWGGI 265


>gi|76809447|ref|YP_334219.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           pseudomallei 1710b]
 gi|167825087|ref|ZP_02456558.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           pseudomallei 9]
 gi|167911808|ref|ZP_02498899.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           pseudomallei 112]
 gi|226199985|ref|ZP_03795535.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei Pakistan
           9]
 gi|254195719|ref|ZP_04902145.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei S13]
 gi|254262091|ref|ZP_04953145.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 1710a]
 gi|254296928|ref|ZP_04964381.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 406e]
 gi|76578900|gb|ABA48375.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           pseudomallei 1710b]
 gi|157807037|gb|EDO84207.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 406e]
 gi|169652464|gb|EDS85157.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei S13]
 gi|225928041|gb|EEH24078.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei Pakistan
           9]
 gi|254220780|gb|EET10164.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 1710a]
          Length = 201

 Score =  128 bits (321), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 100/200 (50%), Positives = 131/200 (65%), Gaps = 5/200 (2%)

Query: 12  FSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDI 71
            +L +             + LGFW+YLM+DC++FA  F T+AVLG  +A GP   D+FDI
Sbjct: 6   MTLDHAASHDHPP---SHSVLGFWLYLMTDCVLFAALFATFAVLGNQFAGGPTAKDLFDI 62

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
            G+ + T  LLLSS++  FAM+ +  +R       WL VT   G  F+ ME+ EF+HL++
Sbjct: 63  PGVALETAALLLSSITYGFAMIGAH-QRRRGAVFGWLAVTFVLGAAFLAMELREFSHLVA 121

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG-LISGNQRRLICLSMFW 190
             A PQRSAFLSSFF LVG HGLHV  GL+W+ VLV Q L++  L   + RRL CLS+FW
Sbjct: 122 EGAGPQRSAFLSSFFTLVGTHGLHVTAGLVWMAVLVAQALRRPELTERDIRRLTCLSLFW 181

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD++WICVFSFVYL  V+
Sbjct: 182 HFLDIVWICVFSFVYLASVI 201


>gi|253990903|ref|YP_003042259.1| cytochrome o ubiquinol oxidase subunit III [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253782353|emb|CAQ85517.1| cyoC; Cytochrome O ubiquinol oxidase subunit III (Ubiquinol oxidase
           chain C) [Photorhabdus asymbiotica]
          Length = 206

 Score =  128 bits (321), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 93/179 (51%), Positives = 126/179 (70%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
            GFWIYLMSDC++FA  F TYAVL    A GP+  ++F +S + V T +LL SS++  FA
Sbjct: 29  FGFWIYLMSDCILFACLFATYAVLVNGTAGGPSGKEIFGLSFVLVETFLLLFSSITYGFA 88

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           ML    K  I +  +WL +T  FG+ F+ ME+YEF HLI+    P RSAFLS FFALV  
Sbjct: 89  ML-GMNKGKIGQVNAWLGMTFLFGLGFVAMELYEFHHLIAEGHGPDRSAFLSGFFALVAT 147

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG+HV  GL+W+ +++IQ+ ++GL   N+ RL CLS+FWHFLD++WICVF+ VYL+G +
Sbjct: 148 HGIHVTCGLVWIIIMMIQVTRRGLTDVNKTRLNCLSLFWHFLDVVWICVFTVVYLLGAM 206


>gi|163938625|ref|YP_001643509.1| cytochrome aa3 quinol oxidase subunit III [Bacillus
           weihenstephanensis KBAB4]
 gi|229131648|ref|ZP_04260529.1| Quinol oxidase subunit 3 [Bacillus cereus BDRD-ST196]
 gi|163860822|gb|ABY41881.1| Cytochrome aa3 quinol oxidase subunit III [Bacillus
           weihenstephanensis KBAB4]
 gi|228651796|gb|EEL07752.1| Quinol oxidase subunit 3 [Bacillus cereus BDRD-ST196]
          Length = 200

 Score =  128 bits (321), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 71/179 (39%), Positives = 109/179 (60%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C  A
Sbjct: 22  LGFWIFLGAEIMLFATLFASYLVLAGRTADGPTPAQLFEVKTLLIQTLLLLTSSFTCGIA 81

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +            ++W ++T   G  F+  EI EF   +   A  Q SAFLS+FF L+G 
Sbjct: 82  IHEMRKHNQK-GMLAWFILTLLLGAGFLFFEIEEFILYVGEGATIQTSAFLSAFFVLLGT 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+IW   ++IQILK+GL     R++  +S++WHFLDL+W+ +++ VYL G+V
Sbjct: 141 HGAHVTGGIIWATCVIIQILKRGLTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMV 199


>gi|262186737|ref|YP_003275996.1| cytochrome c oxidase subunit 3 [Pleurozia purpurea]
 gi|237780734|gb|ACR19380.1| cytochrome c oxidase subunit 3 [Pleurozia purpurea]
          Length = 263

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 44/198 (22%), Positives = 78/198 (39%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
             +   + V   G   G  ++++S+ + F   F  ++               P  I V D
Sbjct: 67  TYEGHHTFVVQLGLRYGMILFIVSEVMFFLASFRAFSHSSLAPTVEIGAIWPPKGISVLD 126

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
             GI     ++LLSS +       +    L  + V  L+ T F  ++F   +  E+   I
Sbjct: 127 PWGIPFLNTLILLSSGAAVTWAHHAILAGLKQQAVYALIATVFLALVFTGFQGIEY---I 183

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                     + S+FF   G HG HV  G I+L +  I+         +       + +W
Sbjct: 184 EAPFTISDGIYGSTFFLATGFHGFHVIIGTIFLIICGIRQYLGHFTPKHHFGFEAAAFYW 243

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ +F  +Y  G
Sbjct: 244 HFVDVVWLFLFVSIYWWG 261


>gi|291612435|ref|YP_003540903.1| cytochrome c oxidase subunit III [Leptodeira septentrionalis
           polysticta]
 gi|189164523|gb|ACD77455.1| cytochrome c oxidase subunit III [Leptodeira septentrionalis
           polysticta]
          Length = 261

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 38/198 (19%), Positives = 76/198 (38%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF     +             P  I   D
Sbjct: 66  TYQGHHTNGVQKNMRYGMILFITSEVFFFLGFFWALYHVSLVPTPELGAEWPPTGITPLD 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
            + + +    +LLSS +       +  K    ++   L+ T   G+ F  +++ E+   +
Sbjct: 126 PTEVPLLNTTVLLSSGATITWSHHTMMKGNKKESTYALMTTIALGIYFTALQMSEY---L 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L + +++++     + +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMIGTSFLMICMLRLIWHHFTTTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDIVWLFLYISVYWWG 260


>gi|270301130|gb|ACZ59726.2| cytochrome c oxidase subunit III [Peromyscus polionotus
           leucocephalus]
          Length = 225

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 43/201 (21%), Positives = 85/201 (42%), Gaps = 15/201 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPID 67
                 + +   G   G  ++++S+             +    T+ + G     G  P++
Sbjct: 30  TYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLAPTHDLGGCWPPTGITPLN 89

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
             ++    ++T VLL S +S ++A  +    +        LL+T   G+ F I++  E+ 
Sbjct: 90  PLEVP--LLNTSVLLASGVSITWAHHSLMEGK-RSNMNQALLITILLGIYFTILQASEY- 145

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
                        + S+FF   G HGLHV  G  +L V +++ LK    S +       +
Sbjct: 146 --FETPFSISDGVYGSTFFMATGFHGLHVIIGTTFLMVCLMRQLKYHFTSKHHFGFEAAA 203

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ ++  +Y  G
Sbjct: 204 WYWHFVDVVWLFLYVSIYWWG 224


>gi|315645044|ref|ZP_07898170.1| cytochrome c oxidase, subunit III [Paenibacillus vortex V453]
 gi|315279465|gb|EFU42770.1| cytochrome c oxidase, subunit III [Paenibacillus vortex V453]
          Length = 206

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 68/194 (35%), Positives = 113/194 (58%), Gaps = 2/194 (1%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            + +++ ++     LGFW++L  + ++F   F T+  L      GP   ++F +     +
Sbjct: 13  HEPEKATLEGRNKVLGFWLFLGGEAVLFGTLFATFLALRGQNNEGPTASELFSLPITAAA 72

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI-SMEAVP 136
           T++LL+SSL+  FA+ A      I K   WL+VT   G+ F+ +EIYEF   I       
Sbjct: 73  TLILLVSSLTSVFAIQALHRHN-IEKLKLWLIVTVALGLGFLGLEIYEFYEYIVHESFNM 131

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
           + SAF S+F+ LVG HG HV FG++W+ +L+ Q+ +KGL      ++   +M+WHF+D++
Sbjct: 132 KTSAFSSAFYTLVGFHGAHVAFGVVWISLLIAQLYRKGLTVVTAPKVYVSAMYWHFIDVV 191

Query: 197 WICVFSFVYLMGVV 210
           W+ +FS VYL+G V
Sbjct: 192 WVFIFSVVYLLGKV 205


>gi|253574578|ref|ZP_04851919.1| cytochrome c oxidase subunit III [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251846283|gb|EES74290.1| cytochrome c oxidase subunit III [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 208

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 67/194 (34%), Positives = 115/194 (59%), Gaps = 2/194 (1%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            + +++ ++     LGFW++L  + ++F   F T+  L    A GP+  ++F++     +
Sbjct: 15  HEPEKATLEGRNKILGFWLFLGGEAVLFGTLFATFLTLRNQIADGPSASELFNLGITAAA 74

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI-SMEAVP 136
           T +LL+SSL+  FA+ A        K   WL VT   G+ F+++EIYEFA  +   +   
Sbjct: 75  TFILLVSSLTSVFAIQAMHRGD-KGKLAGWLAVTVLLGLAFLVLEIYEFAEYVLHEDYGM 133

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
             SAF S+F+ LVG HG HV FG++W+ +L+ Q+ KKGL      ++   +++WHF+D++
Sbjct: 134 TTSAFSSAFYTLVGFHGAHVLFGILWISLLIGQLFKKGLTVVTAPKIYVSAIYWHFIDVV 193

Query: 197 WICVFSFVYLMGVV 210
           W+ +F+ VYL+G V
Sbjct: 194 WVFIFTVVYLLGKV 207


>gi|119387022|ref|YP_918077.1| cytochrome c oxidase, subunit III [Paracoccus denitrificans PD1222]
 gi|119377617|gb|ABL72381.1| cytochrome c oxidase, subunit III [Paracoccus denitrificans PD1222]
          Length = 274

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 50/201 (24%), Positives = 94/201 (46%), Gaps = 14/201 (6%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA--VLGKNYA--------AGPAPIDV 68
             + + V   G   GF +++MS+ + F  +F  +    L               P  I  
Sbjct: 76  TGEHTPVVRIGLQYGFILFIMSEVMFFVAWFWAFIKNALYPMGPDSPIKDGVWPPEGIVT 135

Query: 69  FDIS-GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
           FD      ++T++LLLS ++ ++A  A   +     T++ L+V    G+ F  ++ YE++
Sbjct: 136 FDPWHLPLINTLILLLSGVAVTWAHHAFVHEGDRKTTINGLIVAVILGVCFTGLQAYEYS 195

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
           H          + +  +F+   G HG HV  G I+LFV +I++LK  +           +
Sbjct: 196 H---AAFGLADTVYAGAFYMATGFHGAHVIIGTIFLFVCLIRLLKGQMTQKQHVGFEAAA 252

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ +F  +Y+ G
Sbjct: 253 WYWHFVDVVWLFLFVVIYIWG 273


>gi|330811630|ref|YP_004356092.1| cytochrome o subunit III [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327379738|gb|AEA71088.1| Cytochrome o subunit III [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 208

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 94/181 (51%), Positives = 121/181 (66%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLM+DC++FA  F  YAVL  N A GP+  D+F++  +   T +LL SS++  
Sbjct: 29  TVFGFWLYLMTDCILFASIFAAYAVLVNNVAGGPSGHDIFELPYVLGETALLLFSSITYG 88

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAMLA   K    + + WL +T  FG  FI MEI EF  LIS    P RS FLS FF LV
Sbjct: 89  FAMLAL-FKGKKTQVLGWLAMTFLFGAGFIGMEINEFHMLISEGYGPNRSGFLSGFFTLV 147

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GLIW+ +++ Q+ K GL + N+ RL CLS+FWHFLD++WICVF+ VYLMG 
Sbjct: 148 GTHGLHVTSGLIWMAIMMYQVQKNGLTATNKTRLSCLSLFWHFLDVVWICVFTVVYLMGT 207

Query: 210 V 210
           +
Sbjct: 208 L 208


>gi|229162876|ref|ZP_04290833.1| Cytochrome c oxidase subunit 3 [Bacillus cereus R309803]
 gi|228620758|gb|EEK77627.1| Cytochrome c oxidase subunit 3 [Bacillus cereus R309803]
          Length = 207

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 58/192 (30%), Positives = 103/192 (53%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++    ++GFW++L  + ++FA  F TY  L  +   G    ++F +  +F+ T
Sbjct: 15  EPEKATLEGKNKFVGFWLFLGGETVLFASLFGTYLALKNSTNGGATSQEMFQMPLVFIMT 74

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           ++LL SSL+  +AM            +  L+                + +    +   + 
Sbjct: 75  MLLLTSSLTSVYAMYHMKNFNFKKMQLWLLITVLLGLGFLGFEIYEFYHYTHEFKHTMRS 134

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF S+F+ALVG HGLHV FGL W+  L+ +  K+GL   N  +    S++WHF+D++W+
Sbjct: 135 SAFGSAFYALVGTHGLHVLFGLCWILTLIFRNAKRGLNLYNAPKFYVASIYWHFIDVVWV 194

Query: 199 CVFSFVYLMGVV 210
            +F+ VYLMG+V
Sbjct: 195 FIFTVVYLMGMV 206


>gi|188575778|ref|YP_001912707.1| cytOchrome o ubiquinol oxidase, subunit III [Xanthomonas oryzae pv.
           oryzae PXO99A]
 gi|188520230|gb|ACD58175.1| cytOchrome o ubiquinol oxidase, subunit III [Xanthomonas oryzae pv.
           oryzae PXO99A]
          Length = 210

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 100/182 (54%), Positives = 125/182 (68%), Gaps = 1/182 (0%)

Query: 29  GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSC 88
            T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL SSLS 
Sbjct: 30  NTVFGFWVYLMSDCLLFAGLFATYAVLSGATVDGPTAKELFDLKFVLVETFLLLFSSLSF 89

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            FAM+A+  +++      W+ VTA  G+ F+ MEI+EF HLI   A P RSAFLS+FF L
Sbjct: 90  GFAMIAAHKRKM-GGLYGWMAVTALLGIGFLCMEIWEFNHLIHEGAGPGRSAFLSAFFTL 148

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           VG HGLHV  GL+W+ VLVIQI K GL + N  RL CLS+FWHFLD+IWI VF+ VYL+G
Sbjct: 149 VGTHGLHVASGLLWMAVLVIQISKNGLTARNSTRLACLSLFWHFLDIIWIGVFTVVYLLG 208

Query: 209 VV 210
            +
Sbjct: 209 AL 210


>gi|145579237|pdb|2DYS|C Chain C, Bovine Heart Cytochrome C Oxidase Modified By Dccd
 gi|145579250|pdb|2DYS|P Chain P, Bovine Heart Cytochrome C Oxidase Modified By Dccd
          Length = 261

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 78/197 (39%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDI- 71
               +     G   G  ++++S  L F  FF  +                P  I   +  
Sbjct: 68  QGHHTPAVQKGLRYGMILFIISXVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPL 127

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRKH-MLQALFITITLGVYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V   + LK    S +       + +WH
Sbjct: 184 APFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|163852673|ref|YP_001640716.1| cytochrome c oxidase subunit III [Methylobacterium extorquens PA1]
 gi|163664278|gb|ABY31645.1| cytochrome c oxidase subunit III [Methylobacterium extorquens PA1]
          Length = 285

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 42/209 (20%), Positives = 80/209 (38%), Gaps = 17/209 (8%)

Query: 15  FYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA-------------- 60
                   + V       G  +++ S+ + F  +F  Y       A              
Sbjct: 73  HEANSGDHTRVVQLHHRYGMIMFIASEVMFFVAWFWAYFEAALYTADPIQPQRVEFTGGM 132

Query: 61  AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII 120
             P  I+ FD   + +   ++LL+S +       +            L +T   G++F  
Sbjct: 133 WPPKGIEAFDPWHLPLLNTLILLTSGTTVTWAHHALLHGDRKGLKYGLWLTIILGVLFTA 192

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
            + YE+AH          S + ++FF   G HG HV  G I+L V +++  +        
Sbjct: 193 CQAYEYAH---AHFGFSGSIYSATFFMATGFHGAHVIIGTIFLAVCLLRTYQGDFTPKQH 249

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLMGV 209
                 + +WHF+D++W+ +F+ +Y+ G 
Sbjct: 250 LGFEFAAWYWHFVDVVWLFLFAAIYVWGA 278


>gi|91225751|ref|ZP_01260780.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio alginolyticus
           12G01]
 gi|269968096|ref|ZP_06182133.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio alginolyticus
           40B]
 gi|91189640|gb|EAS75915.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio alginolyticus
           12G01]
 gi|269827342|gb|EEZ81639.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio alginolyticus
           40B]
          Length = 200

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 95/182 (52%), Positives = 120/182 (65%), Gaps = 1/182 (0%)

Query: 29  GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSC 88
               GFW+YLMSDC++FA  F TYAVL  N  AGP   D+F++  +FV T++LL SS++ 
Sbjct: 20  NKLFGFWVYLMSDCVLFATLFATYAVLSSNSIAGPTGKDIFELPFVFVETMLLLFSSITF 79

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            F ++A      +     W+LVT   G+ FI ME+YEF HLI     PQ SAFLS+FF L
Sbjct: 80  GFGIIAMKRNN-VAGLKRWMLVTFALGLGFICMEVYEFHHLIEEGYGPQTSAFLSAFFTL 138

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           VG HGLHV FGLIWL V   Q+  KGL      R  CLS+FWHFLD++WICVF+ VYL+G
Sbjct: 139 VGTHGLHVTFGLIWLAVAYHQLSTKGLNDNMAMRFNCLSLFWHFLDIVWICVFTIVYLLG 198

Query: 209 VV 210
           V+
Sbjct: 199 VM 200


>gi|332187386|ref|ZP_08389124.1| cytochrome c oxidase subunit III family protein [Sphingomonas sp.
           S17]
 gi|332012547|gb|EGI54614.1| cytochrome c oxidase subunit III family protein [Sphingomonas sp.
           S17]
          Length = 211

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 81/178 (45%), Positives = 113/178 (63%), Gaps = 1/178 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
            GFWI+L+SD ++F+ FF  YAVL    A GP+  D+F++  +   T +LLLSS +C  A
Sbjct: 33  YGFWIFLLSDFILFSCFFAAYAVLHDATAGGPSGKDLFELPLVETETALLLLSSFACGLA 92

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
            +A+  + +    +  + VTA  G  F+ +E +EF HLI     P RSAFLS+FFALVG 
Sbjct: 93  GIATLARNMRWFQI-AMAVTALLGAGFLALEAHEFLHLIGEGNGPGRSAFLSAFFALVGC 151

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           HG HV  GL+WL  ++ Q   KG      RR++C S+FWH LD+IW+ +F+ VYLMGV
Sbjct: 152 HGFHVTLGLLWLTTMMAQTWAKGFREDILRRILCFSLFWHALDIIWVALFTMVYLMGV 209


>gi|229056468|ref|ZP_04195880.1| Quinol oxidase subunit 3 [Bacillus cereus AH603]
 gi|229165641|ref|ZP_04293413.1| Quinol oxidase subunit 3 [Bacillus cereus AH621]
 gi|228617815|gb|EEK74868.1| Quinol oxidase subunit 3 [Bacillus cereus AH621]
 gi|228720865|gb|EEL72415.1| Quinol oxidase subunit 3 [Bacillus cereus AH603]
          Length = 200

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 72/179 (40%), Positives = 109/179 (60%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C  A
Sbjct: 22  LGFWIFLGAEIMLFATLFASYLVLAGRTADGPTPAQLFELKTLLIQTLLLLTSSFTCGIA 81

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +            ++W ++T   G  F+  EI EF   I   A  Q SAFLS+FF L+G 
Sbjct: 82  IHEMRKHNQK-GMLAWFILTLLLGAGFLFFEIEEFIMYIGEGATIQTSAFLSAFFVLLGT 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+IW   ++IQILK+GL     R++  +S++WHFLDL+W+ +++ VYL G+V
Sbjct: 141 HGAHVTGGIIWATCVIIQILKRGLTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMV 199


>gi|226225912|ref|YP_002760018.1| cytochrome c oxidase subunit III [Gemmatimonas aurantiaca T-27]
 gi|226089103|dbj|BAH37548.1| cytochrome c oxidase subunit III [Gemmatimonas aurantiaca T-27]
          Length = 230

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 56/207 (27%), Positives = 92/207 (44%), Gaps = 22/207 (10%)

Query: 23  SCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISG------IFV 76
           + +  D   +  W ++ S+C++FA    TY +       GP P +V+            +
Sbjct: 23  TTLGLDNRKIAIWTFIGSECMLFASLISTYLIYKGRSPEGPYPHEVWTNPATGQVFKPIL 82

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVS----------------WLLVTAFFGMIFII 120
           +  V   S+     + LA        +                   WL +T   G++F+ 
Sbjct: 83  NIPVTSASTFVLLMSSLAMVLALAAVQNRHVPKTTTGERILGNSKLWLWMTCLLGIVFLG 142

Query: 121 MEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQ 180
            + YEF   I      + + F SSFF L G HG HV  G+IWLF L+    K+GL   + 
Sbjct: 143 CQAYEFTSFIHEGLTIRTNLFGSSFFTLTGFHGAHVTAGVIWLFTLLAIDYKRGLEPKDS 202

Query: 181 RRLICLSMFWHFLDLIWICVFSFVYLM 207
             +   +++WHF+D+IWI +F+ VYL+
Sbjct: 203 LLVDIAALYWHFVDVIWIVIFTLVYLI 229


>gi|326370353|gb|ADZ56186.1| cytochrome c oxidase subunit III [Orcaella heinsohni]
 gi|326370367|gb|ADZ56199.1| cytochrome c oxidase subunit III [Orcaella heinsohni]
          Length = 261

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 81/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               +     G   G  ++++S+ L F  FF  +  + L      G +            
Sbjct: 68  QGHHTPTVQKGLRYGMILFILSEVLFFTGFFWAFYHSSLAPTPELGGSWPPTGIHPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  LL+T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRKH-MLQALLITIMLGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +     S +       + +WH
Sbjct: 184 APFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFMRQMMFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|260901248|ref|ZP_05909643.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio
           parahaemolyticus AQ4037]
 gi|308106822|gb|EFO44362.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio
           parahaemolyticus AQ4037]
          Length = 200

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 95/182 (52%), Positives = 120/182 (65%), Gaps = 1/182 (0%)

Query: 29  GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSC 88
               GFW+YLMSDC++FA  F TYAVL  N  AGP   ++F++  +FV T++LL SS++ 
Sbjct: 20  NKLFGFWVYLMSDCVLFATLFATYAVLSSNSIAGPTGKEIFELPFVFVETMLLLFSSITF 79

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            F ++A      +     W+LVT   G+ FI ME+YEF HLI     PQ SAFLS+FF L
Sbjct: 80  GFGIIAMKRND-VAGLKRWMLVTFALGLGFICMEVYEFHHLIQEGYGPQTSAFLSAFFTL 138

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           VG HGLHV FGLIWL V   Q+  KGL      R  CLS+FWHFLD++WICVF+ VYLMG
Sbjct: 139 VGTHGLHVTFGLIWLAVAYHQLSTKGLNDNMAMRFNCLSLFWHFLDIVWICVFTIVYLMG 198

Query: 209 VV 210
           V+
Sbjct: 199 VM 200


>gi|28900484|ref|NP_800139.1| cytochrome o ubiquinol oxidase subunit III [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|260365637|ref|ZP_05778158.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio
           parahaemolyticus K5030]
 gi|260877437|ref|ZP_05889792.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio
           parahaemolyticus AN-5034]
 gi|260898918|ref|ZP_05907359.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio
           parahaemolyticus Peru-466]
 gi|28808864|dbj|BAC61972.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|308089175|gb|EFO38870.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio
           parahaemolyticus Peru-466]
 gi|308090543|gb|EFO40238.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio
           parahaemolyticus AN-5034]
 gi|308111449|gb|EFO48989.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio
           parahaemolyticus K5030]
          Length = 200

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 95/182 (52%), Positives = 120/182 (65%), Gaps = 1/182 (0%)

Query: 29  GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSC 88
               GFW+YLMSDC++FA  F TYAVL  N  AGP   ++F++  +FV T++LL SS++ 
Sbjct: 20  NKLFGFWVYLMSDCVLFATLFATYAVLSSNSIAGPTGKEIFELPFVFVETMLLLFSSITF 79

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            F ++A      +     W+LVT   G+ FI ME+YEF HLI     PQ SAFLS+FF L
Sbjct: 80  GFGIIAMKRND-VAGLKRWMLVTFALGLGFICMEVYEFHHLIQEGYGPQTSAFLSAFFTL 138

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           VG HGLHV FGLIWL V   Q+  KGL      R  CLS+FWHFLD++WICVF+ VYLMG
Sbjct: 139 VGTHGLHVTFGLIWLAVAYHQLSTKGLNDNMAMRFNCLSLFWHFLDIVWICVFTIVYLMG 198

Query: 209 VV 210
           V+
Sbjct: 199 VM 200


>gi|254252016|ref|ZP_04945334.1| cytochrome c oxidase subunit III [Burkholderia dolosa AUO158]
 gi|124894625|gb|EAY68505.1| cytochrome c oxidase subunit III [Burkholderia dolosa AUO158]
          Length = 202

 Score =  127 bits (320), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 102/195 (52%), Positives = 128/195 (65%), Gaps = 7/195 (3%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            D          +  GFW+YLM+DC++FA  F T+AVLG  YA GP   D+FDI G+ V 
Sbjct: 13  HDDHPP----SHSVFGFWLYLMTDCVIFAALFATFAVLGNQYAGGPTAKDLFDIPGVAVE 68

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T  LLLSS++  FAMLA+  ++     ++WL VT   G  F+ ME+ EFAHLI+  A PQ
Sbjct: 69  TAALLLSSITYGFAMLAA-YRQRRGALLAWLAVTFVLGAAFLAMELREFAHLIAEGAGPQ 127

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQI--LKKGLISGNQRRLICLSMFWHFLDL 195
           RSAFLS+FF LVG HGLHV  GL+W+ VL  QI      L   + RRL CLS+FWHFLD+
Sbjct: 128 RSAFLSAFFTLVGTHGLHVTVGLLWMIVLAAQIVLRSGDLTDRDLRRLTCLSLFWHFLDI 187

Query: 196 IWICVFSFVYLMGVV 210
           +WICVFSFVYL  V+
Sbjct: 188 VWICVFSFVYLASVI 202


>gi|118590731|ref|ZP_01548132.1| putative cytochrome c oxidase subunit iii transmembrane protein
           [Stappia aggregata IAM 12614]
 gi|118436707|gb|EAV43347.1| putative cytochrome c oxidase subunit iii transmembrane protein
           [Stappia aggregata IAM 12614]
          Length = 290

 Score =  127 bits (320), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 43/205 (20%), Positives = 79/205 (38%), Gaps = 17/205 (8%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA--------------VLGKNYAAGPA 64
               + V       G  +++ S+ + F  +F  Y               V        PA
Sbjct: 83  QGHHTRVVSLHLRYGMLLFIASEVMFFVAWFWAYFDASLFTGEAIQYARVEATGGHWPPA 142

Query: 65  PIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIY 124
            I+ FD   + +   ++LL S +       +            L  T   G++F I ++Y
Sbjct: 143 GIETFDPWHLPLLNTLILLCSGTTVTWAHHALLHNDRDGLKWGLTCTVLLGILFTICQVY 202

Query: 125 EFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLI 184
           E++H          + + ++FF   G HG HV  G I+L V + + L             
Sbjct: 203 EYSH---AAFDFGGNIYGATFFMATGFHGFHVIVGTIFLAVCLFRALAGQFTVEKHFGFE 259

Query: 185 CLSMFWHFLDLIWICVFSFVYLMGV 209
             + +WHF+D++W+ +F  +Y+ G 
Sbjct: 260 AAAWYWHFVDVVWLFLFVSIYIWGA 284


>gi|57282259|emb|CAD32358.1| cytochrome oxidase subunit 3 [Tecophilaea violiflora]
          Length = 265

 Score =  127 bits (320), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 81/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIWVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF+  G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFSATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|138897018|ref|YP_001127471.1| cytochrome aa3 quinol oxidase polypeptide III [Geobacillus
           thermodenitrificans NG80-2]
 gi|134268531|gb|ABO68726.1| Cytochrome aa3 quinol oxidase polypeptide III [Geobacillus
           thermodenitrificans NG80-2]
          Length = 204

 Score =  127 bits (320), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 75/179 (41%), Positives = 115/179 (64%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F TY VL +   +GP   ++F +  + + T++LL SS +C  A
Sbjct: 26  LGFWIFLGAEVVLFATLFATYLVLFQRTGSGPTAQELFQVKDVLIETLLLLTSSFTCGLA 85

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +      R +   ++WLLVT   G+ FI  E+ EF H +   A  Q SAFLSSFF LVG 
Sbjct: 86  IFEMRRGR-LAGLLAWLLVTLLLGIGFITFEVREFIHYVHEGATMQTSAFLSSFFVLVGT 144

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+ W+  ++IQ+L++GL     R++  +S++WHFLD++WI +F+ VYL+G+V
Sbjct: 145 HGAHVSLGIGWMIFIIIQLLQRGLTVKTARKVFIVSLYWHFLDVVWIFIFTLVYLLGMV 203


>gi|186470620|ref|YP_001861938.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia phymatum
           STM815]
 gi|184196929|gb|ACC74892.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia phymatum
           STM815]
          Length = 204

 Score =  127 bits (320), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 95/201 (47%), Positives = 122/201 (60%), Gaps = 1/201 (0%)

Query: 6   IGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAP 65
           +  +P ++     D +    D   T LGFWIYLMSDCL+FA  F T+ VL    A GPA 
Sbjct: 1   MANTPTYAAAAHHDARGHHDDGTRTTLGFWIYLMSDCLIFATLFATFGVLANATAGGPAG 60

Query: 66  IDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYE 125
             +F++  +   T++LL SS +    ML+    R     + WL VT   G  FI ME+YE
Sbjct: 61  RQLFELPYVLGETLLLLASSFTFGMGMLSVYANR-RGTVIGWLAVTFVLGAAFIGMEVYE 119

Query: 126 FAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLIC 185
           FA L S  A P  SAFLS +F LVG HGLHV  GL+W+ V++ QI + GL    +RR+ C
Sbjct: 120 FAKLASDGAGPSTSAFLSGYFTLVGTHGLHVTTGLLWIGVMMHQIGRFGLTPVTRRRIAC 179

Query: 186 LSMFWHFLDLIWICVFSFVYL 206
           LS+FWHFLDL+WICVFS VYL
Sbjct: 180 LSLFWHFLDLVWICVFSLVYL 200


>gi|21230618|ref|NP_636535.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas campestris
           pv. campestris str. ATCC 33913]
 gi|66769386|ref|YP_244148.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas campestris
           pv. campestris str. 8004]
 gi|188992573|ref|YP_001904583.1| Cytochrome O ubiquinol oxidase subunit III [Xanthomonas campestris
           pv. campestris str. B100]
 gi|21112199|gb|AAM40459.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas campestris
           pv. campestris str. ATCC 33913]
 gi|66574718|gb|AAY50128.1| cytochrome O ubiquinol oxidase subunit III [Xanthomonas campestris
           pv. campestris str. 8004]
 gi|167734333|emb|CAP52543.1| Cytochrome O ubiquinol oxidase subunit III [Xanthomonas campestris
           pv. campestris]
          Length = 209

 Score =  127 bits (320), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 100/182 (54%), Positives = 125/182 (68%), Gaps = 1/182 (0%)

Query: 29  GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSC 88
            T  GFW+YLMSDCL+FA  F TYAVL      GP   ++FD+  + V T +LL SSLS 
Sbjct: 29  NTVFGFWVYLMSDCLLFAGLFATYAVLSGATVDGPTAKELFDLKFVLVETFLLLFSSLSF 88

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            FAM+++  +++      WL VTA  G+ F+ MEI+EF HLI   A P RSAFLS+FF L
Sbjct: 89  GFAMISAHKRKM-AGLYGWLAVTALLGIGFLCMEIWEFNHLIHEGAGPGRSAFLSAFFFL 147

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           VG HGLHV  GL+W+ VLVIQI K GL + N  RL CLS+FWHFLD+IWI VF+ VYL+G
Sbjct: 148 VGTHGLHVASGLLWMAVLVIQISKNGLTARNSTRLACLSLFWHFLDIIWIGVFTVVYLLG 207

Query: 209 VV 210
            +
Sbjct: 208 AL 209


>gi|37527737|ref|NP_931082.1| cytochrome o ubiquinol oxidase subunit III [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|36787173|emb|CAE16249.1| cytochrome O ubiquinol oxidase subunit III (ubiquinol oxidase chain
           C) [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 204

 Score =  127 bits (320), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 93/179 (51%), Positives = 125/179 (69%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
            GFWIYLMSDC++FA  F TYAVL    A GP+  ++F +S + V T +LL SS++  FA
Sbjct: 27  FGFWIYLMSDCILFACLFATYAVLVNGTAGGPSGKEIFGLSFVLVETFLLLFSSITYGFA 86

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           ML    K  I +  +WL +T  FG+ F+ ME+YEF HLI     P RSAFLS FFALV  
Sbjct: 87  ML-GMNKGKIGQVNAWLGMTFLFGLGFVAMELYEFHHLIVDGHGPDRSAFLSGFFALVAT 145

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG+HV  GL+W+ +++IQ+ ++GL   N+ RL CLS+FWHFLD++WICVF+ VYL+G +
Sbjct: 146 HGIHVTCGLVWIIIMIIQVTRRGLTDVNKTRLNCLSLFWHFLDVVWICVFTVVYLLGAM 204


>gi|157367461|gb|ABV45594.1| cytochrome c oxidase subunit III [Mammuthus primigenius]
 gi|157367475|gb|ABV45607.1| cytochrome c oxidase subunit III [Mammuthus primigenius]
 gi|157367489|gb|ABV45620.1| cytochrome c oxidase subunit III [Mammuthus primigenius]
          Length = 269

 Score =  127 bits (320), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 83/197 (42%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               + V  +    G  +++ S+ L F  FF  +  + L      G     V        
Sbjct: 68  QGHHTPVVQESLRYGMILFITSEVLFFTGFFWAFYHSSLAPTPELGSYWPPVGVYPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S ++ ++A  +       +  +  LL+T   G+ F +++++E+     
Sbjct: 128 EVPLLNTSVLLASGVTITWAHHSLMEGNRKN-MLQALLITILLGVYFTLLQMFEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L    I+ LK    S +       + +WH
Sbjct: 184 ASFTISDGIYGSTFFVTTGFHGLHVIIGSTFLLTCFIRQLKFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYLSIYWWG 260


>gi|300690264|ref|YP_003751259.1| cytochrome o ubiquinol oxidase, subunit III [Ralstonia solanacearum
           PSI07]
 gi|299077324|emb|CBJ49950.1| cytochrome o ubiquinol oxidase, subunit III [Ralstonia solanacearum
           PSI07]
          Length = 211

 Score =  127 bits (320), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 89/179 (49%), Positives = 119/179 (66%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
            GFW+YLMSD ++FA  F T+ VL    A GP   ++FD+S + + T +LL+SS++    
Sbjct: 34  FGFWVYLMSDLILFASLFATFCVLRSATAGGPDGKELFDLSYVLIETGILLVSSITYGMV 93

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           M+     R   + + WL +T   G  F+ MEI EF HLI+  A P RSAFLSSFF LVG 
Sbjct: 94  MIGLQAGR-KDQVMLWLGITFLLGAAFVGMEINEFHHLIAEGAGPSRSAFLSSFFTLVGT 152

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HGLHV  GL+W+ VL+ QI +KGL + N  RL CLS+FWHFLD++WI VF+ VYL+G +
Sbjct: 153 HGLHVASGLLWIAVLMWQISRKGLTATNSTRLACLSLFWHFLDVVWIGVFTVVYLLGAM 211


>gi|50511292|dbj|BAD32647.1| cytochrome c oxidase subunit 3 [Orthetrum triangulare melania]
          Length = 262

 Score =  127 bits (320), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 45/194 (23%), Positives = 82/194 (42%), Gaps = 11/194 (5%)

Query: 22  ESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD-ISGI 74
            +     G   G  +++ S+ L F  FF  Y     +          P  I  FD +S  
Sbjct: 72  HTYPVVIGLRWGMILFITSEVLFFVSFFWAYFHSSLSPTVEIGSMWPPKGISPFDPMSIP 131

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            ++T +LL S ++ ++A  +             L  T   G+ F I++ YE+   I    
Sbjct: 132 MLNTSILLASGVTVTWAHHSLMQGNHSQGM-QGLFFTVLLGIYFTILQAYEY---IEAPF 187

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
               S + S+FF   G HG+HV  G ++L   +++   K     +       + +WHF+D
Sbjct: 188 TIADSVYGSTFFMATGFHGIHVIIGTMFLSACLLRHSMKHFSESHHFGFEAAAWYWHFVD 247

Query: 195 LIWICVFSFVYLMG 208
           ++W+ ++  +Y  G
Sbjct: 248 VVWLFLYISIYWWG 261


>gi|326370325|gb|ADZ56160.1| cytochrome c oxidase subunit III [Orcaella heinsohni]
 gi|326370339|gb|ADZ56173.1| cytochrome c oxidase subunit III [Orcaella heinsohni]
          Length = 261

 Score =  127 bits (320), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 81/197 (41%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG--- 73
               +     G   G  ++++S+ L F  FF  +  + L      G +            
Sbjct: 68  QGHHTPTVQKGLRYGMILFILSEVLFFTGFFWAFYHSSLAPTPELGGSWPPTGIHPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S +S ++A  +       H  +  LL+T   G+ F +++  E+     
Sbjct: 128 EVPLLNTSVLLASGVSITWAHHSLMEGDRKH-MLQALLITIMLGLYFTLLQASEY---YE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                    + S+FF   G HGLHV  G  +L V  ++ +     S +       + +WH
Sbjct: 184 APFTISDGIYGSTFFVATGFHGLHVIIGSTFLIVCFMRQMMFHFTSNHHFGFEAAAWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ ++  +Y  G
Sbjct: 244 FVDVVWLFLYVSIYWWG 260


>gi|117071|sp|P06030|COX3_PARDE RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome aa3 subunit 3; AltName: Full=Cytochrome
           c oxidase polypeptide III; AltName: Full=Oxidase aa(3)
           subunit 3
 gi|45473|emb|CAA29272.1| unnamed protein product [Paracoccus denitrificans]
 gi|225704|prf||1311262B cytochrome c oxidase III
          Length = 274

 Score =  127 bits (320), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 50/201 (24%), Positives = 94/201 (46%), Gaps = 14/201 (6%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA--VLGKNYA--------AGPAPIDV 68
             + + V   G   GF +++MS+ + F  +F  +    L               P  I  
Sbjct: 76  TGEHTPVVRIGLQYGFILFIMSEVMFFVAWFWAFIKNALYPMGPDSPIKDGVWPPEGIVT 135

Query: 69  FDIS-GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
           FD      ++T++LLLS ++ ++A  A   +     T++ L+V    G+ F  ++ YE++
Sbjct: 136 FDPWHLPLINTLILLLSGVAVTWAHHAFVLEGDRKTTINGLIVAVILGVCFTGLQAYEYS 195

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
           H          + +  +F+   G HG HV  G I+LFV +I++LK  +           +
Sbjct: 196 H---AAFGLADTVYAGAFYMATGFHGAHVIIGTIFLFVCLIRLLKGQMTQKQHVGFEAAA 252

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ +F  +Y+ G
Sbjct: 253 WYWHFVDVVWLFLFVVIYIWG 273


>gi|254501998|ref|ZP_05114149.1| Cytochrome c oxidase subunit III subfamily [Labrenzia alexandrii
           DFL-11]
 gi|222438069|gb|EEE44748.1| Cytochrome c oxidase subunit III subfamily [Labrenzia alexandrii
           DFL-11]
          Length = 286

 Score =  127 bits (319), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 41/206 (19%), Positives = 79/206 (38%), Gaps = 17/206 (8%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG--------------KNYAAG 62
             +   + V       G  +++ S+ + F  +F  Y                        
Sbjct: 83  AHEGHHTRVVSLHLRYGMILFIASEVMFFVAWFWAYFDAALFAGEAINFARAEATGGVWP 142

Query: 63  PAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIME 122
           P  I+ FD   + +   ++LL+S +       +            L +T   G++F I +
Sbjct: 143 PEGIETFDPWHLPLLNTLILLASGTTVTWAHHALLHDDREGLKWGLTLTVLLGVLFTICQ 202

Query: 123 IYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRR 182
           IYE+ H          + + ++F+   G HG HV  G I+L V + + L           
Sbjct: 203 IYEYTH---AAFGFSGNIYGATFYMATGFHGFHVVVGTIFLAVCLFRALAGHFTKEQHFG 259

Query: 183 LICLSMFWHFLDLIWICVFSFVYLMG 208
               + +WHF+D++W+ +F  +Y+ G
Sbjct: 260 FEAAAWYWHFVDVVWLFLFVAIYIWG 285


>gi|78066843|ref|YP_369612.1| Heme/copper-type cytochrome/quinol oxidase subunit 3-like
           [Burkholderia sp. 383]
 gi|77967588|gb|ABB08968.1| cytochrome bo3 quinol oxidase subunit 3 [Burkholderia sp. 383]
          Length = 202

 Score =  127 bits (319), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 102/195 (52%), Positives = 133/195 (68%), Gaps = 7/195 (3%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            D          +  GFW+YLM+DC++FA  F T+AVLG+ +A GP   D+FDI G+ V 
Sbjct: 13  HDDHPP----SHSVFGFWLYLMTDCVIFAALFATFAVLGQQHAGGPTAKDLFDIPGVAVE 68

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T  LLLSS++  FAMLA+  K+     ++WL VT   G  F++ME+ EF+HLI+  A PQ
Sbjct: 69  TAALLLSSITYGFAMLAA-YKQRRGALLAWLAVTFVLGAAFLVMELREFSHLIAEGAGPQ 127

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLICLSMFWHFLDL 195
           RSAFLS+FF LVG HGLHV  GL+W+ VL  QI+ +G  L   + RRL CLS+FWHFLD+
Sbjct: 128 RSAFLSAFFTLVGTHGLHVTAGLLWMIVLAGQIVFRGGDLTDRDLRRLTCLSLFWHFLDI 187

Query: 196 IWICVFSFVYLMGVV 210
           +WICVFSFVYL  V+
Sbjct: 188 VWICVFSFVYLASVI 202


>gi|57282261|emb|CAD32359.1| cytochrome oxidase subunit 3 [Lilium speciosum]
          Length = 265

 Score =  127 bits (319), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 82/199 (41%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++  + +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTVFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF+  G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTLSDSIYGSTFFSATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|57282269|emb|CAD32363.1| cytochrome oxidase subunit 3 [Campynema lineare]
          Length = 265

 Score =  127 bits (319), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 81/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTPILHSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF+  G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFSATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|167720490|ref|ZP_02403726.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           pseudomallei DM98]
 gi|254191301|ref|ZP_04897805.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei Pasteur
           52237]
 gi|157938973|gb|EDO94643.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei Pasteur
           52237]
          Length = 201

 Score =  127 bits (319), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 99/200 (49%), Positives = 130/200 (65%), Gaps = 5/200 (2%)

Query: 12  FSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDI 71
            +L +             +  GFW+YLM+DC++FA  F T+AVLG  +A GP   D+FDI
Sbjct: 6   MTLDHAASHDHPP---SHSVFGFWLYLMTDCVLFAALFATFAVLGNQFAGGPTAKDLFDI 62

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
            G+ + T  LLLSS++  FAM+ +  +R       WL VT   G  F+ ME+ EF+HL++
Sbjct: 63  PGVALETAALLLSSITYGFAMIGAH-QRRRGAVFGWLAVTFVLGAAFLAMELREFSHLVA 121

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKK-GLISGNQRRLICLSMFW 190
             A PQRSAFLSSFF LVG HGLHV  GL+W+ VLV Q L++  L   + RRL CLS+FW
Sbjct: 122 EGAGPQRSAFLSSFFTLVGTHGLHVTAGLVWMAVLVAQALRRPDLTERDIRRLTCLSLFW 181

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD++WICVFSFVYL  V+
Sbjct: 182 HFLDIVWICVFSFVYLASVI 201


>gi|52080094|ref|YP_078885.1| cytochrome caa3 oxidase subunit III [Bacillus licheniformis ATCC
           14580]
 gi|52785468|ref|YP_091297.1| CtaE [Bacillus licheniformis ATCC 14580]
 gi|319646131|ref|ZP_08000361.1| CtaE protein [Bacillus sp. BT1B_CT2]
 gi|52003305|gb|AAU23247.1| cytochrome caa3 oxidase (subunit III) [Bacillus licheniformis ATCC
           14580]
 gi|52347970|gb|AAU40604.1| CtaE [Bacillus licheniformis ATCC 14580]
 gi|317391881|gb|EFV72678.1| CtaE protein [Bacillus sp. BT1B_CT2]
          Length = 207

 Score =  127 bits (319), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 71/188 (37%), Positives = 111/188 (59%), Gaps = 2/188 (1%)

Query: 24  CVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLL 83
            ++    ++GFW++L  + ++FA  F TY  L  + A GP   ++FD+  +F++T++LL 
Sbjct: 20  TLEGKNKFIGFWLFLGGETVLFASLFATYLALKNSNAGGPKTTEMFDMGLVFLATMLLLT 79

Query: 84  SSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME-AVPQRSAFL 142
           SSL+  +AM          K   WL +T   G  F+ +EIYEF H I       Q SA  
Sbjct: 80  SSLTSVYAMYHMKNFAFK-KMQVWLGITVLLGAGFLALEIYEFTHYIHEYGFTIQSSALG 138

Query: 143 SSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFS 202
           S+F+ LVG HG HV FGL+W+  L+I+   +GL   N  +    S++WHF+D++W+ +F+
Sbjct: 139 SAFYTLVGTHGAHVTFGLLWILSLMIRNAGRGLSLYNAPKFFVASLYWHFIDVVWVFIFT 198

Query: 203 FVYLMGVV 210
            VYLMG+V
Sbjct: 199 VVYLMGMV 206


>gi|238800150|gb|ACR55940.1| cytochrome c oxidase subunit 3 [Anilius scytale]
          Length = 261

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 38/198 (19%), Positives = 77/198 (38%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF     +             P  I   +
Sbjct: 66  TYQGHHTTGVQKNMRYGMMLFITSEVFFFLGFFWALYHVSLVPTPELGAEWPPTGISPLN 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +  K    +    L++T   G+ F ++++ E+    
Sbjct: 126 PFEVPLLNTAVLLSSGATITWSHHTMMKGNKKEATYALMITVALGVYFTLLQLSEYM--- 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G ++L   ++++++    + +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMIGTLFLITCLVRLIQYHFTTTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ +F+ VY  G
Sbjct: 243 HFVDVVWLFLFASVYWWG 260


>gi|71734182|ref|YP_273478.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|71554735|gb|AAZ33946.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|320323023|gb|EFW79113.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. glycinea str. B076]
 gi|320329854|gb|EFW85842.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas syringae
           pv. glycinea str. race 4]
          Length = 208

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 95/181 (52%), Positives = 124/181 (68%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLM+DC++FA FF  YAV+  + A GP+  D+F +  + V T  LL+SS++  
Sbjct: 29  TVYGFWLYLMTDCVLFASFFAVYAVMVNSVAGGPSGQDIFLLPFVAVETAFLLVSSITYG 88

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAMLA   K    + + WL +T   G  FI MEIYEF HLI     P RS FLS+FFALV
Sbjct: 89  FAMLAL-YKGKKSQVLGWLALTFLCGAAFIGMEIYEFHHLIHEGYGPSRSGFLSAFFALV 147

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           GLHG HV  GLIW+ +++ Q+ KKGL + N+ RL CLS+FWHFLD++WI VF+ VYLMG 
Sbjct: 148 GLHGAHVTSGLIWMAIMMFQVQKKGLTNTNKTRLSCLSLFWHFLDVVWIGVFTVVYLMGA 207

Query: 210 V 210
           +
Sbjct: 208 L 208


>gi|311029888|ref|ZP_07707978.1| cytochrome c oxidase, subunit III [Bacillus sp. m3-13]
          Length = 207

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 72/189 (38%), Positives = 117/189 (61%), Gaps = 3/189 (1%)

Query: 24  CVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGK--NYAAGPAPIDVFDISGIFVSTIVL 81
            ++    +LGFW++L  + ++FA  F TY  L    +  +GP   ++FD++ +F +T++L
Sbjct: 20  TLEGKNKFLGFWLFLGGETVLFASLFATYLALSGPDSIVSGPDQKELFDLALVFAATMIL 79

Query: 82  LLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAF 141
           L SSL+  +AM          K   W+ +T   G+ F+I+EIYEF H I +      SAF
Sbjct: 80  LTSSLTSVYAMYHMKNFNFK-KMQLWMGITWLLGLSFLILEIYEFNHYIHLGHTITSSAF 138

Query: 142 LSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVF 201
            S+F+ LVG HG HVFFGL+W+  L+I+ +++GL   N  +    S++WHF+D++W+ +F
Sbjct: 139 GSAFYVLVGTHGAHVFFGLLWIGTLLIRNMRRGLDLYNAPKFYVASLYWHFIDVVWLFIF 198

Query: 202 SFVYLMGVV 210
           + VYLMG+V
Sbjct: 199 TVVYLMGLV 207


>gi|17547634|ref|NP_521036.1| transmembrane cytochrome O ubiquinol oxidase (subunit III)
           oxidoreductase [Ralstonia solanacearum GMI1000]
 gi|17429938|emb|CAD16622.1| probable transmembrane cytochrome o ubiquinol oxidase (subunit III)
           oxidoreductase protein [Ralstonia solanacearum GMI1000]
          Length = 211

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 89/179 (49%), Positives = 119/179 (66%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
            GFW+YLMSD ++FA  F T+ VL    A GP   ++FD+S + + T +LL+SS++    
Sbjct: 34  FGFWVYLMSDLIIFASLFATFCVLRSATAGGPDGKELFDLSYVLIETGILLVSSITYGMV 93

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           M+     R   + + WL +T   G  F+ MEI EF HLI+  A P RSAFLSSFF LVG 
Sbjct: 94  MVGLQAGR-KDQVMLWLGITFLLGAAFVGMEINEFHHLIAEGAGPSRSAFLSSFFTLVGT 152

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HGLHV  GL+W+ VL+ QI +KGL + N  RL CLS+FWHFLD++WI VF+ VYL+G +
Sbjct: 153 HGLHVASGLLWIAVLMWQISRKGLTTTNSTRLACLSLFWHFLDVVWIGVFTVVYLLGAM 211


>gi|229592522|ref|YP_002874641.1| cytochrome C oxidase (ubiquinol oxidase) subunit III [Pseudomonas
           fluorescens SBW25]
 gi|229364388|emb|CAY52170.1| cytochrome C oxidase (ubiquinol oxidase) subunit III [Pseudomonas
           fluorescens SBW25]
          Length = 208

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 95/181 (52%), Positives = 123/181 (67%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLM+DC++FA  F  YAVL  N A GP+  D+F++  +   T +LL SS++  
Sbjct: 29  TVFGFWLYLMTDCILFASIFAVYAVLVNNVAGGPSGHDIFELPYVLGETALLLFSSITYG 88

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAMLA   K      +SWL +T  FG+ FI MEI EF  LIS    P RS FLS+FF LV
Sbjct: 89  FAMLAF-YKGNKKGVLSWLALTFLFGLGFIGMEINEFHLLISEGYGPHRSGFLSAFFTLV 147

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GL+W+ V++ Q+ K GL + N+ RL CLS+FWHFLD++WICVF+ VYLMG 
Sbjct: 148 GTHGLHVTAGLLWMAVMMYQVNKHGLTNTNKTRLSCLSLFWHFLDVVWICVFTVVYLMGT 207

Query: 210 V 210
           +
Sbjct: 208 L 208


>gi|254487574|ref|ZP_05100779.1| cytochrome c oxidase subunit III [Roseobacter sp. GAI101]
 gi|214044443|gb|EEB85081.1| cytochrome c oxidase subunit III [Roseobacter sp. GAI101]
          Length = 267

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 52/198 (26%), Positives = 90/198 (45%), Gaps = 9/198 (4%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA---VLGKNYAAG-----PAPIDVFDI 71
              + V   G   GF +++MS+ + F  +F T+    +   +   G     P  I V   
Sbjct: 69  GDHTPVVRIGLRYGFILFIMSEVMFFVAWFWTFFKEALYPMSDFPGSEYVQPDIIPVDAF 128

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T++LLLS  + ++A  A   +      ++ L +    G++F   + +E+  LI+
Sbjct: 129 HLPLINTLILLLSGCAVTWAHHALVHENNRKDLITGLALAIGLGLMFTAFQAFEYYELIA 188

Query: 132 MEAVPQRSA-FLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                     F SSFF   G HG HV  G I+L V +I+ LK              + +W
Sbjct: 189 HYDWQFGGDLFFSSFFMATGFHGFHVIIGTIFLTVCLIRALKGHFTPEQHVGFEAAAWYW 248

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ +F  VY+ G
Sbjct: 249 HFVDVVWLFLFFAVYMWG 266


>gi|212638123|ref|YP_002314643.1| cytochrome aa3 quinol oxidase subunit III [Anoxybacillus
           flavithermus WK1]
 gi|212559603|gb|ACJ32658.1| Cytochrome aa3 quinol oxidase subunit III [Anoxybacillus
           flavithermus WK1]
          Length = 201

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 81/179 (45%), Positives = 119/179 (66%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F  Y VLG  YA GP P D+F ++ + + T++LL SS +C  A
Sbjct: 23  LGFWIFLGAEIVLFATLFAVYGVLGHRYAGGPTPSDIFKLNDVLIETLLLLTSSFTCGLA 82

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +     + +  K + WL++T   G  F+ MEI EF H +   A  Q SAFLSSFF L+G 
Sbjct: 83  VFFMRQRDMK-KLLVWLIITLLLGAGFLFMEIREFIHYVHEGATMQTSAFLSSFFVLLGT 141

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV FG+IW  +L+IQ+L++GL     R++  +S++WHFLD++WI +F+FVYL G+V
Sbjct: 142 HGAHVTFGIIWAVMLIIQLLQRGLTPMTARKMFIISLYWHFLDVVWIFIFTFVYLKGMV 200


>gi|52221045|ref|YP_086847.1| cytochrome c oxidase subunit III [Rhineura floridana]
 gi|47026677|gb|AAT08496.1| cytochrome c oxidase subunit III [Rhineura floridana]
          Length = 261

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 40/201 (19%), Positives = 82/201 (40%), Gaps = 15/201 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPID 67
                 +     G   G  +++ S+ L           +    T  + G     G  P++
Sbjct: 66  TYQGHHTPPVQSGLRYGMLLFITSEVLFFFGFFWAFYHSSLAPTPEIGGTWPPNGIHPLN 125

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
            F++    ++T VLL S ++ ++A  +    +    T   L +T   G+ F  ++  E+ 
Sbjct: 126 PFEVP--LLNTTVLLASGITVTWAHHSIMEAKHKEAT-QALSITILLGLYFTALQAMEY- 181

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
                      S + ++FF   G HGLHV  G  +L   +++  K    + +       +
Sbjct: 182 --YEAPFTISDSVYGTTFFVATGFHGLHVIIGSTFLLTCLLRQTKHHFTTSHHFGFEAAA 239

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ ++  +Y  G
Sbjct: 240 WYWHFVDVVWLFLYVSIYWWG 260


>gi|300702889|ref|YP_003744490.1| cytochrome o ubiquinol oxidase subunit III [Ralstonia solanacearum
           CFBP2957]
 gi|299070551|emb|CBJ41846.1| cytochrome o ubiquinol oxidase, subunit III [Ralstonia solanacearum
           CFBP2957]
          Length = 211

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 89/179 (49%), Positives = 120/179 (67%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
            GFW+YLMSD ++FA  F T+ VL    A GP   ++FD+S + + T +LL+SS++    
Sbjct: 34  FGFWVYLMSDLILFASLFATFCVLRSATAGGPNGKELFDLSYVLIETGILLVSSITYGMV 93

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           M+   + R   + + WL +T   G  F+ MEI EF HLI+  A P RSAFLSSFF LVG 
Sbjct: 94  MIGLQSGR-KDQVMLWLGITFLLGAAFVGMEINEFHHLIAEGAGPSRSAFLSSFFTLVGT 152

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HGLHV  GL+W+ VL+ QI +KGL + N  RL CLS+FWHFLD++WI VF+ VYL+G +
Sbjct: 153 HGLHVASGLLWIAVLMWQISRKGLTATNSTRLACLSLFWHFLDVVWIGVFTVVYLLGAM 211


>gi|270301111|gb|ACZ59688.2| cytochrome c oxidase subunit III [Peromyscus polionotus ammobates]
 gi|270301132|gb|ACZ59730.2| cytochrome c oxidase subunit III [Peromyscus polionotus allophrys]
          Length = 223

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 39/201 (19%), Positives = 79/201 (39%), Gaps = 15/201 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPID 67
                 + +   G   G  ++++S+             +    T+ + G     G  P++
Sbjct: 28  TYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLAPTHDLGGCWPPTGITPLN 87

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
             ++    ++T VLL S +S ++A  +        K  +         ++ I   I   +
Sbjct: 88  PLEVP--LLNTSVLLASGVSITWAHHSLMEG----KRSNMNQALLITILLGIYFTILPAS 141

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
                        + S+FF   G HGLHV  G  +L V +++ LK    S +       +
Sbjct: 142 EYFETPFSISDGVYGSTFFMATGFHGLHVIIGTTFLMVCLMRQLKYHFTSKHHFGFEAAA 201

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ ++  +Y  G
Sbjct: 202 WYWHFVDVVWLFLYVSIYWWG 222


>gi|261404604|ref|YP_003240845.1| cytochrome-c oxidase [Paenibacillus sp. Y412MC10]
 gi|329923617|ref|ZP_08279061.1| cytochrome C oxidase, subunit 3 [Paenibacillus sp. HGF5]
 gi|261281067|gb|ACX63038.1| Cytochrome-c oxidase [Paenibacillus sp. Y412MC10]
 gi|328941170|gb|EGG37469.1| cytochrome C oxidase, subunit 3 [Paenibacillus sp. HGF5]
          Length = 206

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 67/194 (34%), Positives = 113/194 (58%), Gaps = 2/194 (1%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            + +++ ++     LGFW++L  + ++F   F T+  L      GP   ++F +     +
Sbjct: 13  HEPEKATLEGRNKVLGFWLFLGGEAVLFGTLFATFLALRGQNNEGPTAAELFSLPITAAA 72

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI-SMEAVP 136
           T++LL+SSL+  FA+ A      I K   WL+VT   G+ F+ +EIYEF   +       
Sbjct: 73  TLILLVSSLTSVFAIQALHRHN-IEKLKLWLIVTVVLGLGFLGLEIYEFYEYVVHESFNM 131

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
           + SAF S+F+ LVG HG HV FG++W+ +L+ Q+ +KGL      ++   +M+WHF+D++
Sbjct: 132 KTSAFSSAFYTLVGFHGAHVAFGVVWISLLIAQLYRKGLTVVTAPKVYVSAMYWHFIDVV 191

Query: 197 WICVFSFVYLMGVV 210
           W+ +FS VYL+G V
Sbjct: 192 WVFIFSVVYLLGKV 205


>gi|89072119|ref|ZP_01158715.1| cytochrome o ubiquinol oxidase, subunit III [Photobacterium sp.
           SKA34]
 gi|89052220|gb|EAR57671.1| cytochrome o ubiquinol oxidase, subunit III [Photobacterium sp.
           SKA34]
          Length = 198

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 96/192 (50%), Positives = 123/192 (64%), Gaps = 2/192 (1%)

Query: 20  KKESCVDHDGTY-LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
            + +  D  G    GFWIYLMSDC++FA  F TYAVL  +  AGP   D+F++  +FV T
Sbjct: 8   HEHTHHDTTGIKLFGFWIYLMSDCVLFATLFATYAVLESSSIAGPTGQDIFELPFVFVET 67

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           ++LL SS++  F M++    ++       L VT   G+ FI ME+YEF HLI     PQ 
Sbjct: 68  MLLLFSSITFGFGMISMKRNKITVFKRW-LQVTFLLGLSFICMELYEFHHLIENGNGPQG 126

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAFLS+FF LVG HGLHV FGLIW+ V   Q+  KGL      R  CLS+FWHFLD++WI
Sbjct: 127 SAFLSAFFTLVGTHGLHVTFGLIWMVVCYQQLSSKGLTENMSMRFQCLSLFWHFLDIVWI 186

Query: 199 CVFSFVYLMGVV 210
           CVF+ VYLMGV+
Sbjct: 187 CVFTIVYLMGVM 198


>gi|83747512|ref|ZP_00944550.1| Cytochrome O ubiquinol oxidase subunit III [Ralstonia solanacearum
           UW551]
 gi|83725826|gb|EAP72966.1| Cytochrome O ubiquinol oxidase subunit III [Ralstonia solanacearum
           UW551]
          Length = 211

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 89/179 (49%), Positives = 120/179 (67%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
            GFW+YLMSD ++FA  F T+ VL    A GP   ++FD+S + + T +LL+SS++    
Sbjct: 34  FGFWVYLMSDLILFASLFATFCVLRSATAGGPNGKELFDLSYVLIETGILLVSSITYGMV 93

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           M+   + R   + + WL +T   G  F+ MEI EF HLI+  A P RSAFLSSFF LVG 
Sbjct: 94  MIGLQSGR-KDQVMLWLGITFLLGAAFVGMEINEFHHLIAEGAGPSRSAFLSSFFTLVGT 152

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HGLHV  GL+W+ VL+ QI +KGL + N  RL CLS+FWHFLD++WI VF+ VYL+G +
Sbjct: 153 HGLHVASGLLWIAVLMWQISRKGLTATNSTRLACLSLFWHFLDVVWIGVFTVVYLLGAM 211


>gi|118196943|emb|CAL37040.1| cytochrome oxidase subunit 3 [Eunectes notaeus]
          Length = 261

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 40/198 (20%), Positives = 76/198 (38%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA------AGPAPIDVFD 70
                 +         G  ++++S+   F  FF T   +    A        P  I   +
Sbjct: 66  TYQGHHTKGVQKNMRYGMMLFIVSEVFFFLGFFWTLYHVSLVPAPELGAEWPPTGILPLN 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +       +    L++T   G+ F  +++ E+    
Sbjct: 126 PFEVPLLNTAVLLSSGATITWSHHTMMSGNKKEATYALMITVALGIYFTALQLSEYM--- 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L + + +++K    + +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMIGTTFLMICLGRLIKFHFTTTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ +F  VY  G
Sbjct: 243 HFVDVVWLFLFVSVYWWG 260


>gi|327441188|dbj|BAK17553.1| heme/copper-type cytochrome/quinol oxidase, subunit 3 [Solibacillus
           silvestris StLB046]
          Length = 208

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 73/197 (37%), Positives = 117/197 (59%), Gaps = 3/197 (1%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAG--PAPIDVFDISG 73
           + K  +++ ++     +G WI+L SD ++FA  F TY  L  +  AG   A  D++++  
Sbjct: 12  WPKHPEQATMEGKNKLVGLWIFLASDTVLFASVFATYIALKDSGPAGMEFAAKDLYELPL 71

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
            FV T++LL SSL+  +AM             +W+ +T   G+ F+ +EIYEF H + + 
Sbjct: 72  AFVMTMLLLTSSLTSVYAMYHMRNFNYS-GVRTWMGITVLLGLGFLALEIYEFQHYVHIG 130

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
               +SAF S+FF LVG+HGLHV  GL+W+  L+I+   +GL   N  +    S++WHF+
Sbjct: 131 FGYTQSAFSSAFFTLVGMHGLHVIIGLVWITGLIIRNSSRGLNLYNAPKFFAASLYWHFI 190

Query: 194 DLIWICVFSFVYLMGVV 210
           D++W+ +F+ VYLMGVV
Sbjct: 191 DVVWVFIFTVVYLMGVV 207


>gi|264681191|ref|YP_003289034.1| cytochrome c oxidase subunit III [Micrurus fulvius]
 gi|262073520|gb|ACY09614.1| cytochrome c oxidase subunit III [Micrurus fulvius]
          Length = 261

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 44/198 (22%), Positives = 75/198 (37%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYA----AGPAPIDVFD 70
                 +         G  +++ S+   F  FF    +  L           PA I+  D
Sbjct: 66  TYQGHHTKGVQKNMRYGMILFITSEVFFFLGFFWALYHVSLVPTPELGATWPPAGINPLD 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       S       +    LL+T   GM F  +++ E+    
Sbjct: 126 PMEVPLLNTAVLLSSGATITWSHHSLMVGNKKEATRALLITIMLGMYFTDLQLSEYKD-- 183

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L V ++++ +      +         +W
Sbjct: 184 -TSFTISDSVYGSLFFVATGFHGLHVMIGTSFLLVCLVRLARSHFTMTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D+IW+ ++  VY  G
Sbjct: 243 HFVDIIWLFLYISVYWWG 260


>gi|74487330|ref|YP_313674.1| cytochrome c oxidase subunit III [Ovophis okinavensis]
 gi|73760179|dbj|BAE19981.1| cytochrome oxidase [Ovophis okinavensis]
          Length = 261

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 38/198 (19%), Positives = 76/198 (38%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF T   +             P  I+  +
Sbjct: 66  TYQGHHTPGVQKNMRYGMILFITSEVFFFLGFFWTLYHVSLVPTPELGAEWPPTGINPLN 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +  K    +    L++T   G+ F  +++ E+    
Sbjct: 126 PMDVPLLNTAVLLSSGATITWSHHALMKGNKKEATYALMITIILGVYFTALQVSEYM--- 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L + ++++++      +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMIGTSFLTICLMRLIRFHFTMTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDIVWLFLYVSVYWWG 260


>gi|57281954|emb|CAD19464.1| cytochrome oxidase subunit 3 [Colchicum persicum]
          Length = 265

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 82/199 (41%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDIS 72
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGISVLDPR 130

Query: 73  -GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A   ++   + V  L+ T    ++    +  E+     
Sbjct: 131 KIPFLNTPILPSSGAAVTWAHHAILARKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF+  G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFSATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWGGGI 265


>gi|312962954|ref|ZP_07777440.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas
           fluorescens WH6]
 gi|311282723|gb|EFQ61318.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas
           fluorescens WH6]
          Length = 208

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 95/181 (52%), Positives = 123/181 (67%), Gaps = 1/181 (0%)

Query: 30  TYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCS 89
           T  GFW+YLM+DC++FA  F  YAVL  N A GP+  D+F++  +   T +LL SS++  
Sbjct: 29  TVFGFWLYLMTDCILFASIFAVYAVLVNNVAGGPSGHDIFELPYVLGETALLLFSSITYG 88

Query: 90  FAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALV 149
           FAMLA   K      +SWL +T  FG+ FI MEI EF  LIS    P RS FLS+FF LV
Sbjct: 89  FAMLAF-YKGNKKGVLSWLGLTFLFGLGFIGMEINEFHLLISEGYGPHRSGFLSAFFTLV 147

Query: 150 GLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGV 209
           G HGLHV  GL+W+ V++ Q+ K GL + N+ RL CLS+FWHFLD++WICVF+ VYLMG 
Sbjct: 148 GTHGLHVSAGLLWMAVMMYQVNKHGLTNTNKTRLSCLSLFWHFLDVVWICVFTVVYLMGT 207

Query: 210 V 210
           +
Sbjct: 208 L 208


>gi|167563462|ref|ZP_02356378.1| ubiquinol oxidase, subunit III [Burkholderia oklahomensis EO147]
 gi|167570630|ref|ZP_02363504.1| ubiquinol oxidase, subunit III [Burkholderia oklahomensis C6786]
          Length = 201

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 99/200 (49%), Positives = 128/200 (64%), Gaps = 5/200 (2%)

Query: 12  FSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDI 71
             L +             +  GFW+YLM+DC++FA  F T+AVLG  +A GP   D+FDI
Sbjct: 6   MMLDHAASHDHPP---SHSVFGFWLYLMTDCIVFAALFATFAVLGNQFAGGPTGKDLFDI 62

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
            G+ + T  LLLSS++  FAM+ +   R       WL VT   G  F+ ME+ EF+HLI+
Sbjct: 63  PGVALETAALLLSSITYGFAMIGAHK-RRRGAVFGWLAVTFVLGAAFLAMELREFSHLIA 121

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG-LISGNQRRLICLSMFW 190
             A PQRSAFLSSFF LVG HGLHV  GL+W+ VL +Q L++  L   + RRL CLS+FW
Sbjct: 122 EGAGPQRSAFLSSFFTLVGTHGLHVTAGLVWMVVLALQALRRPELTERDVRRLTCLSLFW 181

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD++WICVFSFVYL  V+
Sbjct: 182 HFLDIVWICVFSFVYLASVI 201


>gi|53719987|ref|YP_108973.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           pseudomallei K96243]
 gi|167816683|ref|ZP_02448363.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           pseudomallei 91]
 gi|167903560|ref|ZP_02490765.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           pseudomallei NCTC 13177]
 gi|217421180|ref|ZP_03452685.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia
           pseudomallei 576]
 gi|52210401|emb|CAH36382.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           pseudomallei K96243]
 gi|217396592|gb|EEC36609.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia
           pseudomallei 576]
          Length = 201

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 99/200 (49%), Positives = 130/200 (65%), Gaps = 5/200 (2%)

Query: 12  FSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDI 71
            +L +             +  GFW+YLM+DC++FA  F T+AVLG  +A GP   D+FDI
Sbjct: 6   MTLDHAASHDHPP---SHSVFGFWLYLMTDCVLFAALFATFAVLGNQFAGGPTAKDLFDI 62

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
            G+ + T  LLLSS++  FAM+ +  +R       WL VT   G  F+ ME+ EF+HL++
Sbjct: 63  PGVALETAALLLSSITYGFAMIGAH-QRRRGAVFGWLAVTFVLGAAFLAMELREFSHLVA 121

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG-LISGNQRRLICLSMFW 190
             A PQRSAFLSSFF LVG HGLHV  GL+W+ VLV Q L++  L   + RRL CLS+FW
Sbjct: 122 EGAGPQRSAFLSSFFTLVGTHGLHVTAGLVWMAVLVAQALRRPELTERDIRRLTCLSLFW 181

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD++WICVFSFVYL  V+
Sbjct: 182 HFLDIVWICVFSFVYLASVI 201


>gi|323649901|ref|YP_004237274.1| cytochrome c oxidase subunit 3 [Ricinus communis]
 gi|322394281|gb|ADW96038.1| cytochrome c oxidase subunit 3 [Ricinus communis]
          Length = 265

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 45/199 (22%), Positives = 83/199 (41%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDIS 72
           +   + V   G   GF  +++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKVVQLGPRYGFIPFIVSEVMFLFAFFWASFHSSLAPTVEIGGIWPPKGIGVLDPW 130

Query: 73  -GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +LL S  + ++A  A    +   + V  L+ T    ++F   +  E+     
Sbjct: 131 EIPFLNTPILLSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVFTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                  S + S+FF   G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APFTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ + +F  +Y  G +
Sbjct: 247 FVDVVRLFLFVSIYWWGGI 265


>gi|57281948|emb|CAD19461.1| cytochrome oxidase subunit 3 [Serapias vomeracea]
          Length = 265

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 81/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDIS 72
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V +  
Sbjct: 71  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLNPW 130

Query: 73  -GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++F   +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVFTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSLYGSTFFLATGFHGFHVIIGTLFLIICCIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|76780588|emb|CAD92024.1| cytochrome oxidase subunit 3 [Burchardia rosea]
          Length = 265

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 81/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGISVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHAILAGKDK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF+  G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFSATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWGGGI 265


>gi|212725557|ref|YP_002317304.1| cytochrome c oxidase subunit III [Achalinus meiguensis]
 gi|211997654|gb|ACJ14782.1| cytochrome c oxidase subunit III [Achalinus meiguensis]
          Length = 261

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 37/197 (18%), Positives = 69/197 (35%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAGPAPIDVFDISG--- 73
               +         G  +++ S+   F  FF T  +  L      G              
Sbjct: 68  QGHHTKGVQKNMRYGMALFITSEVFFFLGFFWTLYHVSLVPTPELGAEWPPTGITPLNPL 127

Query: 74  --IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T VLL S  + +++  A         T+           +       + +    
Sbjct: 128 EVPLLNTAVLLSSGATVTWSHHALMKGDKKESTI----ALLATIALGAYFTALQLSEYKE 183

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                  S + S FF   G HGLHV  G ++L V +++++     + +         +WH
Sbjct: 184 TPFTISDSVYGSLFFVATGFHGLHVMIGTLFLTVCLVRLINFHFTTTHHFGYEAAIWYWH 243

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++W+ +F  VY  G
Sbjct: 244 FVDIVWLFLFISVYWWG 260


>gi|52221031|ref|YP_086886.1| cytochrome c oxidase subunit III [Geocalamus acutus]
 gi|47026719|gb|AAT08535.1| cytochrome c oxidase subunit III [Geocalamus acutus]
 gi|121309382|dbj|BAF43998.1| cytochrome oxidase subunit 3 [Geocalamus acutus]
          Length = 261

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 38/194 (19%), Positives = 72/194 (37%), Gaps = 11/194 (5%)

Query: 22  ESCVDHDGTYLGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAGPAPIDVFDISG-----I 74
            +     G   G  +++ S+ L F  FF  +  + L   +  G        I        
Sbjct: 71  HTPSVQRGLRYGMALFITSEVLFFIGFFWAFYHSSLAPTHELGNQWPPSGIIPLNPLEVP 130

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            ++T VLL S ++ ++A  A                     ++ +     +         
Sbjct: 131 LLNTAVLLASGVTVTWAHHAIMAGMRKEAV----QGLLLTALLGLYFTALQAMEYYEAPF 186

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
               S + S+FF   G HGLHV  G  +L V + + L     + +       + +WHF+D
Sbjct: 187 TISDSTYGSTFFVATGFHGLHVIIGTSFLLVCLWRQLNYHFTTHHHFGFEAAAWYWHFVD 246

Query: 195 LIWICVFSFVYLMG 208
           ++W+ ++  +Y  G
Sbjct: 247 VVWLFLYISIYWWG 260


>gi|76780578|emb|CAD92019.1| cytochrome oxidase subunit 3 [Lomandra ordii]
          Length = 265

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 80/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGYHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWANHAILAGKEK-RAVYALIATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|148254208|ref|YP_001238793.1| cytochrome o ubiquinol oxidase subunit III [Bradyrhizobium sp.
           BTAi1]
 gi|146406381|gb|ABQ34887.1| cytochrome bb3 quinol oxidase subunit 3 [Bradyrhizobium sp. BTAi1]
          Length = 213

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 85/215 (39%), Positives = 125/215 (58%), Gaps = 12/215 (5%)

Query: 1   MSRQKIGKSPNFSLFYVKDKKESCVDHDG-------TYLGFWIYLMSDCLMFAVFFVTYA 53
           MS   + ++P     Y         +HDG       T  GFWI+L+SD +MF+ FF ++A
Sbjct: 1   MSVSAVEQAPA----YADPHHLRAAEHDGPAPKRIVTGYGFWIFLLSDIVMFSCFFASFA 56

Query: 54  VLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAF 113
           VL K  A GP   ++FDI  + + T +LL+SS +C  A +A+     +   V+       
Sbjct: 57  VLSKATAGGPGGAELFDIRNVAIETALLLVSSFACGMASIAAERHSALWFQVAMAATGLL 116

Query: 114 FGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKK 173
            G  F+++E  EF  L+     P RSAFLS+FF LVG HGLHV  GL+WL  ++ Q++ K
Sbjct: 117 -GAGFLLLEAREFTDLVGRGDGPSRSAFLSAFFTLVGCHGLHVGAGLLWLLTMMAQVMTK 175

Query: 174 GLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           G  +  +RR++C ++FWH LD+IW+ VFS VYL+G
Sbjct: 176 GFRADIERRILCFALFWHALDIIWVAVFSVVYLLG 210


>gi|291612393|ref|YP_003540864.1| cytochrome c oxidase subunit III [Hypsiglena slevini]
 gi|189164449|gb|ACD77387.1| cytochrome c oxidase subunit III [Hypsiglena slevini]
          Length = 261

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 39/198 (19%), Positives = 74/198 (37%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF     +             P  I   D
Sbjct: 66  TYQGHHTKGVQKNMRYGMMLFITSEVFFFLGFFWALYHVSLVPTPELGAEWPPTGITPLD 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +  K    +    L+ T   G+ F  +++ E+   +
Sbjct: 126 PMEVPLLNTTVLLSSGATITWSHHTMMKGNKKEATYALMATIMLGVYFTALQMSEY---L 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L V +++++     + +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMIGTSFLTVCILRLIMHHFTTTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDIVWLFLYISVYWWG 260


>gi|76780582|emb|CAD92021.1| cytochrome oxidase subunit 3 [Polygonatum hookeri]
          Length = 265

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 42/199 (21%), Positives = 80/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  +++ S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGPRYGSILFIASEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L LS  + ++A  A    +   + V  L  T    ++    +  E+     
Sbjct: 131 EIPFLNTPILPLSGAAVTWAHHAILAGKEK-RAVYALRATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F+ +Y  G +
Sbjct: 247 FVDVVRLFPFASIYWGGGI 265


>gi|74310579|ref|YP_313700.1| cytochrome c oxidase subunit III [Python regius]
 gi|73760207|dbj|BAE20007.1| cytochrome oxidase subunit 3 [Python regius]
          Length = 261

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 38/196 (19%), Positives = 74/196 (37%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +         G  ++++S+   F  FF T   +             P  I   +  
Sbjct: 68  QGHHTKGVQKNMRYGMMLFIVSEVFFFLGFFWTLYHVSLVPTPELGAEWPPTGITPLNPL 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LLSS +       +  +    +    L++T   G+ F  +++ E+      
Sbjct: 128 EVPLLNTAVLLSSGATVTWSHHATMQGNKKEATYALMITIALGIYFTALQLSEYM---ET 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                 S + S FF   G HG HV  G  +L V + +++     + +         +WHF
Sbjct: 185 PFTISDSVYGSLFFVATGFHGFHVMIGTTFLMVCLARLINFHFTTSHHFGYEAAIWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ +F  VY  G
Sbjct: 245 VDVVWLFLFVSVYWWG 260


>gi|15226079|ref|NP_178782.1| cytochrome c oxidase subunit 3 [Arabidopsis thaliana]
 gi|26556997|ref|NP_085532.2| cytochrome c oxidase subunit 3 [Arabidopsis thaliana]
 gi|15215914|emb|CAA69818.3| cytochrome c oxidase subunit 3 [Arabidopsis thaliana]
 gi|20198123|gb|AAM15412.1| hypothetical protein [Arabidopsis thaliana]
 gi|330250984|gb|AEC06078.1| cytochrome c oxidase subunit 3 [Arabidopsis thaliana]
          Length = 265

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 43/199 (21%), Positives = 85/199 (42%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAV--FFVTYAVLGKNYAAG----PAPIDVFDIS 72
           +   + V   G   G  ++++S+ + F    +  +++ L      G    P  I+V D  
Sbjct: 71  EGHHTKVVQLGPRYGSILFIVSEVMFFFAFFWASSHSSLAPAVEIGGIWPPKGIEVLDPW 130

Query: 73  -GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++F   +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVLLALVFTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                  S + S+FF   G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APFTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++W+ +F  +Y  G +
Sbjct: 247 FVDVVWLFLFVSIYWWGGI 265


>gi|76780574|emb|CAD92017.1| cytochrome oxidase subunit 3 [Johnsonia pubescens]
          Length = 265

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 80/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALIATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWGGGI 265


>gi|209886932|ref|YP_002290785.1| cytochrome c oxidase subunit III [Gloydius blomhoffi brevicaudus]
 gi|194395436|gb|ACF60273.1| cytochrome c oxidase subunit III [Gloydius blomhoffi brevicaudus]
          Length = 261

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 39/198 (19%), Positives = 75/198 (37%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF T   +             P  I   +
Sbjct: 66  TYQGHHTLGVQKNMRYGMILFITSEVFFFLGFFWTLYHVSLVPTPELGAEWPPTGIYPLN 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +  K    +    L +T   G+ F  +++ E+A   
Sbjct: 126 PMDVPLLNTAVLLSSGATITWSHHTMMKGNKKEATYALAITIVLGIYFTALQVSEYA--- 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L + + ++++    + +         +W
Sbjct: 183 ETPFTIPDSVYGSLFFVATGFHGLHVMIGTSFLMICLARLIQYHFTTTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDIVWLFLYVSVYWWG 260


>gi|312881377|ref|ZP_07741174.1| cytochrome o ubiquinol oxidase subunit III [Vibrio caribbenthicus
           ATCC BAA-2122]
 gi|309371017|gb|EFP98472.1| cytochrome o ubiquinol oxidase subunit III [Vibrio caribbenthicus
           ATCC BAA-2122]
          Length = 199

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 96/182 (52%), Positives = 118/182 (64%), Gaps = 1/182 (0%)

Query: 29  GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSC 88
               GFWIYLMSDC++FA  F TYAVL     +GP   D+F++  +FV T++LL SS++ 
Sbjct: 19  NKLFGFWIYLMSDCILFATLFATYAVLETGSISGPTGKDIFELPFVFVETMLLLFSSITF 78

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            F M+A      I     W+ VT   G+ FI MEIYEF HLI     PQ SAFLS+FF L
Sbjct: 79  GFGMIAMKRND-IAGLKRWMKVTFLLGVGFIAMEIYEFHHLIEAGYGPQESAFLSAFFTL 137

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           VG HGLHV FGL+WL V   Q+  KGL      R  CLS+FWHFLD++WICVF+ VYLMG
Sbjct: 138 VGTHGLHVTFGLVWLAVCYHQLSTKGLNENMAMRFSCLSLFWHFLDIVWICVFTIVYLMG 197

Query: 209 VV 210
           V+
Sbjct: 198 VM 199


>gi|57282275|emb|CAD32366.1| cytochrome oxidase subunit 3 [Philesia magellanica]
          Length = 265

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 80/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWGGGI 265


>gi|296492463|gb|ADH29759.1| cytochrome c oxidase subunit III [Peromyscus maniculatus]
          Length = 255

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 39/201 (19%), Positives = 80/201 (39%), Gaps = 15/201 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPID 67
                 + +   G   G  ++++S+             +    T+ + G     G  P++
Sbjct: 60  TYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLAPTHDLGGCWPPTGITPLN 119

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
             ++    ++T VLL S +S ++A  +        K  +         ++ I   I + +
Sbjct: 120 PLEVP--LLNTSVLLASGVSITWAHHSLMEG----KRNNMNQALLITILLGIYFTILQAS 173

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
                        + S+FF   G HGLHV  G  +L V +++ LK    S +       +
Sbjct: 174 EYFETPFSISDGIYGSTFFMATGFHGLHVIIGTTFLMVCLLRQLKYHFTSKHHFGFEAAA 233

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ ++  +Y  G
Sbjct: 234 WYWHFVDVVWLFLYVSIYWWG 254


>gi|301353294|ref|YP_003795367.1| cytochrome c oxidase subunit III [Anilius scytale]
 gi|226446133|gb|ACO58427.1| cytochrome c oxidase subunit 3 [Anilius scytale]
          Length = 261

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 38/198 (19%), Positives = 76/198 (38%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF     +             P  I   +
Sbjct: 66  TYQGHHTTGVQKNMRYGMMLFITSEVFFFLGFFWALYHVSLVPTPELGAEWPPTGISPLN 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +  K    +    L++T   G+ F ++++ E+    
Sbjct: 126 PFEVPLLNTAVLLSSGATITWSHHTMMKGNKKEATYALMITVALGVYFTLLQLSEYM--- 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G ++L   + ++++    + +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMIGTLFLITCLTRLIQYHFTTTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ +F+ VY  G
Sbjct: 243 HFVDVVWLFLFASVYWWG 260


>gi|76780590|emb|CAD92025.1| cytochrome oxidase subunit 3 [Uvularia perfoliata]
          Length = 265

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 81/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGYHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWANHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF+  G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFSATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|15615176|ref|NP_243479.1| cytochrome caa3 oxidase (subunit III) [Bacillus halodurans C-125]
 gi|10175234|dbj|BAB06332.1| cytochrome caa3 oxidase (subunit III) [Bacillus halodurans C-125]
          Length = 206

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 72/193 (37%), Positives = 112/193 (58%), Gaps = 2/193 (1%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
             + + ++    +LGFW +L  + ++FA FF TY  L    A GP P D+F +  +F+ T
Sbjct: 14  HPERATLEGKNKFLGFWFFLGGETILFATFFGTYLGLRSGTADGPLPQDIFALPLVFIMT 73

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME-AVPQ 137
           ++LL SSL+   A +A+  K        W+ +T   G+ F+  EIYEF   +        
Sbjct: 74  MLLLTSSLTSVIA-MAAMKKNKFGAMKLWMWITVLLGLGFLGFEIYEFYEYVHHYELGFS 132

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
            SAF SSF++LVGLHG HV FGL W+  L+I+  + G+   N  +    S++WHF+D++W
Sbjct: 133 TSAFASSFYSLVGLHGAHVAFGLSWIITLLIRYNRSGITLTNAPKFYVASLYWHFIDVVW 192

Query: 198 ICVFSFVYLMGVV 210
           + +F+ VYLMGV+
Sbjct: 193 VFIFTVVYLMGVL 205


>gi|114561410|ref|YP_748923.1| cytochrome c oxidase, subunit III [Shewanella frigidimarina NCIMB
           400]
 gi|114332703|gb|ABI70085.1| cytochrome c oxidase, subunit III [Shewanella frigidimarina NCIMB
           400]
          Length = 211

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 92/182 (50%), Positives = 129/182 (70%), Gaps = 1/182 (0%)

Query: 29  GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSC 88
            T  GFWIYLM+DC++FA  F TYAVL  N   G +  D+F++  + + T  LL+SS++ 
Sbjct: 31  NTLFGFWIYLMTDCILFASVFATYAVLFMNTDGGVSGKDIFELDFVLIETAALLVSSITY 90

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            FAM+ +   +    T+ WLL+T   G +FI ME+YEF HLI     P RSAFLS+FFAL
Sbjct: 91  GFAMICAR-HQKKAATLGWLLITFALGCVFIAMEVYEFHHLIEHGNGPDRSAFLSAFFAL 149

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           VG+HGLHV  GLIW+ ++++++LK GL + +  RL CLS+FWHFLD++W+CVF+ VYL+G
Sbjct: 150 VGMHGLHVTAGLIWMLIMMVEVLKTGLTNRSITRLSCLSLFWHFLDIVWVCVFTVVYLLG 209

Query: 209 VV 210
           V+
Sbjct: 210 VL 211


>gi|57281941|emb|CAD19457.1| cytochrome oxidase subunit 3 [Sansevieria trifasciata]
          Length = 265

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 80/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGYHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|57282263|emb|CAD32360.1| cytochrome oxidase subunit 3 [Luzuriaga radicans]
          Length = 265

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 81/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF+  G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFSATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWGGGI 265


>gi|70732358|ref|YP_262114.1| cytochrome o ubiquinol oxidase subunit III [Pseudomonas fluorescens
           Pf-5]
 gi|68346657|gb|AAY94263.1| cytochrome o ubiquinol oxidase, subunit III [Pseudomonas
           fluorescens Pf-5]
          Length = 208

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 93/184 (50%), Positives = 123/184 (66%), Gaps = 1/184 (0%)

Query: 27  HDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSL 86
            + T  GFW+YLM+DC++FA  F  YAVL  N A GP+  D+F++  +   T +LL SS+
Sbjct: 26  GEMTVFGFWLYLMTDCILFASIFAVYAVLVNNVAGGPSGHDIFELPYVLGETALLLFSSI 85

Query: 87  SCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFF 146
           +  FAMLA   +    + + WL +T  FG+ FI MEI EF  LIS    P RS FLS FF
Sbjct: 86  TYGFAMLAF-FRGNKKQVLGWLAMTFLFGLGFIGMEINEFHLLISEGYGPSRSGFLSGFF 144

Query: 147 ALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
            LVG HGLHV  GLIW+ +++ Q+ K GL + N+ RL CLS+FWHFLD++WICVF+ VYL
Sbjct: 145 TLVGTHGLHVTSGLIWMAIMMYQVQKNGLTATNKTRLSCLSLFWHFLDVVWICVFTVVYL 204

Query: 207 MGVV 210
           MG +
Sbjct: 205 MGTM 208


>gi|56751515|ref|YP_172216.1| cytochrome c oxidase subunit III [Synechococcus elongatus PCC 6301]
 gi|81301413|ref|YP_401621.1| cytochrome c oxidase subunit III [Synechococcus elongatus PCC 7942]
 gi|56686474|dbj|BAD79696.1| cytochrome c oxidase subunit III [Synechococcus elongatus PCC 6301]
 gi|81170294|gb|ABB58634.1| cytochrome c oxidase subunit III [Synechococcus elongatus PCC 7942]
          Length = 195

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 43/191 (22%), Positives = 89/191 (46%), Gaps = 5/191 (2%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
           K         D    G  ++L+++ ++F   F  Y       +     +   ++    ++
Sbjct: 9   KTHHLEEAHPDHRIFGLILFLVAEGMIFLGLFAAYLTFRAVNSLPAEQMPELELLIPAIN 68

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T +L+ SS     A  A     +      +  +TA  G++F++ +IYE++    +    +
Sbjct: 69  TTILISSSFVIHGAEDAIKQNNVK-AVQRYFGITALMGVVFLVGQIYEYSQ---LTFGLR 124

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISG-NQRRLICLSMFWHFLDLI 196
            + F S+F+AL G HGLHV  GL+ +  ++ +  +    S  +   +    ++WHF+D++
Sbjct: 125 DNLFASTFYALTGFHGLHVLVGLLAILAVLWRSRQPDYYSDQHHFGIEAAEIYWHFVDIV 184

Query: 197 WICVFSFVYLM 207
           WI +F  +YL+
Sbjct: 185 WIVLFVLLYLI 195


>gi|57282237|emb|CAD32347.1| cytochrome oxidase subunit 3 [Xanthorrhoea resinosa]
          Length = 265

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 80/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGYHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALIATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|76780592|emb|CAD92026.1| cytochrome oxidase subunit 3 [Paris quadrifolia]
          Length = 265

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 80/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L  T    ++    +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALAATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF+  G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFSATGFHGFHVIIGTLFLIICDIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWGGGI 265


>gi|239995159|ref|ZP_04715683.1| cytochrome o ubiquinol oxidase subunit III (Ubiquinol oxidase chain
           C) [Alteromonas macleodii ATCC 27126]
          Length = 205

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 93/183 (50%), Positives = 127/183 (69%), Gaps = 1/183 (0%)

Query: 28  DGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLS 87
           + T  GFW+YLM+DCL+FA FF TYAVL  N A G +  D+F+++ + V T  LLLSS++
Sbjct: 24  NNTVFGFWLYLMTDCLLFASFFATYAVLFMNTAGGVSGKDIFELNFVAVETAALLLSSIA 83

Query: 88  CSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFA 147
             FAM+ +  +      ++WL VT   G  FI ME+YEF HLI     PQ+SAFL++FF+
Sbjct: 84  FGFAMICAHRQN-KSGALAWLAVTWALGACFIGMEVYEFHHLIEHGNGPQQSAFLTAFFS 142

Query: 148 LVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           LVGLHGLHV  GLIW+ ++ I++ ++ L      RL CLS+FWHFLD++WICVF+ VYLM
Sbjct: 143 LVGLHGLHVTAGLIWMTIMFIEVTRRDLGEQTVTRLSCLSLFWHFLDIVWICVFTVVYLM 202

Query: 208 GVV 210
           G +
Sbjct: 203 GAM 205


>gi|254522775|ref|ZP_05134830.1| cytochrome o ubiquinol oxidase, subunit III [Stenotrophomonas sp.
           SKA14]
 gi|219720366|gb|EED38891.1| cytochrome o ubiquinol oxidase, subunit III [Stenotrophomonas sp.
           SKA14]
          Length = 212

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 91/184 (49%), Positives = 116/184 (63%), Gaps = 1/184 (0%)

Query: 27  HDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSL 86
              T  GFW+YLMSDCL+FA  F TY VL      GP   D+F++  +   T +LL SSL
Sbjct: 30  GGNTVFGFWVYLMSDCLIFASLFATYVVLSGGTDGGPGAKDLFELPFVAWETALLLTSSL 89

Query: 87  SCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFF 146
           +    M+A   K++    +  L +T   G  F+ ME++EF HLI     P RSAFLS+FF
Sbjct: 90  TFGLGMIAMHRKQMGQMYLW-LAITWLLGFGFMCMEVWEFQHLIHQGYGPDRSAFLSAFF 148

Query: 147 ALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
           ALVG HGLHV  GL+WL V+ +Q+ K GL   N+ R+ CLS+FWHFLDLIWI VFS VYL
Sbjct: 149 ALVGTHGLHVSAGLLWLLVMFVQLKKYGLTPTNKTRMACLSLFWHFLDLIWIGVFSVVYL 208

Query: 207 MGVV 210
            G +
Sbjct: 209 NGAL 212


>gi|57281921|emb|CAD19447.1| cytochrome oxidase subunit 3 [Asparagus sp. Quagliariello 16104]
 gi|57282219|emb|CAD32338.1| cytochrome oxidase subunit 3 [Tulbaghia alliacea]
 gi|57282221|emb|CAD32339.1| cytochrome oxidase subunit 3 [Agave americana]
 gi|57282223|emb|CAD32340.1| cytochrome oxidase subunit 3 [Yucca sp. Quagliariello 16107]
 gi|57282225|emb|CAD32341.1| cytochrome oxidase subunit 3 [Polianthes tuberosa]
 gi|57282229|emb|CAD32343.1| cytochrome oxidase subunit 3 [Anthericum liliago]
 gi|57282249|emb|CAD32353.1| cytochrome oxidase subunit 3 [Herreria salsaparilha]
          Length = 265

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 80/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGYHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|126453691|ref|YP_001067025.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 1106a]
 gi|167846590|ref|ZP_02472098.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei B7210]
 gi|237813134|ref|YP_002897585.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia
           pseudomallei MSHR346]
 gi|242315461|ref|ZP_04814477.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 1106b]
 gi|126227333|gb|ABN90873.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 1106a]
 gi|237505149|gb|ACQ97467.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia
           pseudomallei MSHR346]
 gi|242138700|gb|EES25102.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 1106b]
          Length = 201

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 99/200 (49%), Positives = 129/200 (64%), Gaps = 5/200 (2%)

Query: 12  FSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDI 71
             L +             +  GFW+YLM+DC++FA  F T+AVLG  +A GP   D+FDI
Sbjct: 6   MMLDHAASHDHPP---SHSVFGFWLYLMTDCVLFAALFATFAVLGNQFAGGPTAKDLFDI 62

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
            G+ + T  LLLSS++  FAM+ +  +R       WL VT   G  F+ ME+ EF+HL++
Sbjct: 63  PGVALETAALLLSSITYGFAMIGAH-QRRRGAVFGWLAVTFVLGAAFLAMELREFSHLVA 121

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKK-GLISGNQRRLICLSMFW 190
             A PQRSAFLSSFF LVG HGLHV  GL+W+ VLV Q L++  L   + RRL CLS+FW
Sbjct: 122 EGAGPQRSAFLSSFFTLVGTHGLHVTAGLVWMAVLVAQALRRPDLTERDIRRLTCLSLFW 181

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD++WICVFSFVYL  V+
Sbjct: 182 HFLDIVWICVFSFVYLASVI 201


>gi|1502349|emb|CAA92212.1| cytochrome oxidase subunit 3 [Magnolia grandiflora]
          Length = 265

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 38/199 (19%), Positives = 78/199 (39%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFF--VTYAVLGKNYAAG----PAPIDVFDI- 71
           +   + V   G   G   +++S+ +     F   +++ L      G    P  I V D  
Sbjct: 71  EGHHTKVVQLGPRYGSIPFIVSEVMFLFALFRASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +   S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTPIPPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+F +  G HG HV  G ++  +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFSSATGFHGFHVIIGTLFSIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|302632645|ref|YP_003848740.1| cytochrome c oxidase subunit III [Crotalus horridus]
 gi|302151286|gb|ADK97522.1| cytochrome c oxidase subunit III [Crotalus horridus]
          Length = 260

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 34/194 (17%), Positives = 67/194 (34%), Gaps = 2/194 (1%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAGPAPIDVFDISGI 74
                 +         G  +++ S+   F  FF T  +  L      G            
Sbjct: 66  TYQGHHTLGVQKNMRYGMILFITSEVFFFLGFFWTLYHVSLVPTPELGAEWPPTGINPLN 125

Query: 75  FVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEA 134
            +   +L  + L  S A + S    +               ++       + +  +    
Sbjct: 126 PMDVPLLNTAVLLSSGATITSHHTMMKGNKKEATYALMITIILGTYFTALQVSEYMETPF 185

Query: 135 VPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLD 194
               S + S FF   G HGLHV  G  +L + +I++++    + +         +WHF+D
Sbjct: 186 TISDSVYGSLFFVATGFHGLHVMIGTSFLLICLIRLIRFHFTTTHHFWYEAAIWYWHFVD 245

Query: 195 LIWICVFSFVYLMG 208
           ++W+ ++  VY  G
Sbjct: 246 IVWLFLYISVYWWG 259


>gi|81176513|ref|YP_398397.1| cox3 [Triticum aestivum]
 gi|13698|emb|CAA34071.1| unnamed protein product [Triticum aestivum]
 gi|78675237|dbj|BAE47662.1| cox3 [Triticum aestivum]
 gi|169649050|gb|ACA62611.1| cox3 [Triticum aestivum]
          Length = 265

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 40/199 (20%), Positives = 79/199 (39%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDIS 72
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPW 130

Query: 73  -GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPLLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++L V  I+     +   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFLATGFHGFHVIIGTLFLIVCGIRQYLGQMTKKHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|209886918|ref|YP_002290772.1| cytochrome c oxidase subunit III [Naja atra]
 gi|194395408|gb|ACF60247.1| cytochrome c oxidase subunit III [Naja atra]
          Length = 261

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 38/198 (19%), Positives = 75/198 (37%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF     +             P  I+  +
Sbjct: 66  TYQGHHTEGVQMNMRYGMILFITSEVFFFLGFFWALYHVSLVPTPELGAEWPPTGINPLN 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +  K    + +  L++T   G+ F  +++ E+    
Sbjct: 126 PMEVPLLNTAVLLSSGATITWSHHTLMKGNKKEAIYALIITVVLGVYFTALQLSEYQ--- 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L V ++++ +      +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMIGTSFLLVCLMRMTRSHFTMTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDVVWLFLYISVYWWG 260


>gi|194364920|ref|YP_002027530.1| cytochrome o ubiquinol oxidase subunit III [Stenotrophomonas
           maltophilia R551-3]
 gi|194347724|gb|ACF50847.1| cytochrome o ubiquinol oxidase, subunit III [Stenotrophomonas
           maltophilia R551-3]
          Length = 212

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 91/184 (49%), Positives = 116/184 (63%), Gaps = 1/184 (0%)

Query: 27  HDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSL 86
              T  GFW+YLMSDCL+FA  F TY VL      GP   D+F++  +   T +LL SSL
Sbjct: 30  GGNTVFGFWVYLMSDCLIFASLFATYVVLAGGTDGGPTAKDLFELPFVAWETALLLTSSL 89

Query: 87  SCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFF 146
           +    M+A   K++    +  L +T   G  F+ ME++EF HLI     P RSAFLS+FF
Sbjct: 90  TFGLGMIAMHRKQMGQMYLW-LGITWLLGFGFMCMEVWEFQHLIHQGYGPDRSAFLSAFF 148

Query: 147 ALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
           ALVG HGLHV  GL+WL V+ +Q+ K GL   N+ R+ CLS+FWHFLDLIWI VFS VYL
Sbjct: 149 ALVGTHGLHVSAGLLWLLVMFVQLKKYGLTPTNKTRMACLSLFWHFLDLIWIGVFSVVYL 208

Query: 207 MGVV 210
            G +
Sbjct: 209 NGAL 212


>gi|190573373|ref|YP_001971218.1| putative quinol oxidase subunit 3 [Stenotrophomonas maltophilia
           K279a]
 gi|30351179|gb|AAP22950.1| cytochrome oxidase subunit III [Rhizobium arachis]
 gi|190011295|emb|CAQ44908.1| putative quinol oxidase subunit 3 [Stenotrophomonas maltophilia
           K279a]
          Length = 212

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 91/184 (49%), Positives = 116/184 (63%), Gaps = 1/184 (0%)

Query: 27  HDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSL 86
              T  GFW+YLMSDCL+FA  F TY VL      GP   D+F++  +   T +LL SSL
Sbjct: 30  GGNTVFGFWVYLMSDCLIFASLFATYVVLAGGTDGGPTAKDLFELPFVAWETALLLTSSL 89

Query: 87  SCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFF 146
           +    M+A   K++    +  L +T   G  F+ ME++EF HLI     P RSAFLS+FF
Sbjct: 90  TFGLGMIAMHRKQMGQMYLW-LGITWLLGFGFMCMEVWEFQHLIHQGYGPDRSAFLSAFF 148

Query: 147 ALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYL 206
           ALVG HGLHV  GL+WL V+ +Q+ K GL   N+ R+ CLS+FWHFLDLIWI VFS VYL
Sbjct: 149 ALVGTHGLHVSAGLLWLLVMFVQLKKYGLTPTNKTRMACLSLFWHFLDLIWIGVFSVVYL 208

Query: 207 MGVV 210
            G +
Sbjct: 209 NGAL 212


>gi|57281927|emb|CAD19450.1| cytochrome oxidase subunit 3 [Agapanthus africanus]
          Length = 265

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 81/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGYHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF+  G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFSATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|74310565|ref|YP_313713.1| cytochrome c oxidase subunit III [Acrochordus granulatus]
 gi|73760221|dbj|BAE20020.1| cytochrome oxidase subunit 3 [Acrochordus granulatus]
          Length = 261

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 77/196 (39%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               +         G  ++++S+   F  FF T   +             P  I   +  
Sbjct: 68  QGHHTKGVQKNMRYGMILFIVSEVFFFLGFFWTLYHVSLVPTPELGAEWPPTGITPLNPM 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LLSS +       + T     +    L++T   G+ F  +++ E+      
Sbjct: 128 EVPLLNTAVLLSSGATITWSHHTMTNGNKKEATYALMITIMLGIYFTTLQLSEYKD---T 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                 S + S FF   G HGLHV  G  +L + +I++++    + +         +WHF
Sbjct: 185 PFTISDSVYGSLFFVATGFHGLHVMIGTTFLIICLIRLIQFHFTTTHHFGYEAAIWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ +F  VY  G
Sbjct: 245 VDIVWLFLFISVYWWG 260


>gi|5835575|ref|NP_008425.1|COX3_13972 cytochrome c oxidase subunit III [Dinodon semicarinatus]
 gi|14194494|sp|O79552|COX3_DINSE RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|3582128|dbj|BAA33028.1| cytochrome oxidase subunit III [Dinodon semicarinatus]
          Length = 261

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/198 (19%), Positives = 71/198 (35%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF     +             P  I   +
Sbjct: 66  TYQGHHTSGVQKNMRYGMILFITSEVFFFLGFFWALYHVSLVPTPELGAEWPPIGITPLN 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +  K    +    L++T   G  F  +++ E+    
Sbjct: 126 PMEVPLLNTAVLLSSGATITWSHHTMMKGNKKEATHALMLTIILGAYFTALQLSEYM--- 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L V  +++ K      +         +W
Sbjct: 183 ETPFTIADSVYGSLFFVATGFHGLHVMIGTSFLMVCALRLAKHHFTITHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDIVWLFLYISVYWWG 260


>gi|164420844|ref|YP_001648793.1| cytochrome c oxidase subunit III [Naja naja]
 gi|84371456|gb|ABC55910.1| cytochrome oxidase subunit 3 [Naja naja]
          Length = 261

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 38/198 (19%), Positives = 75/198 (37%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF     +             P  I+  +
Sbjct: 66  TYQGHHTEGVQMNMRYGMILFITSEVFFFLGFFWALYHVSLVPTPELGAEWPPTGINPLN 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +  K    + +  L++T   G+ F  +++ E+    
Sbjct: 126 PMEVPLLNTAVLLSSGATITWSHHTLMKGNKKEAIYALIITVVLGVYFTALQLSEYQ--- 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L V ++++ +      +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMVGTSFLLVCLMRMTRSHFTMTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDVVWLFLYISVYWWG 260


>gi|126441942|ref|YP_001059740.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 668]
 gi|134277941|ref|ZP_01764656.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 305]
 gi|167744574|ref|ZP_02417348.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 14]
 gi|167895176|ref|ZP_02482578.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 7894]
 gi|167919810|ref|ZP_02506901.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei BCC215]
 gi|254184266|ref|ZP_04890856.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 1655]
 gi|126221435|gb|ABN84941.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia
           pseudomallei 668]
 gi|134251591|gb|EBA51670.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 305]
 gi|184214797|gb|EDU11840.1| ubiquinol oxidase, subunit III [Burkholderia pseudomallei 1655]
          Length = 201

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 99/200 (49%), Positives = 129/200 (64%), Gaps = 5/200 (2%)

Query: 12  FSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDI 71
             L +             +  GFW+YLM+DC++FA  F T+AVLG  +A GP   D+FDI
Sbjct: 6   MMLDHAASHDHPP---SHSVFGFWLYLMTDCVLFAALFATFAVLGNQFAGGPTAKDLFDI 62

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
            G+ + T  LLLSS++  FAM+ +  +R       WL VT   G  F+ ME+ EF+HL++
Sbjct: 63  PGVALETAALLLSSITYGFAMIGAH-QRRRGAVFGWLAVTFVLGAAFLAMELREFSHLVA 121

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG-LISGNQRRLICLSMFW 190
             A PQRSAFLSSFF LVG HGLHV  GL+W+ VLV Q L++  L   + RRL CLS+FW
Sbjct: 122 EGAGPQRSAFLSSFFTLVGTHGLHVTAGLVWMAVLVAQALRRPELTERDIRRLTCLSLFW 181

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD++WICVFSFVYL  V+
Sbjct: 182 HFLDIVWICVFSFVYLASVI 201


>gi|74310512|ref|YP_313687.1| cytochrome c oxidase subunit III [Boa constrictor]
 gi|73760193|dbj|BAE19994.1| unnamed protein product [Boa constrictor]
          Length = 261

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/198 (19%), Positives = 78/198 (39%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA------AGPAPIDVFD 70
                 +         G  ++++S+   F  FF T   +    A        PA +   +
Sbjct: 66  TYQGHHTKGVQKNMRYGMMLFIVSEVFFFLGFFWTLYHVSLVPAPELGAEWPPAGVAPLN 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LL+S +       +  K    ++   L++T   G+ F  +++ E+    
Sbjct: 126 PFEVPLLNTAVLLASGATVTWSHHALMKGNKKESTYALIITIALGVYFTALQLSEYM--- 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L + + +++     + +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMIGTTFLIICLGRLINFHFTTTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ +F  VY  G
Sbjct: 243 HFVDVVWLFLFVSVYWWG 260


>gi|115526744|ref|YP_783655.1| cytochrome c oxidase, subunit III [Rhodopseudomonas palustris
           BisA53]
 gi|115520691|gb|ABJ08675.1| cytochrome c oxidase, subunit III [Rhodopseudomonas palustris
           BisA53]
          Length = 285

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 40/205 (19%), Positives = 79/205 (38%), Gaps = 17/205 (8%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA--------------AGP 63
                S V       G  +++ S+ + F  +F  Y       A                P
Sbjct: 73  HKGDHSRVVQISHRYGMILFIASEVMFFVAWFWAYFNSALFPADPVHATREALFGGVWPP 132

Query: 64  APIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEI 123
             ++ FD   + +   ++LL+S +       +            L+ T   G++F  ++ 
Sbjct: 133 KGVETFDPWHLPLLNTLILLTSGTTVTWAHHALLNNDRKGLKWGLICTIALGVLFSCVQA 192

Query: 124 YEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRL 183
           YE++H          + + ++FF   G HG HV  G I+L V + + +            
Sbjct: 193 YEYSH---AAFSFAGNVYGATFFMATGFHGFHVLVGTIFLAVCLFRAMAGHFTPQQHLGF 249

Query: 184 ICLSMFWHFLDLIWICVFSFVYLMG 208
              + +WHF+D++W+ +F  +Y+ G
Sbjct: 250 EFAAWYWHFVDVVWLFLFVSIYVWG 274


>gi|262396850|ref|YP_003288703.1| cytochrome O ubiquinol oxidase subunit III [Vibrio sp. Ex25]
 gi|262340444|gb|ACY54238.1| cytochrome O ubiquinol oxidase subunit III [Vibrio sp. Ex25]
          Length = 200

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 96/182 (52%), Positives = 121/182 (66%), Gaps = 1/182 (0%)

Query: 29  GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSC 88
               GFW+YLMSDC++FA  F TYAVL  N  AGP   D+F++  +FV T++LL SS++ 
Sbjct: 20  NKLFGFWVYLMSDCVLFATLFATYAVLSSNSIAGPTGKDIFELPFVFVETMLLLFSSITF 79

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            F ++A      +     W+LVT  FG+ FI ME+YEF HLI     PQ SAFLS+FF L
Sbjct: 80  GFGIIAMKRNN-VAGLKRWMLVTFAFGLGFICMEVYEFHHLIEEGYGPQTSAFLSAFFTL 138

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           VG HGLHV FGLIWL V   Q+  KGL      R  CLS+FWHFLD++WICVF+ VYL+G
Sbjct: 139 VGTHGLHVTFGLIWLAVAYHQLSTKGLNDNMAMRFNCLSLFWHFLDIVWICVFTIVYLLG 198

Query: 209 VV 210
           V+
Sbjct: 199 VM 200


>gi|209886974|ref|YP_002290837.1| cytochrome c oxidase subunit III [Ophiophagus hannah]
 gi|194739383|gb|ACF94342.1| cytochrome c oxidase subunit III [Ophiophagus hannah]
          Length = 261

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 37/198 (18%), Positives = 72/198 (36%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF     +             P  I+  +
Sbjct: 66  AYQGHHTNGVQKNMRYGMILFITSEVFFFLGFFWALYHVSLVPTPELGAEWPPTGINPLN 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +  K    +    L +T   G+ F  +++ E+    
Sbjct: 126 PMEVPLLNTAVLLSSGATITWSHHTMMKGNKKEATYALAITISLGLYFTALQLSEYQ--- 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLH   G  +L V +++++       +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHAMIGTSFLMVCIVRLIHSHFTMTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDIVWLFLYISVYWWG 260


>gi|258510523|ref|YP_003183957.1| cytochrome c oxidase subunit III [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257477249|gb|ACV57568.1| cytochrome c oxidase subunit III [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 202

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 82/178 (46%), Positives = 118/178 (66%), Gaps = 1/178 (0%)

Query: 33  GFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFAM 92
           GFW++L +D L+F   F TY VL  +   GP PI +FDI G  + T  LL SS +   A 
Sbjct: 24  GFWVFLATDMLLFGCLFATYLVLRTHTDGGPTPIQIFDIPGFTLETFFLLTSSFTGGIAT 83

Query: 93  LASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGLH 152
            A  + R   +TVSW+LVT  FG+ FI++E  EFAH +++ A   RSAFLS+FF LVG H
Sbjct: 84  WAMRSGRQK-QTVSWMLVTMMFGLAFILLEATEFAHDVTVGATIGRSAFLSAFFTLVGTH 142

Query: 153 GLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           G HV  GL+W+F+ ++Q+LK G+     R++  ++++WHFLD++W+ +F+ VYL GVV
Sbjct: 143 GSHVSIGLVWMFLTMLQVLKHGITPQTARKVFVVNLYWHFLDVVWVFIFTVVYLSGVV 200


>gi|220920311|ref|YP_002495612.1| cytochrome c oxidase subunit III [Methylobacterium nodulans ORS
           2060]
 gi|219944917|gb|ACL55309.1| cytochrome c oxidase subunit III [Methylobacterium nodulans ORS
           2060]
          Length = 288

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 42/209 (20%), Positives = 80/209 (38%), Gaps = 17/209 (8%)

Query: 14  LFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA------------- 60
           +        + V       G  +++ S+ + F  +F  Y       A             
Sbjct: 72  VHEANTGDHTRVVQLHHRYGMMMFIASEVMFFVAWFWAYFDAALYAAEPIQASRLEFTGG 131

Query: 61  -AGPAPIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFI 119
              P  ++ FD   + +   ++LL+S +       +            L +T   G++F 
Sbjct: 132 TWPPKGVEAFDPWHLPLLNTLILLTSGTTITWAHHALLNNDRKGLKYGLWLTIILGVLFS 191

Query: 120 IMEIYEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGN 179
            ++ YE+AH          S + ++FF   G HG HV  G I+L V + +          
Sbjct: 192 CVQGYEYAH---AHFGFSGSIYSATFFMATGFHGAHVIIGTIFLSVCLYRAYLGHFTPRQ 248

Query: 180 QRRLICLSMFWHFLDLIWICVFSFVYLMG 208
                  + +WHF+D++W+ +FS +Y+ G
Sbjct: 249 HLGFEFAAWYWHFVDVVWLFLFSAIYVWG 277


>gi|319654011|ref|ZP_08008104.1| cytochrome c oxidase subunit III [Bacillus sp. 2_A_57_CT2]
 gi|317394333|gb|EFV75078.1| cytochrome c oxidase subunit III [Bacillus sp. 2_A_57_CT2]
          Length = 208

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 67/197 (34%), Positives = 111/197 (56%), Gaps = 3/197 (1%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPI--DVFDISG 73
           +    + + ++    +LGFW +L  + ++FA  F TY  L      G  P+  ++F +  
Sbjct: 12  WPTSPERATLEAKNKFLGFWFFLGGETVLFASLFATYLALKNKVPNGDHPLTNELFSMEI 71

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           +FV+T++LL+SSL+   AM          K   WL +T   G+ F+ +EIYEF       
Sbjct: 72  VFVATMLLLVSSLTSVCAMYHMKNFNFK-KMQLWLGITVLLGVAFLGLEIYEFTEYFHKG 130

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
                SAF S+F+ LVG HG HV FGL+W+  L+++  ++GL   N  +    S++WHF+
Sbjct: 131 HTFTSSAFGSAFYVLVGFHGAHVAFGLLWIVTLMVRNARRGLNLYNAPKFYVASLYWHFI 190

Query: 194 DLIWICVFSFVYLMGVV 210
           D++W+ +F+ VYLMG++
Sbjct: 191 DVVWVFIFTVVYLMGMI 207


>gi|226310781|ref|YP_002770675.1| quinol oxidase polypeptide III [Brevibacillus brevis NBRC 100599]
 gi|226093729|dbj|BAH42171.1| quinol oxidase polypeptide III [Brevibacillus brevis NBRC 100599]
          Length = 202

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 74/179 (41%), Positives = 120/179 (67%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI++++DC++F   F TYAV+  ++A GP   ++F + G+  ST +LL SS +   A
Sbjct: 25  LGFWIFVVTDCVLFGTLFATYAVMMNSFAGGPTGQELFQLPGVIASTFILLTSSFTSGLA 84

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +LA   K  + + + WL VT   G+ F+++E+ EF HL+S  A    S + S+F+ LVG 
Sbjct: 85  VLA-MNKGNVKQLIGWLAVTGLLGLSFVVLEVTEFMHLMSEGATMATSGYWSAFYTLVGT 143

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG+HV  GL W+  L+IQ+ ++G+ +  +R++   S++WHFLD++WI +F+ VYLMGV+
Sbjct: 144 HGVHVTVGLFWMTALMIQLKRRGISAVTRRKITNFSLYWHFLDVVWIFLFTVVYLMGVM 202


>gi|23098894|ref|NP_692360.1| cytochrome c oxidase subunit III [Oceanobacillus iheyensis HTE831]
 gi|22777121|dbj|BAC13395.1| cytochrome c oxidase subunit III (aa3 type) [Oceanobacillus
           iheyensis HTE831]
          Length = 208

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 72/195 (36%), Positives = 117/195 (60%), Gaps = 2/195 (1%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFV 76
            +D  ++ ++    +LG WI+L  + ++FA  F TY  L  + A GP+  D++ +  +F+
Sbjct: 14  TQDPSKATMEGKHKFLGLWIFLGGETVLFACLFGTYLALKDSTAGGPSTHDLYGLELVFL 73

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME-AV 135
            T++LL SSL+  +A+          K   W+ +TA  G+ F+  EIYEFAH I      
Sbjct: 74  MTVLLLTSSLTSVYAIYHMKNNDFK-KMQLWMGITAALGLAFLGFEIYEFAHYIHDYGFT 132

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
            + SAF S+F+ALVG HG HV FGL W+  L+++  K+GL   N  +    +++WHF+D+
Sbjct: 133 FRSSAFGSAFYALVGFHGGHVVFGLSWIITLMVRNAKRGLNLYNAPKYNTFALYWHFIDV 192

Query: 196 IWICVFSFVYLMGVV 210
           +W+ +F+ VYLMG+V
Sbjct: 193 VWVFIFTVVYLMGMV 207


>gi|117922464|ref|YP_871656.1| cytochrome c oxidase subunit III [Shewanella sp. ANA-3]
 gi|117614796|gb|ABK50250.1| cytochrome c oxidase, subunit III [Shewanella sp. ANA-3]
          Length = 206

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 94/206 (45%), Positives = 133/206 (64%), Gaps = 1/206 (0%)

Query: 5   KIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPA 64
            +    +  + + ++  E       T  GFW+YLM+DC++FA  F TYAVL  N   G +
Sbjct: 2   SVAIPADLEVAHAEEHHEHHDTGGNTLFGFWLYLMTDCILFASVFATYAVLYMNTDGGVS 61

Query: 65  PIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIY 124
             D+F++  + + T  LLLSS++  FA L  A +     T++WL +T   G +FI ME+Y
Sbjct: 62  GKDIFELDFVLIETAALLLSSITYGFA-LIFAKRHNKAATLTWLAITFALGCVFIGMEVY 120

Query: 125 EFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLI 184
           EF HLI     PQRSAFLSSFF LVG+HGLHV  GLIW+ +++I++ K GL + +  RL 
Sbjct: 121 EFHHLIEHGNGPQRSAFLSSFFTLVGMHGLHVTAGLIWMAIMMIEVAKTGLGNRSITRLS 180

Query: 185 CLSMFWHFLDLIWICVFSFVYLMGVV 210
           CLS+FWHFLD++WICVF+ VYL+G +
Sbjct: 181 CLSLFWHFLDIVWICVFTVVYLLGAL 206


>gi|308173456|ref|YP_003920161.1| cytochrome caa3 oxidase subunit III [Bacillus amyloliquefaciens DSM
           7]
 gi|307606320|emb|CBI42691.1| cytochrome caa3 oxidase (subunit III) [Bacillus amyloliquefaciens
           DSM 7]
 gi|328553615|gb|AEB24107.1| cytochrome c oxidase, subunit III [Bacillus amyloliquefaciens
           TA208]
 gi|328911591|gb|AEB63187.1| cytochrome caa3 oxidase (subunit III) [Bacillus amyloliquefaciens
           LL3]
          Length = 207

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 71/188 (37%), Positives = 113/188 (60%), Gaps = 2/188 (1%)

Query: 24  CVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLL 83
            ++    +LGFW++L  + ++FA  F T+  L ++ A GP+  D+F++  +F++T++LL 
Sbjct: 20  TLEGKNKFLGFWLFLGGETVLFASLFATFLALRESKAGGPSTADMFELPIVFIATMLLLT 79

Query: 84  SSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME-AVPQRSAFL 142
           SSL+  +AM          K   WLL+T   G  F+ +EIYEF H           SA  
Sbjct: 80  SSLTSVYAMYHMKNFSFK-KMQVWLLITVLLGAGFLGVEIYEFKHYTHEFGFTITSSALG 138

Query: 143 SSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFS 202
           S+F+ LVG HG HV FGL+W+  L+I+  K+GL   N  +    S++WHF+D++W+ +F+
Sbjct: 139 SAFYTLVGTHGAHVAFGLLWISALMIRNAKRGLSLYNAPKYYVASLYWHFIDVVWVFIFT 198

Query: 203 FVYLMGVV 210
            VYLMG+V
Sbjct: 199 VVYLMGMV 206


>gi|76780596|emb|CAD97445.1| cytochrome oxidase subunit III [Posidonia oceanica]
          Length = 265

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 42/199 (21%), Positives = 81/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFF--VTYAVLGKNYAAG----PAPIDVFDIS 72
           +   +     G   G  ++++S+ +     F    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGPRYGSILFIVSEVMFLFALFRASFHSSLAPTVEIGGIWPPKGIGVLDPW 130

Query: 73  -GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++F   +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHALLAGKEK-RAVYALVATVLLALVFTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF+  G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFSATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  VY  G +
Sbjct: 247 FVDVVRLFPFVSVYWWGGI 265


>gi|39933913|ref|NP_946189.1| cytochrome c oxidase subunit III [Rhodopseudomonas palustris
           CGA009]
 gi|192289332|ref|YP_001989937.1| cytochrome C oxidase subunit III [Rhodopseudomonas palustris TIE-1]
 gi|39647760|emb|CAE26280.1| cytochrome c oxidase subunit III [Rhodopseudomonas palustris
           CGA009]
 gi|192283081|gb|ACE99461.1| cytochrome c oxidase subunit III [Rhodopseudomonas palustris TIE-1]
          Length = 284

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 41/205 (20%), Positives = 79/205 (38%), Gaps = 17/205 (8%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA--------------AGP 63
                + V       G  +++ S+ + F  +F  Y       A                P
Sbjct: 73  YQHDHTRVVQLSHRYGMILFIASEVMFFVAWFWAYFNAALFPADPVHATREALFGGVWPP 132

Query: 64  APIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEI 123
             I+ FD   + +   ++LL+S +       +  +         L+ T   G  F  +++
Sbjct: 133 KGIETFDPWHLPLLNTLILLTSGTTVTWAHHALLQNDRKGLKQGLICTVLLGATFSCVQV 192

Query: 124 YEFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRL 183
           YE++H          + + ++FF   G HG HV  G I+L V +I+              
Sbjct: 193 YEYSH---ATFSFAGNIYGATFFMATGFHGFHVLVGTIFLLVCLIRAYAGHFTPKQHLGF 249

Query: 184 ICLSMFWHFLDLIWICVFSFVYLMG 208
              + +WHF+D++W+ +F  +Y+ G
Sbjct: 250 EFAAWYWHFVDVVWLFLFVCIYVWG 274


>gi|218453778|gb|ACK76656.1| cytochrome oxidase subunit III [Peromyscus maniculatus]
          Length = 253

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/201 (19%), Positives = 80/201 (39%), Gaps = 15/201 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPID 67
                 + +   G   G  ++++S+             +    T+ + G     G  P++
Sbjct: 58  TYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLAPTHDLGGCWPPTGITPLN 117

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
             ++    ++T VLL S +S ++A  +        K  +         ++ I   I + +
Sbjct: 118 PLEVP--LLNTSVLLASGVSITWAHHSLMEG----KRNNMNQALIITILLGIYFTILQAS 171

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
                        + S+FF   G HGLHV  G  +L V +++ LK    S +       +
Sbjct: 172 EYFETPFSISDGIYGSTFFMATGFHGLHVIIGTTFLMVCLLRQLKYHFTSKHHFGFEAAA 231

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ ++  +Y  G
Sbjct: 232 WYWHFVDVVWLFLYVSIYWWG 252


>gi|164421146|ref|YP_001648548.1| cytochrome c oxidase subunit III [Chondrilla aff. nucula CHOND]
 gi|158668107|gb|ABW76568.1| cytochrome c oxidase subunit 3 [Chondrilla aff. nucula CHOND]
          Length = 261

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 37/196 (18%), Positives = 77/196 (39%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA------AGPAPIDVFDIS 72
               + +   G   G  ++++S+  +F   F  +       A        P  ++  +  
Sbjct: 68  QGHHTFIVKQGLKYGMILFILSEVCLFFSLFWAFFHSSLAPAIEVGAIWPPRGVNPLNPW 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LLSS +       +       + +  L +T   G+ F  ++  E+      
Sbjct: 128 SVPLLNTAVLLSSGATVTWAHHAIISGKRKEXILGLFITVLLGIGFTGLQAMEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                 S + S+FF   G HG HV  G  +L V + +++       +       + +WHF
Sbjct: 185 PFTISDSVYGSTFFVTTGAHGGHVLIGSTFLLVCLFRLISHQFTRHHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ +F F+Y  G
Sbjct: 245 VDVVWLFLFIFMYWWG 260


>gi|218453800|gb|ACK76667.1| cytochrome oxidase subunit III [Peromyscus polionotus subgriseus]
          Length = 253

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/201 (19%), Positives = 80/201 (39%), Gaps = 15/201 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPID 67
                 + +   G   G  ++++S+             +    T+ + G     G  P++
Sbjct: 58  TYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLAPTHDLGGCWPPTGITPLN 117

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
             ++    ++T VLL S +S ++A  +        K  +         ++ I   I + +
Sbjct: 118 PLEVP--LLNTSVLLASGVSITWAHHSLMEG----KRSNMNQALLITILLGIYFTILQAS 171

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
                        + S+FF   G HGLHV  G  +L V +++ LK    S +       +
Sbjct: 172 EYFETPFSISDGVYGSTFFMATGFHGLHVIIGTTFLMVCLMRQLKYHFTSKHHFGFEAAA 231

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ ++  +Y  G
Sbjct: 232 WYWHFVDVVWLFLYVSIYWWG 252


>gi|57281929|emb|CAD19451.1| cytochrome oxidase subunit 3 [Hyacinthus sp. CQ-2001]
 gi|57281937|emb|CAD19455.1| cytochrome oxidase subunit 3 [Triteleia laxa]
          Length = 265

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 81/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGYHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T++L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTLILPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|117079|sp|P14853|COX3_SOYBN RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
          Length = 265

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 45/199 (22%), Positives = 83/199 (41%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDIS 72
           +   + V   G   G   +++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKVVQLGPRYGSIPFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPLGIWVLDPW 130

Query: 73  -GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +LL S  + ++A  A    +   + V  L+ T    ++F   +  E+     
Sbjct: 131 EIPFLNTPILLSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVFTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                  S + S+FF   G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APFTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++W+ +F  +Y  G +
Sbjct: 247 FVDVVWLFLFVSIYWWGGI 265


>gi|207081101|gb|ACI22832.1| cytochrome c oxidase subunit III [Peromyscus leucopus]
 gi|296492436|gb|ADH29741.1| cytochrome c oxidase subunit III [Peromyscus leucopus]
 gi|296492439|gb|ADH29743.1| cytochrome c oxidase subunit III [Peromyscus leucopus]
          Length = 255

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/201 (19%), Positives = 80/201 (39%), Gaps = 15/201 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPID 67
                 + +   G   G  ++++S+             +    T+ + G     G  P++
Sbjct: 60  TYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLAPTHDLGGCWPPTGITPLN 119

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
             ++    ++T VLL S +S ++A  +        K  +         ++ I   I + +
Sbjct: 120 PLEVP--LLNTSVLLASGVSITWAHHSLMEG----KRSNMNQALLITILLGIYFTILQAS 173

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
                        + S+FF   G HGLHV  G  +L V +++ LK    S +       +
Sbjct: 174 EYFETPFSISDGVYGSTFFMATGFHGLHVIIGTTFLMVCLLRQLKYHFTSKHHFGFEAAA 233

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ ++  +Y  G
Sbjct: 234 WYWHFVDVVWLFLYVSIYWWG 254


>gi|157692164|ref|YP_001486626.1| cytochrome-c oxidase subunit III [Bacillus pumilus SAFR-032]
 gi|194014225|ref|ZP_03052842.1| cytochrome c oxidase subunit 3 (cytochrome c oxidasepolypeptide
           III) (cytochrome aa3 subunit 3) ( subunit 3)(Oxidase
           aa(3) subunit 3) [Bacillus pumilus ATCC 7061]
 gi|157680922|gb|ABV62066.1| cytochrome-c oxidase subunit III [Bacillus pumilus SAFR-032]
 gi|194013251|gb|EDW22816.1| cytochrome c oxidase subunit 3 (cytochrome c oxidasepolypeptide
           III) (cytochrome aa3 subunit 3) ( subunit 3)(Oxidase
           aa(3) subunit 3) [Bacillus pumilus ATCC 7061]
          Length = 206

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 58/187 (31%), Positives = 103/187 (55%)

Query: 24  CVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLL 83
            ++    ++GFW++L  + ++FA  F TY  L  + A G    D+FD++ +F++T++LL 
Sbjct: 19  TLEGKNKFVGFWLFLGGETVLFASLFATYLALKNSNAGGAKTTDMFDLTLVFIATMLLLT 78

Query: 84  SSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLS 143
           SSL+  +AM            +   +          +     + ++ + +     SA  S
Sbjct: 79  SSLTSVYAMYHMKNFAFKKMQLWLGVTVLLGASFLGVEIYEFYHYVHAYDFTITSSALGS 138

Query: 144 SFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           SF+ LVG HG HV FGL W+  L+I+ +++GL   N  +    S++WHF+D++W+ +F+ 
Sbjct: 139 SFYTLVGTHGAHVAFGLCWITALMIRNMRRGLDLYNAPKYYVASLYWHFIDVVWVFIFTV 198

Query: 204 VYLMGVV 210
           VYLMG+V
Sbjct: 199 VYLMGMV 205


>gi|229083935|ref|ZP_04216238.1| Quinol oxidase subunit 3 [Bacillus cereus Rock3-44]
 gi|228699370|gb|EEL52052.1| Quinol oxidase subunit 3 [Bacillus cereus Rock3-44]
          Length = 200

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 73/179 (40%), Positives = 106/179 (59%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F +Y VL    A GP P D+F++  + + T++LL SS +C   
Sbjct: 22  LGFWIFLGAEIMLFATLFASYLVLAGRTADGPTPADLFEVKTLLIQTLLLLTSSFTCGIV 81

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +            + W L T   G  F+  EI EF   +   A  Q SAFLS FF L+G 
Sbjct: 82  IHEMRKNNQK-AMLGWFLFTLLLGAGFLFFEIEEFIMYVGEGATLQTSAFLSGFFVLLGT 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+IW   ++IQILK+GL     R++  +S++WHFLDL+WI +++ VYL G+V
Sbjct: 141 HGAHVTGGIIWATCVIIQILKRGLTPVTARKVFIISLYWHFLDLVWIFIYTLVYLNGMV 199


>gi|226314594|ref|YP_002774490.1| cytochrome c oxidase polypeptide III [Brevibacillus brevis NBRC
           100599]
 gi|226097544|dbj|BAH45986.1| cytochrome c oxidase polypeptide III [Brevibacillus brevis NBRC
           100599]
          Length = 208

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 67/192 (34%), Positives = 111/192 (57%), Gaps = 1/192 (0%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++     LGFW++L  + ++F   F T+  L      GP    +FD++ + V+T
Sbjct: 13  EPEKATLEGKNKVLGFWLFLGGETVLFGSLFATFIALRDQANGGPTSQALFDMNLVAVAT 72

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           ++LL SS++   A LA   K L  K   WL +T   G+ F+ +EIYEF H ++       
Sbjct: 73  LLLLTSSMTSVMATLALHRKDLK-KIQLWLTITVILGLGFLALEIYEFVHYVNEGLKMST 131

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF S+F+ LVG HG HV FG+ W+ +L +   KKGL      +     ++WHF+D++W+
Sbjct: 132 SAFSSAFYTLVGFHGAHVAFGICWITLLQLSATKKGLTVVTAPKFYLACLYWHFIDVVWV 191

Query: 199 CVFSFVYLMGVV 210
            +F+ VYLMG++
Sbjct: 192 FIFTVVYLMGMI 203


>gi|57281933|emb|CAD19453.1| cytochrome oxidase subunit 3 [Ipheion uniflorum]
 gi|57281935|emb|CAD19454.1| cytochrome oxidase subunit 3 [Nothoscordum inodorum]
          Length = 265

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 80/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDIS 72
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGYHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPW 130

Query: 73  -GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|207081095|gb|ACI22828.1| cytochrome c oxidase subunit III [Peromyscus maniculatus bairdii]
 gi|296492433|gb|ADH29739.1| cytochrome c oxidase subunit III [Peromyscus maniculatus]
          Length = 255

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/201 (19%), Positives = 80/201 (39%), Gaps = 15/201 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPID 67
                 + +   G   G  ++++S+             +    T+ + G     G  P++
Sbjct: 60  TYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLAPTHDLGGCWPPTGITPLN 119

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
             ++    ++T VLL S +S ++A  +        K  +         ++ I   I + +
Sbjct: 120 PLEVP--LLNTSVLLASGVSITWAHHSLMEG----KRNNMNQALIITILLGIYFTILQAS 173

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
                        + S+FF   G HGLHV  G  +L V +++ LK    S +       +
Sbjct: 174 EYFETPFSISDGIYGSTFFMATGFHGLHVIIGTTFLMVCLLRQLKYHFTSKHHFGFEAAA 233

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ ++  +Y  G
Sbjct: 234 WYWHFVDVVWLFLYVSIYWWG 254


>gi|218453802|gb|ACK76668.1| cytochrome oxidase subunit III [Peromyscus polionotus subgriseus]
          Length = 253

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 40/201 (19%), Positives = 81/201 (40%), Gaps = 15/201 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPID 67
                 + +   G   G  ++++S+             +    T+ + G    AG  P++
Sbjct: 58  TYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLAPTHDLGGCWPPAGITPLN 117

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
             ++    ++T VLL S +S ++A  +        K  +         ++ I   I + +
Sbjct: 118 PLEVP--LLNTSVLLASGVSITWAHHSLMEG----KRSNMNQALLITILLGIYFTILQAS 171

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
                        + S+FF   G HGLHV  G  +L V +++ LK    S +       +
Sbjct: 172 EYFETPFSISDGVYGSTFFMATGFHGLHVIIGTTFLMVCLMRQLKYHFTSKHHFGFEAAA 231

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ ++  +Y  G
Sbjct: 232 WYWHFVDVVWLFLYVSIYWWG 252


>gi|152974415|ref|YP_001373932.1| cytochrome aa3 quinol oxidase subunit III [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152023167|gb|ABS20937.1| Cytochrome aa3 quinol oxidase subunit III [Bacillus cytotoxicus NVH
           391-98]
          Length = 200

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 70/179 (39%), Positives = 106/179 (59%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C  A
Sbjct: 22  LGFWIFLGAEIVLFATLFASYLVLAGRTADGPTPAQLFELKTLLIQTLLLLTSSFTCGIA 81

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +         +  + W + T   G  F+  EI EF    +  A  Q S FLS FF L+G 
Sbjct: 82  IHEMRRHN-KNAMLGWFIFTLLLGAGFLFFEIEEFMTYAAEGATIQTSGFLSGFFVLLGT 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+IW   ++IQILK+GL     R++  +S++WHFLD++WI +++ VYL G+V
Sbjct: 141 HGAHVTAGIIWAICVIIQILKRGLTPITARKVFIISLYWHFLDVVWIFIYTLVYLNGMV 199


>gi|297818670|ref|XP_002877218.1| cytochrome c oxidase subunit 3 [Arabidopsis lyrata subsp. lyrata]
 gi|297323056|gb|EFH53477.1| cytochrome c oxidase subunit 3 [Arabidopsis lyrata subsp. lyrata]
          Length = 265

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 43/199 (21%), Positives = 84/199 (42%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAV--FFVTYAVLGKNYAAG----PAPIDVFDIS 72
           +   + V   G   G  ++++S+ + F    +  +++ L      G    P  I V D  
Sbjct: 71  EGHHTKVVQLGPRYGSILFIVSEVMFFFAFFWASSHSSLAPAVEIGGIWPPKGIGVLDPW 130

Query: 73  -GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++F   +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVLLALVFTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                  S + S+FF   G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APFTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++W+ +F  +Y  G +
Sbjct: 247 FVDVVWLFLFVSIYWWGGI 265


>gi|32526835|ref|NP_871767.1| cytochrome c oxidase subunit III [Urotrichus talpoides]
 gi|32469186|dbj|BAC78880.1| cytochrome oxidase subunit 3 [Urotrichus talpoides]
          Length = 261

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 45/199 (22%), Positives = 85/199 (42%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPIDVF 69
               + +   G   G  ++++S+             +    T+ + G    AG  P++  
Sbjct: 68  QGHHTPIVQKGLRYGMILFIISEVFFFAGFFWAFYHSSLAPTHELGGFWPPAGIHPLNPL 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S +S ++A  +       H  +  L +T   G+ F I++  E+   
Sbjct: 128 EVP--LLNTSVLLASGVSITWAHHSLMEGNRKH-MIQALFITIALGVYFTILQAAEY--- 181

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + S+FF   G HGLHV  G  +L V  I+ LK    S +       + +
Sbjct: 182 YEAPFTISDGVYGSTFFMATGFHGLHVIIGTTFLTVCFIRQLKYHFTSKHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYVSIYWWG 260


>gi|87198940|ref|YP_496197.1| cytochrome c oxidase, subunit III [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87134621|gb|ABD25363.1| cytochrome c oxidase, subunit III [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 273

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 42/203 (20%), Positives = 81/203 (39%), Gaps = 15/203 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA-----------VLGKNYAAGPAP 65
                 + V       G  +++ S+ + F  +F  +             +G  +      
Sbjct: 68  AHAGDHTPVVQLHQRYGMILFIASEVMFFVGWFWAFFDFSLFPSTIAETVGGQWPPKAIE 127

Query: 66  IDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYE 125
             +       ++T++LL S  + ++A  A             L  T   G+IF +++ YE
Sbjct: 128 AVMDPFDLPLLNTLILLCSGTTLTWAHHALI-HGDREGLKKGLWATIILGVIFSMIQAYE 186

Query: 126 FAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLIC 185
           +AH          + + S+F+   G HG HV  G I+L V +I+  K             
Sbjct: 187 YAH---APFAFGTNTYGSAFYMATGFHGFHVIVGTIFLIVCLIRAYKGHFTPRQHFGFEA 243

Query: 186 LSMFWHFLDLIWICVFSFVYLMG 208
            + +WHF+D++W+ +F  +Y+ G
Sbjct: 244 AAWYWHFVDVVWLFLFVAIYVWG 266


>gi|114049400|ref|YP_739950.1| cytochrome c oxidase subunit III [Shewanella sp. MR-7]
 gi|113890842|gb|ABI44893.1| cytochrome c oxidase, subunit III [Shewanella sp. MR-7]
          Length = 206

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 94/206 (45%), Positives = 133/206 (64%), Gaps = 1/206 (0%)

Query: 5   KIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPA 64
            +    +  + + ++  E       T  GFW+YLM+DC++FA  F TYAVL  N   G +
Sbjct: 2   SVAIPADLEVAHAEEHHEHHDTGGNTLFGFWLYLMTDCILFASVFATYAVLYMNTDGGVS 61

Query: 65  PIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIY 124
             D+F++  + + T  LLLSS++  FA L  A +     T++WL +T   G +FI ME+Y
Sbjct: 62  GKDIFELDFVLIETAALLLSSITYGFA-LIFAKRHNRLATLTWLAITFALGCVFIGMEVY 120

Query: 125 EFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLI 184
           EF HLI     PQRSAFLSSFF LVG+HGLHV  GLIW+ +++I++ K GL + +  RL 
Sbjct: 121 EFHHLIEHGNGPQRSAFLSSFFTLVGMHGLHVTAGLIWMAIMMIEVAKTGLGNRSITRLS 180

Query: 185 CLSMFWHFLDLIWICVFSFVYLMGVV 210
           CLS+FWHFLD++WICVF+ VYL+G +
Sbjct: 181 CLSLFWHFLDIVWICVFTVVYLLGAL 206


>gi|262369761|ref|ZP_06063089.1| cytochrome o ubiquinol oxidase subunit III [Acinetobacter johnsonii
           SH046]
 gi|262315829|gb|EEY96868.1| cytochrome o ubiquinol oxidase subunit III [Acinetobacter johnsonii
           SH046]
          Length = 206

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 93/197 (47%), Positives = 122/197 (61%), Gaps = 2/197 (1%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVFDISGI 74
           +  D+     D D T  GFW YLMSD ++F   F+ +AVL  +   G P+  ++F  S  
Sbjct: 10  HGHDEHHQHDDTDITVFGFWTYLMSDLILFGTLFIAFAVLSSHVPMGTPSAKELFGESLG 69

Query: 75  FVSTIVLLLSSLSCSFAMLASATKR-LIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           FV T    L   S +F     A  +  +++ ++WL +T  FG  FI ME+YEF HL+   
Sbjct: 70  FVLTETFALLISSVTFGFAVLAAYKKNVNQVLTWLAITWLFGASFIGMELYEFNHLVHAG 129

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
             P  SAFLSSFF LVG HG+HV  GL+W+ +L+IQI K GL   N RRL CLS+FWHFL
Sbjct: 130 HGPSVSAFLSSFFTLVGTHGIHVTSGLVWMIILMIQIKKNGLTLPNTRRLACLSLFWHFL 189

Query: 194 DLIWICVFSFVYLMGVV 210
           D++WICVFS VYLMGV+
Sbjct: 190 DIVWICVFSVVYLMGVL 206


>gi|86751681|ref|YP_488177.1| cytochrome c oxidase, subunit III [Rhodopseudomonas palustris HaA2]
 gi|86574709|gb|ABD09266.1| Cytochrome c oxidase, subunit III [Rhodopseudomonas palustris HaA2]
          Length = 284

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 41/203 (20%), Positives = 80/203 (39%), Gaps = 17/203 (8%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLG--------------KNYAAGPAP 65
              + V       G  +++ S+ + F  +F  Y                        P  
Sbjct: 75  GDHTRVVQISHRYGMILFIASEVMFFVAWFWAYFNAALFPGDPVHATREALFGGVWPPKG 134

Query: 66  IDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYE 125
           I+ FD   + +   ++LL+S +       +            L++T   G  F  +++YE
Sbjct: 135 IETFDPWHLPLLNTLILLTSGTTVTWAHHALLHNDRKGVKQALILTVLLGAAFSCVQVYE 194

Query: 126 FAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLIC 185
           ++H          + + ++FF   G HG HV  G I+L V +I++ K             
Sbjct: 195 YSH---AAFSFAGNVYGATFFMATGFHGFHVLVGTIFLLVCLIRVYKGHFTPTQHLGFEF 251

Query: 186 LSMFWHFLDLIWICVFSFVYLMG 208
            + +WHF+D++W+ +F  +Y+ G
Sbjct: 252 AAWYWHFVDVVWLFLFVCIYVWG 274


>gi|296536348|ref|ZP_06898455.1| cytochrome-c oxidase [Roseomonas cervicalis ATCC 49957]
 gi|296263324|gb|EFH09842.1| cytochrome-c oxidase [Roseomonas cervicalis ATCC 49957]
          Length = 283

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 44/197 (22%), Positives = 74/197 (37%), Gaps = 11/197 (5%)

Query: 22  ESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYA---------AGPAPIDVFDIS 72
            + V   G   G  +++ S+ + F  FF  Y                   PA I  FD  
Sbjct: 83  HTPVVRLGMRYGMVLFIASEVMFFVAFFWAYFHFALYPEHVSGAAKAIWPPAGIQTFDPF 142

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +   ++LL S         +  +      +  L +T   G+ F   +  E+A   + 
Sbjct: 143 HLPLLNTLILLLSGCTVTWAHHALLENDRKGMLQGLGLTVLLGLTFTFFQAVEYAE--AP 200

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
            A      + S FF   G HG HV  G I+L V   +                 + +WHF
Sbjct: 201 FAFHGGGIYPSVFFLATGFHGFHVIVGTIFLAVCWFRARAGHFTPQRHFGFEAAAWYWHF 260

Query: 193 LDLIWICVFSFVYLMGV 209
           +D++W+ +F  VY++G 
Sbjct: 261 VDVVWLFLFVCVYVLGA 277


>gi|107028751|ref|YP_625846.1| cytochrome c oxidase, subunit III [Burkholderia cenocepacia AU
           1054]
 gi|116690090|ref|YP_835713.1| cytochrome c oxidase, subunit III [Burkholderia cenocepacia HI2424]
 gi|170733424|ref|YP_001765371.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           cenocepacia MC0-3]
 gi|105897915|gb|ABF80873.1| cytochrome bo3 quinol oxidase subunit 3 [Burkholderia cenocepacia
           AU 1054]
 gi|116648179|gb|ABK08820.1| cytochrome bo3 quinol oxidase subunit 3 [Burkholderia cenocepacia
           HI2424]
 gi|169816666|gb|ACA91249.1| cytochrome o ubiquinol oxidase, subunit III [Burkholderia
           cenocepacia MC0-3]
          Length = 202

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 100/195 (51%), Positives = 130/195 (66%), Gaps = 7/195 (3%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            D          +  GFW+YLM+DC++FA  F T+AVLG  YA G    ++FDI G+ V 
Sbjct: 13  HDDHPP----SHSVFGFWLYLMTDCVIFAALFATFAVLGHQYAGGQTAKELFDIPGVAVE 68

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T  LLLSS++  FAMLA+  ++     ++WL VT   G  F+ ME+ EF+HLI+  A PQ
Sbjct: 69  TAALLLSSITYGFAMLAA-YQQRRGALLAWLAVTFVLGAAFLTMELREFSHLIAEGAGPQ 127

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLICLSMFWHFLDL 195
           RSAFLS+FF LVG HGLHV  GL+W+ VL  QI+ +G  L   + RRL CLS+FWHFLD+
Sbjct: 128 RSAFLSAFFTLVGTHGLHVTAGLLWMIVLAAQIVLRGGDLTDRDLRRLTCLSLFWHFLDI 187

Query: 196 IWICVFSFVYLMGVV 210
           +WICVFSFVYL  V+
Sbjct: 188 VWICVFSFVYLASVI 202


>gi|76780580|emb|CAD92020.1| cytochrome oxidase subunit 3 [Chamaescilla sp. Chase 2208]
          Length = 265

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 80/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDIS 72
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGYHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGILVLDPR 130

Query: 73  -GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 KIPFLNTPILPSSGAAVTWAYHAILAGKEK-RAVYALIATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|153833148|ref|ZP_01985815.1| cytOchrome o ubiquinol oxidase, subunit III [Vibrio harveyi HY01]
 gi|163800403|ref|ZP_02194304.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio sp. AND4]
 gi|148870578|gb|EDL69486.1| cytOchrome o ubiquinol oxidase, subunit III [Vibrio harveyi HY01]
 gi|159175846|gb|EDP60640.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio sp. AND4]
          Length = 199

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 96/182 (52%), Positives = 119/182 (65%), Gaps = 1/182 (0%)

Query: 29  GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSC 88
               GFW+YLMSDC++FA  F TYAVL     AGP   D+F++  +FV T++LL SS++ 
Sbjct: 19  NKLFGFWVYLMSDCVLFATLFATYAVLESGSIAGPTGKDIFELPFVFVETMLLLFSSITF 78

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            F M+A   K  +     WL VT   G+ FI ME+YEF HLI     PQ SAFLS+FF L
Sbjct: 79  GFGMIAMKRKD-VAGLKRWLKVTFLLGLGFICMEVYEFHHLIEEGYGPQESAFLSAFFTL 137

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           VG HGLHV FGLIWL V   Q+  KGL      R  CLS+FWHFLD++WICVF+ VYL+G
Sbjct: 138 VGTHGLHVTFGLIWLAVGYHQLSTKGLNDNMSMRFQCLSLFWHFLDIVWICVFTIVYLLG 197

Query: 209 VV 210
           V+
Sbjct: 198 VM 199


>gi|145223396|ref|YP_001134074.1| cytochrome c oxidase, subunit III [Mycobacterium gilvum PYR-GCK]
 gi|145215882|gb|ABP45286.1| cytochrome c oxidase, subunit III [Mycobacterium gilvum PYR-GCK]
          Length = 197

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 48/176 (27%), Positives = 85/176 (48%), Gaps = 1/176 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           +G  ++L S+ + FA  F  Y          P P    +++     T++L+ SS +C   
Sbjct: 22  VGTIVWLSSELMFFAGLFAMYFTARAQADEWPPPPTELNLALAVPVTLILIASSFTCQMG 81

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           + A+     +     W +VT   G+IF++ + YE+  L+        SA+ S F+   G 
Sbjct: 82  VFAAERGD-VFGLRRWYVVTLLMGLIFVLGQGYEYISLVREGTTIAGSAYGSVFYLTTGF 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLM 207
           HGLHV  GL+   +L+I+              I +S +WHF+D++WI +F+ +Y +
Sbjct: 141 HGLHVIGGLVAFILLLIRTRMSKFTPAQATAAIVVSYYWHFVDIVWIALFATIYFV 196


>gi|237869105|ref|YP_002907432.1| cytochrome c oxidase subunit III [Chitala blanci]
 gi|237648802|dbj|BAH58902.1| cytochrome c oxidase subunit III [Chitala blanci]
          Length = 261

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 43/198 (21%), Positives = 81/198 (40%), Gaps = 15/198 (7%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPIDVFD 70
              +     G  LG  +++ S+             +    T  + G     G AP+D F+
Sbjct: 69  GHHTPPVQKGLRLGMILFITSEVFFFLGFFWAFFHSSLAPTPELGGCWPPTGIAPLDPFE 128

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
           +    ++T VLL S ++ ++A  +             L +T   G  F  ++  E+    
Sbjct: 129 VP--LLNTAVLLASGVTVTWAHHSLMEGARKEAV-QSLALTILLGCYFTALQAMEYH--- 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                     + S+FF   G HGLHV  G  +L V +++ +K    S +       + +W
Sbjct: 183 EAPFTIADGVYGSTFFVATGFHGLHVIVGTTFLTVCLLRQIKYHFTSQHHFGFEAAAWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  +Y  G
Sbjct: 243 HFVDVVWLFLYVSIYWWG 260


>gi|311068008|ref|YP_003972931.1| cytochrome c oxidase, subunit III [Bacillus atrophaeus 1942]
 gi|310868525|gb|ADP32000.1| cytochrome c oxidase, subunit III [Bacillus atrophaeus 1942]
          Length = 207

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 61/187 (32%), Positives = 101/187 (54%)

Query: 24  CVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLL 83
            ++    +LGFW++L  + ++FA  F T+  L  + A+ P   ++FD+S +F++T++LL 
Sbjct: 20  TLEGKNKFLGFWLFLGGETVLFASLFATFLALRNSNASDPPTSEMFDLSLVFIATMLLLT 79

Query: 84  SSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLS 143
           SSL+  +AM            +  LL          +       +          SA  S
Sbjct: 80  SSLTSVYAMYHMKNFAFGKMQLWLLLTLLLGAGFLGVEIYEFKHYTHEFGFTITSSALGS 139

Query: 144 SFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSF 203
           SF+ LVG HG HV FGL+W+  L+I+  K+GL   N  +    S++WHF+D++W+ +F+ 
Sbjct: 140 SFYTLVGTHGAHVAFGLLWISALMIRNAKRGLSLYNAPKFYVASLYWHFIDVVWVFIFTV 199

Query: 204 VYLMGVV 210
           VYLMG+V
Sbjct: 200 VYLMGMV 206


>gi|228989832|ref|ZP_04149812.1| Quinol oxidase subunit 3 [Bacillus pseudomycoides DSM 12442]
 gi|228996023|ref|ZP_04155678.1| Quinol oxidase subunit 3 [Bacillus mycoides Rock3-17]
 gi|229003639|ref|ZP_04161454.1| Quinol oxidase subunit 3 [Bacillus mycoides Rock1-4]
 gi|228757605|gb|EEM06835.1| Quinol oxidase subunit 3 [Bacillus mycoides Rock1-4]
 gi|228763719|gb|EEM12611.1| Quinol oxidase subunit 3 [Bacillus mycoides Rock3-17]
 gi|228769979|gb|EEM18562.1| Quinol oxidase subunit 3 [Bacillus pseudomycoides DSM 12442]
          Length = 200

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 70/179 (39%), Positives = 106/179 (59%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C  A
Sbjct: 22  LGFWIFLGAEIVLFATLFASYLVLAGRTADGPTPAQLFELKTLLIQTLLLLTSSFTCGIA 81

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +            + W + T   G  F+  E+ EF   ++  A  Q S FLS FF L+G 
Sbjct: 82  IHEMRKHNQK-AMLGWFIFTLILGAGFLFFEVEEFMAYVAEGATIQTSGFLSGFFVLLGT 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+IW   +VIQILK+GL     R++  +S++WHFLD++WI +++ VYL G+V
Sbjct: 141 HGAHVTAGIIWATCVVIQILKRGLTPVTARKVFIISLYWHFLDVVWIFIYTLVYLNGMV 199


>gi|3121891|sp|Q36952|COX3_AEGCO RecName: Full=Cytochrome c oxidase subunit 3; AltName:
           Full=Cytochrome c oxidase polypeptide III
 gi|1213424|gb|AAA91210.1| cytochrome c oxidase subunit III [Aegilops columnaris]
 gi|1213426|gb|AAA91211.1| cytochrome c oxidase subunit III [Aegilops columnaris]
          Length = 265

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 40/199 (20%), Positives = 79/199 (39%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDIS 72
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPW 130

Query: 73  -GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
               ++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPLLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++L V  I+     +   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFLATGFHGFHVIIGTLFLIVCGIRQYLGLMTKKHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|237869119|ref|YP_002907445.1| cytochrome c oxidase subunit III [Chitala lopis]
 gi|237648816|dbj|BAH58915.1| cytochrome c oxidase subunit III [Chitala lopis]
          Length = 261

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 41/198 (20%), Positives = 80/198 (40%), Gaps = 15/198 (7%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPIDVFD 70
              +     G   G  +++ S+             +    T  + G     G AP+D F+
Sbjct: 69  GHHTPPVQKGLRFGMILFITSEVFFFLGFFWAFFHSSLAPTPELGGCWPPTGIAPLDPFE 128

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
           +    ++T VLL S ++ ++A  +             L +T   G  F  ++  E+    
Sbjct: 129 VP--LLNTAVLLASGVTVTWAHHSLMEGARKEAV-QSLALTILLGCYFTALQAMEY---Y 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                     + S+FF   G HGLHV  G  +L + +++ +K    S +       + +W
Sbjct: 183 EAPFTIADGVYGSTFFVATGFHGLHVIIGTTFLAICLLRQIKYHFTSQHHFGFEAAAWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  +Y  G
Sbjct: 243 HFVDVVWLFLYVSIYWWG 260


>gi|304405377|ref|ZP_07387036.1| Cytochrome-c oxidase [Paenibacillus curdlanolyticus YK9]
 gi|304345416|gb|EFM11251.1| Cytochrome-c oxidase [Paenibacillus curdlanolyticus YK9]
          Length = 206

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 69/194 (35%), Positives = 115/194 (59%), Gaps = 2/194 (1%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVFDISGIFV 76
            + +++ ++     LGFW++L  + ++F   F  +  L      G P   ++F++S + +
Sbjct: 13  HEPEKATLEGRNKVLGFWLFLGGETVLFGTLFSAFLALRDKVGEGNPTANELFNLSTVAI 72

Query: 77  STIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVP 136
           +T +LL SSL+  FA+ A  + +  +  + WL +T  FG+ F+ +EIYEF   +      
Sbjct: 73  ATFILLTSSLTSVFAIQAMHSGK-KNAMLGWLAITVLFGLGFLGLEIYEFYEYVHEGHGF 131

Query: 137 QRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLI 196
             SAF SSF+ LVG HG HV FG+IW+ +L+ Q++KKGL      +L    M+WHF+D++
Sbjct: 132 TTSAFSSSFYTLVGFHGAHVAFGVIWISLLIGQVMKKGLNVVTAPKLYVAGMYWHFIDVV 191

Query: 197 WICVFSFVYLMGVV 210
           W+ +F+ VYLMG V
Sbjct: 192 WVFIFTVVYLMGKV 205


>gi|228913389|ref|ZP_04077022.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|228846298|gb|EEM91317.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
          Length = 200

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 71/179 (39%), Positives = 106/179 (59%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C   
Sbjct: 22  LGFWIFLGAEIMLFATLFASYLVLAGRTADGPTPAQLFELKTLLIQTLLLLTSSFTCGIV 81

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +            + W ++T   G  F+  EI EF   I   A  Q SAFLS FF L+G 
Sbjct: 82  IHEMRKHNQK-AMLGWFILTLLLGAGFLFFEIEEFIMYIGEGATIQTSAFLSGFFVLLGT 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+IW   ++IQILK+GL     R++  +S++WHFLDL+W+ +++ VYL G+V
Sbjct: 141 HGAHVTGGIIWAICVIIQILKRGLTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMV 199


>gi|270301120|gb|ACZ59706.2| cytochrome c oxidase subunit III [Peromyscus polionotus allophrys]
          Length = 242

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 39/201 (19%), Positives = 80/201 (39%), Gaps = 15/201 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPID 67
                 + +   G   G  ++++S+             +    T+ + G     G  P++
Sbjct: 47  TYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLAPTHDLGGCWPPTGITPLN 106

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
             ++    ++T VLL S +S ++A  +        K  +         ++ I   I + +
Sbjct: 107 PLEVP--LLNTSVLLASGVSITWAHHSLMEG----KRSNMNQALLITILLGIYFTILQAS 160

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
                        + S+FF   G HGLHV  G  +L V +++ LK    S +       +
Sbjct: 161 EYFETPFSISDGVYGSTFFMATGFHGLHVIIGTTFLMVCLMRQLKYHFTSKHHFGFEAAA 220

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ ++  +Y  G
Sbjct: 221 WYWHFVDVVWLFLYVSIYWWG 241


>gi|57282255|emb|CAD32356.1| cytochrome oxidase subunit 3 [Behnia reticulata]
          Length = 265

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 81/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGYHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
             +F++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EILFLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|30018878|ref|NP_830509.1| cytochrome aa3 quinol oxidase polypeptide III [Bacillus cereus ATCC
           14579]
 gi|30260851|ref|NP_843228.1| quinol oxidase, subunit III [Bacillus anthracis str. Ames]
 gi|42779848|ref|NP_977095.1| quinol oxidase, subunit III [Bacillus cereus ATCC 10987]
 gi|47525982|ref|YP_017331.1| quinol oxidase subunit III [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49183692|ref|YP_026944.1| quinol oxidase subunit III [Bacillus anthracis str. Sterne]
 gi|49480265|ref|YP_034957.1| quinol oxidase subunit III (cytochrome c oxidase subunit III)
           [Bacillus thuringiensis serovar konkukian str. 97-27]
 gi|52144610|ref|YP_082218.1| quinol oxidase, subunit III (cytochrome c oxidase, subunit III)
           [Bacillus cereus E33L]
 gi|65318129|ref|ZP_00391088.1| COG1845: Heme/copper-type cytochrome/quinol oxidase, subunit 3
           [Bacillus anthracis str. A2012]
 gi|118476379|ref|YP_893530.1| quinol oxidase, subunit III (cytochrome c oxidase, subunit III)
           [Bacillus thuringiensis str. Al Hakam]
 gi|165872914|ref|ZP_02217538.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0488]
 gi|167635136|ref|ZP_02393452.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0442]
 gi|167641848|ref|ZP_02400088.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0193]
 gi|170689426|ref|ZP_02880617.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0465]
 gi|170709008|ref|ZP_02899439.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0389]
 gi|177652799|ref|ZP_02935172.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0174]
 gi|190568584|ref|ZP_03021490.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis
           Tsiankovskii-I]
 gi|196035750|ref|ZP_03103153.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus W]
 gi|196047115|ref|ZP_03114333.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus
           03BB108]
 gi|206968469|ref|ZP_03229425.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus AH1134]
 gi|206977812|ref|ZP_03238702.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus
           H3081.97]
 gi|217958285|ref|YP_002336831.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus AH187]
 gi|218232838|ref|YP_002365495.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus B4264]
 gi|222094456|ref|YP_002528515.1| quinol oxidase, subunit iii (cytochrome c oxidase, subunit iii)
           [Bacillus cereus Q1]
 gi|225862679|ref|YP_002748057.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus
           03BB102]
 gi|227816428|ref|YP_002816437.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           CDC 684]
 gi|228932130|ref|ZP_04095021.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228957119|ref|ZP_04118889.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228983900|ref|ZP_04144093.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229042562|ref|ZP_04190305.1| Quinol oxidase subunit 3 [Bacillus cereus AH676]
 gi|229108308|ref|ZP_04237927.1| Quinol oxidase subunit 3 [Bacillus cereus Rock1-15]
 gi|229126127|ref|ZP_04255148.1| Quinol oxidase subunit 3 [Bacillus cereus BDRD-Cer4]
 gi|229143425|ref|ZP_04271854.1| Quinol oxidase subunit 3 [Bacillus cereus BDRD-ST24]
 gi|229188907|ref|ZP_04315940.1| Quinol oxidase subunit 3 [Bacillus cereus ATCC 10876]
 gi|229601533|ref|YP_002865296.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0248]
 gi|254684222|ref|ZP_05148082.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           CNEVA-9066]
 gi|254725884|ref|ZP_05187666.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A1055]
 gi|254734416|ref|ZP_05192129.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           Western North America USA6153]
 gi|254742102|ref|ZP_05199789.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           Kruger B]
 gi|254755776|ref|ZP_05207809.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           Vollum]
 gi|254762358|ref|ZP_05214202.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           Australia 94]
 gi|296501451|ref|YP_003663151.1| cytochrome aa3 quinol oxidase polypeptide III [Bacillus
           thuringiensis BMB171]
 gi|301052350|ref|YP_003790561.1| quinol oxidase subunit III [Bacillus anthracis CI]
 gi|29894420|gb|AAP07710.1| Cytochrome aa3 quinol oxidase polypeptide III [Bacillus cereus ATCC
           14579]
 gi|30254300|gb|AAP24714.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           Ames]
 gi|42735765|gb|AAS39703.1| quinol oxidase, subunit III [Bacillus cereus ATCC 10987]
 gi|47501130|gb|AAT29806.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49177619|gb|AAT52995.1| quinol oxidase, subunit III [Bacillus anthracis str. Sterne]
 gi|49331821|gb|AAT62467.1| quinol oxidase, subunit III (cytochrome c oxidase, subunit III)
           [Bacillus thuringiensis serovar konkukian str. 97-27]
 gi|51978079|gb|AAU19629.1| quinol oxidase, subunit III (cytochrome c oxidase, subunit III)
           [Bacillus cereus E33L]
 gi|118415604|gb|ABK84023.1| cytochrome aa3 quinol oxidase subunit 3 [Bacillus thuringiensis
           str. Al Hakam]
 gi|164711327|gb|EDR16880.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0488]
 gi|167510196|gb|EDR85602.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0193]
 gi|167529395|gb|EDR92146.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0442]
 gi|170126110|gb|EDS95006.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0389]
 gi|170666588|gb|EDT17360.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0465]
 gi|172081833|gb|EDT66902.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0174]
 gi|190560378|gb|EDV14357.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis
           Tsiankovskii-I]
 gi|195991717|gb|EDX55682.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus W]
 gi|196022096|gb|EDX60785.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus
           03BB108]
 gi|206737389|gb|EDZ54536.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus AH1134]
 gi|206744009|gb|EDZ55426.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus
           H3081.97]
 gi|217062978|gb|ACJ77228.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus AH187]
 gi|218160795|gb|ACK60787.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus B4264]
 gi|221238513|gb|ACM11223.1| quinol oxidase, subunit III (cytochrome c oxidase, subunit III)
           [Bacillus cereus Q1]
 gi|225788852|gb|ACO29069.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus
           03BB102]
 gi|227007623|gb|ACP17366.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           CDC 684]
 gi|228594612|gb|EEK52398.1| Quinol oxidase subunit 3 [Bacillus cereus ATCC 10876]
 gi|228640053|gb|EEK96454.1| Quinol oxidase subunit 3 [Bacillus cereus BDRD-ST24]
 gi|228657334|gb|EEL13151.1| Quinol oxidase subunit 3 [Bacillus cereus BDRD-Cer4]
 gi|228675145|gb|EEL30370.1| Quinol oxidase subunit 3 [Bacillus cereus Rock1-15]
 gi|228726781|gb|EEL77995.1| Quinol oxidase subunit 3 [Bacillus cereus AH676]
 gi|228775813|gb|EEM24186.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228802566|gb|EEM49413.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228827558|gb|EEM73301.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|229265941|gb|ACQ47578.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus anthracis str.
           A0248]
 gi|296322503|gb|ADH05431.1| cytochrome aa3 quinol oxidase polypeptide III [Bacillus
           thuringiensis BMB171]
 gi|300374519|gb|ADK03423.1| quinol oxidase, subunit III [Bacillus cereus biovar anthracis str.
           CI]
 gi|324324742|gb|ADY20002.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 200

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 71/179 (39%), Positives = 106/179 (59%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C   
Sbjct: 22  LGFWIFLGAEIMLFATLFASYLVLAGRTADGPTPAQLFELKTLLIQTLLLLTSSFTCGIV 81

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +            + W ++T   G  F+  EI EF   I   A  Q SAFLS FF L+G 
Sbjct: 82  IHEMRKHNQK-AMLGWFVLTLLLGAGFLFFEIEEFIMYIGEGATIQTSAFLSGFFVLLGT 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+IW   ++IQILK+GL     R++  +S++WHFLDL+W+ +++ VYL G+V
Sbjct: 141 HGAHVTGGIIWAICVIIQILKRGLTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMV 199


>gi|164420983|ref|YP_001648604.1| cytochrome c oxidase subunit III [Halisarca dujardini]
 gi|158668137|gb|ABW76596.1| cytochrome c oxidase subunit 3 [Halisarca dujardini]
          Length = 261

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 36/196 (18%), Positives = 76/196 (38%), Gaps = 9/196 (4%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFDIS 72
               + +   G   G  ++++S+  +F   F  +                P  ++  +  
Sbjct: 68  QGHHTFIVKQGLKYGMILFILSEVCLFFSLFWAFFHSSLAPTIEVGAVWPPRGVNPLNPW 127

Query: 73  GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISM 132
            + +    +LLSS +       +         ++ L +T   G+ F  ++  E+      
Sbjct: 128 SVPLLNTAVLLSSGATVTWAHHAIISGNRKDAIAGLFLTVLLGIGFTGLQAMEY---YEA 184

Query: 133 EAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHF 192
                 S + S+FF   G HG HV  G  +L V + +++       +       + +WHF
Sbjct: 185 PFTISDSVYGSTFFLTTGAHGGHVLIGSTFLLVCLFRLISHQFTRHHHFGFEAAAWYWHF 244

Query: 193 LDLIWICVFSFVYLMG 208
           +D++W+ +F F+Y  G
Sbjct: 245 VDVVWLFLFIFMYWWG 260


>gi|57281943|emb|CAD19458.1| cytochrome oxidase subunit 3 [Danae racemosa]
 gi|57282227|emb|CAD32342.1| cytochrome oxidase subunit 3 [Ruscus aculeatus]
 gi|57282241|emb|CAD32349.1| cytochrome oxidase subunit 3 [Ixiolirion tataricum]
 gi|57282243|emb|CAD32350.1| cytochrome oxidase subunit 3 [Aspidistra elatior]
          Length = 265

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 80/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGYHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|83719897|ref|YP_442318.1| cytochrome c oxidase subunit III [Burkholderia thailandensis E264]
 gi|167619298|ref|ZP_02387929.1| Cytochrome c oxidase subunit III [Burkholderia thailandensis Bt4]
 gi|257138515|ref|ZP_05586777.1| cytochrome c oxidase subunit III [Burkholderia thailandensis E264]
 gi|83653722|gb|ABC37785.1| Cytochrome c oxidase subunit III [Burkholderia thailandensis E264]
          Length = 201

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 99/200 (49%), Positives = 128/200 (64%), Gaps = 5/200 (2%)

Query: 12  FSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDI 71
             L +             +  GFW+YLM+DC++FA  F T+AVLG  +A GP   D+FDI
Sbjct: 6   MMLDHAASHDHPP---SHSVFGFWLYLMTDCVLFAALFATFAVLGNQFAGGPTAKDLFDI 62

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
            G+ + T  LLLSS++  FAM+ +   R       WL VT   G  F+ ME+ EF+HLI+
Sbjct: 63  PGVALETAALLLSSITYGFAMIGAHK-RRRGAVFGWLAVTFVLGAAFLAMELREFSHLIA 121

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG-LISGNQRRLICLSMFW 190
             A PQRSAFLSSFF LV  HGLHV  GL+W+ VLV+Q L++  L   + RRL CLS+FW
Sbjct: 122 EGAGPQRSAFLSSFFTLVATHGLHVTAGLLWMAVLVVQALRRPELTERDIRRLTCLSLFW 181

Query: 191 HFLDLIWICVFSFVYLMGVV 210
           HFLD++WICVFSFVYL  V+
Sbjct: 182 HFLDIVWICVFSFVYLASVI 201


>gi|228906454|ref|ZP_04070335.1| Quinol oxidase subunit 3 [Bacillus thuringiensis IBL 200]
 gi|228975947|ref|ZP_04136468.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228977448|ref|ZP_04137842.1| Quinol oxidase subunit 3 [Bacillus thuringiensis Bt407]
 gi|229028500|ref|ZP_04184620.1| Quinol oxidase subunit 3 [Bacillus cereus AH1271]
 gi|229095350|ref|ZP_04226342.1| Quinol oxidase subunit 3 [Bacillus cereus Rock3-29]
 gi|229114300|ref|ZP_04243720.1| Quinol oxidase subunit 3 [Bacillus cereus Rock1-3]
 gi|229171484|ref|ZP_04299068.1| Quinol oxidase subunit 3 [Bacillus cereus MM3]
 gi|228612022|gb|EEK69260.1| Quinol oxidase subunit 3 [Bacillus cereus MM3]
 gi|228669138|gb|EEL24560.1| Quinol oxidase subunit 3 [Bacillus cereus Rock1-3]
 gi|228688209|gb|EEL42095.1| Quinol oxidase subunit 3 [Bacillus cereus Rock3-29]
 gi|228732813|gb|EEL83675.1| Quinol oxidase subunit 3 [Bacillus cereus AH1271]
 gi|228782272|gb|EEM30456.1| Quinol oxidase subunit 3 [Bacillus thuringiensis Bt407]
 gi|228783783|gb|EEM31841.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228853181|gb|EEM97957.1| Quinol oxidase subunit 3 [Bacillus thuringiensis IBL 200]
 gi|326938473|gb|AEA14369.1| cytochrome aa3 quinol oxidase polypeptide III [Bacillus
           thuringiensis serovar chinensis CT-43]
          Length = 200

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 71/179 (39%), Positives = 107/179 (59%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C   
Sbjct: 22  LGFWIFLGAEIMLFATLFASYLVLAGRTADGPTPAQLFELKTLLIQTLLLLTSSFTCGIV 81

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +            + W ++T   G  F+  EI EF   I   A  Q SAFLS+FF L+G 
Sbjct: 82  IHEMRKHNQK-AMLGWFILTLLLGAGFLFFEIEEFIMYIGEGATIQTSAFLSAFFVLLGT 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+IW   ++IQILK+GL     R++  +S++WHFLDL+W+ +++ VYL G+V
Sbjct: 141 HGAHVTGGIIWATCVIIQILKRGLTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMV 199


>gi|207081104|gb|ACI22834.1| cytochrome c oxidase subunit III [Peromyscus aztecus hylocetes]
          Length = 255

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 42/201 (20%), Positives = 87/201 (43%), Gaps = 15/201 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPID 67
                 + +   G   G  ++++S+             +    T+ + G     G +P++
Sbjct: 60  TYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLAPTHDLGGCWPPTGISPLN 119

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
             ++    ++T VLL S +S ++A  +    +  +     LL+T   G+ F +++  E+ 
Sbjct: 120 PLEVP--LLNTSVLLASGVSITWAHHSLMEGK-RNNMNQALLITILLGVYFTLLQAMEY- 175

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
                        + S+FF   G HGLHV  G  +L V +++ LK    S +       +
Sbjct: 176 --FETPFSISDGVYGSTFFMATGFHGLHVIIGSTFLMVCLLRQLKYHFTSKHHFGFEAAA 233

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ ++  +Y  G
Sbjct: 234 WYWHFVDVVWLFLYVSIYWWG 254


>gi|241664395|ref|YP_002982755.1| cytochrome o ubiquinol oxidase subunit III [Ralstonia pickettii
           12D]
 gi|240866422|gb|ACS64083.1| cytochrome o ubiquinol oxidase, subunit III [Ralstonia pickettii
           12D]
          Length = 213

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 86/179 (48%), Positives = 116/179 (64%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
            GFW+YLMSD ++FA  F T+ VL    A GP   ++FD+S + + T +LL+SS++    
Sbjct: 36  FGFWVYLMSDLIIFASLFATFCVLRGATAGGPTGKELFDLSYVAIETGILLVSSITYGMV 95

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           M++        + + WL +T   G  F+ MEI EF HLI+  A P RSAFLSSFF LVG 
Sbjct: 96  MISLQ-NGRKDQVMLWLGITLLLGAAFVGMEINEFHHLIAEGAGPSRSAFLSSFFLLVGT 154

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HGLHV  G++W+ VL+ QI  KGL      RL CLS+FWHFLD++WI VF+ VYL+G +
Sbjct: 155 HGLHVASGMLWIIVLMWQIGAKGLTPTQSTRLSCLSLFWHFLDVVWIGVFTVVYLLGAM 213


>gi|187930228|ref|YP_001900715.1| cytochrome o ubiquinol oxidase subunit III [Ralstonia pickettii
           12J]
 gi|187727118|gb|ACD28283.1| cytochrome o ubiquinol oxidase, subunit III [Ralstonia pickettii
           12J]
          Length = 209

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 86/179 (48%), Positives = 116/179 (64%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
            GFW+YLMSD ++FA  F T+ VL    A GP   ++FD+S + + T +LL+SS++    
Sbjct: 32  FGFWVYLMSDLIIFASLFATFCVLRGATAGGPTGKELFDLSYVAIETGILLVSSITYGMV 91

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           M++        + + WL +T   G  F+ MEI EF HLI+  A P RSAFLSSFF LVG 
Sbjct: 92  MISLQ-NGRKDQVMLWLGITLLLGAAFVGMEINEFHHLIAEGAGPSRSAFLSSFFLLVGT 150

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HGLHV  G++W+ VL+ QI  KGL      RL CLS+FWHFLD++WI VF+ VYL+G +
Sbjct: 151 HGLHVASGMLWIIVLMWQIGAKGLTPTQSTRLSCLSLFWHFLDVVWIGVFTVVYLLGAM 209


>gi|47568831|ref|ZP_00239525.1| cytochrome c oxidase subunit III [Bacillus cereus G9241]
 gi|228951199|ref|ZP_04113314.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|229068385|ref|ZP_04201688.1| Quinol oxidase subunit 3 [Bacillus cereus F65185]
 gi|229078012|ref|ZP_04210621.1| Quinol oxidase subunit 3 [Bacillus cereus Rock4-2]
 gi|229149039|ref|ZP_04277283.1| Quinol oxidase subunit 3 [Bacillus cereus m1550]
 gi|229177229|ref|ZP_04304616.1| Quinol oxidase subunit 3 [Bacillus cereus 172560W]
 gi|47554507|gb|EAL12864.1| cytochrome c oxidase subunit III [Bacillus cereus G9241]
 gi|228606235|gb|EEK63669.1| Quinol oxidase subunit 3 [Bacillus cereus 172560W]
 gi|228634421|gb|EEK91006.1| Quinol oxidase subunit 3 [Bacillus cereus m1550]
 gi|228705350|gb|EEL57727.1| Quinol oxidase subunit 3 [Bacillus cereus Rock4-2]
 gi|228714846|gb|EEL66718.1| Quinol oxidase subunit 3 [Bacillus cereus F65185]
 gi|228808496|gb|EEM55000.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
          Length = 200

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 71/179 (39%), Positives = 106/179 (59%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C   
Sbjct: 22  LGFWIFLGAEIMLFATLFASYLVLAGRTADGPTPAQLFELKTLLIQTLLLLTSSFTCGIV 81

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +            + W ++T   G  F+  EI EF   I   A  Q SAFLS FF L+G 
Sbjct: 82  IHEMRKHNQK-AMLGWFVLTLLLGAGFLFFEIEEFIMYIGEGATIQTSAFLSGFFVLLGT 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+IW   ++IQILK+GL     R++  +S++WHFLDL+W+ +++ VYL G+V
Sbjct: 141 HGAHVTGGIIWATCVIIQILKRGLTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMV 199


>gi|218895754|ref|YP_002444165.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus G9842]
 gi|228963801|ref|ZP_04124941.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|218540782|gb|ACK93176.1| cytochrome aa3 quinol oxidase, subunit III [Bacillus cereus G9842]
 gi|228795872|gb|EEM43340.1| Quinol oxidase subunit 3 [Bacillus thuringiensis serovar sotto str.
           T04001]
          Length = 200

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 71/179 (39%), Positives = 107/179 (59%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C   
Sbjct: 22  LGFWIFLGAEIMLFATLFASYLVLAGRTADGPTPAQLFELKTLLIQTLLLLTSSFTCGIV 81

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +            + W ++T   G  F+  EI EF   I   A  Q SAFLS+FF L+G 
Sbjct: 82  IHEMRKHNQK-AMLGWFVLTLLLGAGFLFFEIEEFIMYIGEGATIQTSAFLSAFFVLLGT 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+IW   ++IQILK+GL     R++  +S++WHFLDL+W+ +++ VYL G+V
Sbjct: 141 HGAHVTGGIIWAICVIIQILKRGLTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMV 199


>gi|119509088|ref|ZP_01628239.1| cytochrome c oxidase subunit III [Nodularia spumigena CCY9414]
 gi|119466254|gb|EAW47140.1| cytochrome c oxidase subunit III [Nodularia spumigena CCY9414]
          Length = 204

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 48/194 (24%), Positives = 86/194 (44%), Gaps = 5/194 (2%)

Query: 15  FYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVFDISG 73
            +    +    +      GF ++L+S+ ++F  FF  Y V         PA +   +I  
Sbjct: 14  HHHPGVEHEHDEEGNKMFGFIVFLLSESVIFLSFFAGYIVYKTTTPNWLPAGVSGLEIRE 73

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
             ++T++L+ SS     A  A     L      +L  T   G  F++ +  E++   ++E
Sbjct: 74  PAINTVILVSSSFVIYLAERALQNHNLK-GFRIYLAATMAMGSYFLVGQGIEWS---NLE 129

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
                  +   F+ L G HGLHVF G++   ++ ++    G        +   S+FWHF+
Sbjct: 130 FGFTSGVYGGMFYLLTGFHGLHVFTGILLQAIIFVRSYLPGNYDSGHYGVNATSLFWHFV 189

Query: 194 DLIWICVFSFVYLM 207
           D+IWI +F  +YL 
Sbjct: 190 DVIWIVLFILIYLW 203


>gi|325522319|gb|EGD00931.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia sp. TJI49]
          Length = 202

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 99/195 (50%), Positives = 129/195 (66%), Gaps = 7/195 (3%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            D          +  GFW+YLM+DC++FA  F T+AVLG  YA G    ++FDI G+ V 
Sbjct: 13  HDDHPP----SHSVFGFWLYLMTDCVIFAALFATFAVLGHQYAGGQTAKELFDIPGVAVE 68

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T  LLLSS++  FAML++  ++     + WL VT   G  F+ ME+ EF+HLI+  A PQ
Sbjct: 69  TAALLLSSITYGFAMLSA-YQQRRGALLGWLAVTFVLGAAFLAMELREFSHLIAEGAGPQ 127

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLICLSMFWHFLDL 195
           RSAFLS+FF LVG HGLHV  GL+W+ VL  QI+ +G  L   + RRL CLS+FWHFLD+
Sbjct: 128 RSAFLSAFFTLVGTHGLHVTAGLLWMVVLAAQIVSRGGDLTDRDLRRLTCLSLFWHFLDI 187

Query: 196 IWICVFSFVYLMGVV 210
           +WICVFSFVYL  V+
Sbjct: 188 VWICVFSFVYLASVI 202


>gi|218453788|gb|ACK76661.1| cytochrome oxidase subunit III [Peromyscus polionotus phasma]
          Length = 239

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 39/201 (19%), Positives = 80/201 (39%), Gaps = 15/201 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPID 67
                 + +   G   G  ++++S+             +    T+ + G     G  P++
Sbjct: 44  TYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLAPTHDLGGCWPPTGITPLN 103

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
             ++    ++T VLL S +S ++A  +        K  +         ++ I   I + +
Sbjct: 104 PLEVP--LLNTSVLLASGVSITWAHHSLMEG----KRSNMNQALLITILLGIYFTILQAS 157

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
                        + S+FF   G HGLHV  G  +L V +++ LK    S +       +
Sbjct: 158 EYFETPFSISDGVYGSTFFMATGFHGLHVIIGTTFLMVCLMRQLKYHFTSKHHFGFEAAA 217

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ ++  +Y  G
Sbjct: 218 WYWHFVDVVWLFLYVSIYWWG 238


>gi|146762391|gb|ABQ45329.1| cytochrome oxidase subunit 3 [Gymnadenia conopsea]
          Length = 233

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 42/197 (21%), Positives = 80/197 (40%), Gaps = 11/197 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA--VLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF  ++   L      G    P  I V D  
Sbjct: 41  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWAFSHSSLAPTVDIGGLRPPKGIGVLDPR 100

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +   + V  L+ T    ++F   +  E+     
Sbjct: 101 EIPFLNTPILPSSGAAVTWAHHALLAGKEK-RAVYALVATVSLALVFTGFQGMEY---YQ 156

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 157 APSTISDSLYGSTFFLATGFHGFHVIIGTLFLIICCIRQYLGHLTKEHHVGFEAAAWYWH 216

Query: 192 FLDLIWICVFSFVYLMG 208
           F+D++ +  F  +Y  G
Sbjct: 217 FVDVVRLFPFVSIYWWG 233


>gi|296492454|gb|ADH29753.1| cytochrome c oxidase subunit III [Peromyscus crinitus]
 gi|296492457|gb|ADH29755.1| cytochrome c oxidase subunit III [Peromyscus crinitus]
          Length = 255

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 39/201 (19%), Positives = 80/201 (39%), Gaps = 15/201 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPID 67
                 + +   G   G  ++++S+             +    T+ + G     G  P++
Sbjct: 60  TYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLAPTHDLGGCWPPTGITPLN 119

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
             ++    ++T VLL S +S ++A  +        K  +         ++ I   I + +
Sbjct: 120 PLEVP--LLNTSVLLASGVSITWAHHSLMEG----KRNNMNQALFITILLGIYFTILQAS 173

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
                        + S+FF   G HGLHV  G  +L V +++ LK    S +       +
Sbjct: 174 EYFETPFSISDGIYGSTFFMATGFHGLHVIIGSTFLMVCLLRQLKFHFTSKHHFGFEAAA 233

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ ++  +Y  G
Sbjct: 234 WYWHFVDVVWLFLYVSIYWWG 254


>gi|154685910|ref|YP_001421071.1| CtaE [Bacillus amyloliquefaciens FZB42]
 gi|154351761|gb|ABS73840.1| CtaE [Bacillus amyloliquefaciens FZB42]
          Length = 207

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 71/188 (37%), Positives = 113/188 (60%), Gaps = 2/188 (1%)

Query: 24  CVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLL 83
            ++    +LGFW++L  + ++FA  F T+  L ++ A GP+  ++F++  +F++T++LL 
Sbjct: 20  TLEGKNKFLGFWLFLGGETVLFASLFATFLALRESKAGGPSTAEMFELPIVFIATMLLLT 79

Query: 84  SSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME-AVPQRSAFL 142
           SSL+  +AM          K   WLLVT   G  F+ +EIYEF H           SA  
Sbjct: 80  SSLTSVYAMYHMKNFSFK-KMQVWLLVTVLLGAGFLGVEIYEFMHYTHEFGFTITSSALG 138

Query: 143 SSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFS 202
           S+F+ LVG HG HV FGL+W+  L+I+  K+GL   N  +    S++WHF+D++W+ +F+
Sbjct: 139 SAFYTLVGTHGAHVAFGLLWISALMIRNAKRGLSLYNAPKYYVASLYWHFIDVVWVFIFT 198

Query: 203 FVYLMGVV 210
            VYLMG+V
Sbjct: 199 VVYLMGMV 206


>gi|113972152|ref|YP_735945.1| cytochrome c oxidase subunit III [Shewanella sp. MR-4]
 gi|113886836|gb|ABI40888.1| cytochrome c oxidase, subunit III [Shewanella sp. MR-4]
          Length = 206

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 94/206 (45%), Positives = 133/206 (64%), Gaps = 1/206 (0%)

Query: 5   KIGKSPNFSLFYVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPA 64
            +    +  + + ++  E       T  GFW+YLM+DC++FA  F TYAVL  N   G +
Sbjct: 2   SVAIPADLEVAHAEEHHEHHDTGGNTLFGFWLYLMTDCILFASVFATYAVLYMNTDGGVS 61

Query: 65  PIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIY 124
             D+F++  + + T  LLLSS++  FA L  A +     T++WL +T   G +FI ME+Y
Sbjct: 62  GKDIFELDFVLIETAALLLSSITYGFA-LIFAKRHNKAATLTWLAITFALGCVFIGMEVY 120

Query: 125 EFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLI 184
           EF HLI     PQRSAFLSSFF LVG+HGLHV  GLIW+ +++I++ K GL + +  RL 
Sbjct: 121 EFHHLIEHGNGPQRSAFLSSFFTLVGMHGLHVTAGLIWMAIMMIEVGKTGLGNRSITRLS 180

Query: 185 CLSMFWHFLDLIWICVFSFVYLMGVV 210
           CLS+FWHFLD++WICVF+ VYL+G +
Sbjct: 181 CLSLFWHFLDIVWICVFTVVYLLGAL 206


>gi|260769715|ref|ZP_05878648.1| cytochrome O ubiquinol oxidase subunit III [Vibrio furnissii CIP
           102972]
 gi|260615053|gb|EEX40239.1| cytochrome O ubiquinol oxidase subunit III [Vibrio furnissii CIP
           102972]
 gi|315182289|gb|ADT89202.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio furnissii NCTC
           11218]
          Length = 200

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 97/179 (54%), Positives = 121/179 (67%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
            GFWIYLMSDC++FA  F T+AVL    A GP   ++F++  +F  T++LL SS++  F 
Sbjct: 22  FGFWIYLMSDCVLFASLFATFAVLSNATAGGPTGKELFELPFVFAETMLLLFSSITFGFG 81

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           M+A   K  I     WL VT   G  FI ME+YEF HLI+  A PQRSAFLS+FF LVG 
Sbjct: 82  MIAMKRKD-IAGLKRWLAVTFLLGAGFIGMELYEFHHLIAEGAGPQRSAFLSAFFTLVGT 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HGLHV FGLIWL V   Q+  KGL    + R  CLS+FWHFLD++WICVF+ VYL+GV+
Sbjct: 141 HGLHVTFGLIWLAVCYWQLNTKGLNDMMETRFNCLSLFWHFLDIVWICVFTIVYLLGVM 199


>gi|156976718|ref|YP_001447624.1| cytochrome o ubiquinol oxidase, subunit III [Vibrio harveyi ATCC
           BAA-1116]
 gi|156528312|gb|ABU73397.1| hypothetical protein VIBHAR_05493 [Vibrio harveyi ATCC BAA-1116]
          Length = 199

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 96/182 (52%), Positives = 119/182 (65%), Gaps = 1/182 (0%)

Query: 29  GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSC 88
               GFW+YLMSDC++FA  F TYAVL     AGP   D+F++  +FV T++LL SS++ 
Sbjct: 19  NKLFGFWVYLMSDCVLFATLFATYAVLESGSIAGPTGKDIFELPFVFVETMLLLFSSITF 78

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            F M+A   K  +     WL VT   G+ FI ME+YEF HLI     PQ SAFLS+FF L
Sbjct: 79  GFGMIAMKRKD-VAGLKRWLKVTFLLGLGFICMEVYEFHHLIEEGYGPQESAFLSAFFTL 137

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           VG HGLHV FGLIWL V   Q+  KGL      R  CLS+FWHFLD++WICVF+ VYL+G
Sbjct: 138 VGTHGLHVTFGLIWLAVGYHQLSTKGLNDNMSMRFQCLSLFWHFLDIVWICVFTIVYLLG 197

Query: 209 VV 210
           V+
Sbjct: 198 VM 199


>gi|75812459|ref|YP_320078.1| cytochrome c oxidase subunit III [Anabaena variabilis ATCC 29413]
 gi|75705215|gb|ABA24889.1| cytochrome c oxidase subunit III [Anabaena variabilis ATCC 29413]
          Length = 206

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 48/192 (25%), Positives = 89/192 (46%), Gaps = 5/192 (2%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAG-PAPIDVFDISGIF 75
            +  + +  +   +  GF ++L+S+ ++F  FF  Y V         P  ++  ++    
Sbjct: 18  TRTVEHTHDEAANSMFGFIVFLLSESIIFLSFFAGYIVYKTTTPDWLPPGVEGLEVREPA 77

Query: 76  VSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAV 135
           ++T++L+ SS    FA LA     +        L T   G  F+  +  E++   S+   
Sbjct: 78  INTVILVSSSFVIYFAELALKRHNM-WGFRLLWLTTMMMGSYFLYGQAVEWS---SLHFT 133

Query: 136 PQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDL 195
                F   F+ L G HGLHVF G++   +++++ L  G        +   S+FWHF+D+
Sbjct: 134 VTSGVFGGMFYLLTGFHGLHVFTGVLLQLIMLVRSLIPGNYDKGHFGVDATSLFWHFVDV 193

Query: 196 IWICVFSFVYLM 207
           IWI +F  +Y+ 
Sbjct: 194 IWIILFLLIYIW 205


>gi|254247835|ref|ZP_04941156.1| Cytochrome C oxidase subunit III [Burkholderia cenocepacia PC184]
 gi|124872611|gb|EAY64327.1| Cytochrome C oxidase subunit III [Burkholderia cenocepacia PC184]
          Length = 202

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 99/195 (50%), Positives = 130/195 (66%), Gaps = 7/195 (3%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            D          +  GFW+YLM+DC++FA  F T+AVLG  YA G    ++FDI G+ V 
Sbjct: 13  HDDHPP----SHSVFGFWLYLMTDCVIFAALFATFAVLGHQYAGGQTAKELFDIPGVAVE 68

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T  LLLSS++  FAMLA+  ++     ++WL VT   G  F+ ME+ EF+HL++  A PQ
Sbjct: 69  TAALLLSSITYGFAMLAA-YQQRRGALLAWLAVTFVLGAAFLTMELREFSHLVAEGAGPQ 127

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLICLSMFWHFLDL 195
           RSAFLS+FF LVG HGLHV  GL+W+ VL  QI+ +G  L   + RRL CLS+FWHFLD+
Sbjct: 128 RSAFLSAFFTLVGTHGLHVTAGLLWMIVLAAQIVLRGGDLTDRDLRRLTCLSLFWHFLDI 187

Query: 196 IWICVFSFVYLMGVV 210
           +WICVFSFVYL  V+
Sbjct: 188 VWICVFSFVYLASVI 202


>gi|218453780|gb|ACK76657.1| cytochrome oxidase subunit III [Peromyscus polionotus niveiventris]
          Length = 243

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 39/201 (19%), Positives = 80/201 (39%), Gaps = 15/201 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPID 67
                 + +   G   G  ++++S+             +    T+ + G     G  P++
Sbjct: 48  TYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLAPTHDLGGCWPPTGITPLN 107

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
             ++    ++T VLL S +S ++A  +        K  +         ++ I   I + +
Sbjct: 108 PLEVP--LLNTSVLLASGVSITWAHHSLMEG----KRSNMNQALLITILLGIYFTILQAS 161

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
                        + S+FF   G HGLHV  G  +L V +++ LK    S +       +
Sbjct: 162 EYFETPFSISDGVYGSTFFMATGFHGLHVIIGTTFLMVCLMRQLKYHFTSKHHFGFEAAA 221

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ ++  +Y  G
Sbjct: 222 WYWHFVDVVWLFLYVSIYWWG 242


>gi|237880825|ref|YP_002907471.1| cytochrome c oxidase subunit III [Notopterus notopterus]
 gi|237648844|dbj|BAH58941.1| cytochrome c oxidase subunit III [Notopterus notopterus]
          Length = 261

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 42/198 (21%), Positives = 80/198 (40%), Gaps = 15/198 (7%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPIDVFD 70
              +     G   G  +++ S+             +    T  + G     G AP+D F+
Sbjct: 69  GHHTPPVQKGLRFGMILFITSEVFFFLGFFWAFFHSSLAPTPELGGCWPPTGIAPLDPFE 128

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
           +    ++T VLL S ++ ++A  +             L +T   G  F  ++  E+    
Sbjct: 129 VP--LLNTAVLLASGVTVTWAHHSLMEGARKEAV-QSLALTILLGCYFTALQAMEY---Y 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                     + S+FF   G HGLHV  G  +L V +++ +K    S +       + +W
Sbjct: 183 EAPFTIADGVYGSTFFVATGFHGLHVIVGTSFLAVCLLRQIKYHFTSQHHFGFEAAAWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  +Y  G
Sbjct: 243 HFVDVVWLFLYVSIYWWG 260


>gi|7580470|ref|NP_037655.1|COX3_15261 cytochrome c oxidase subunit III [Talpa europaea]
 gi|6851072|emb|CAB71165.1| cytochrome oxidase subunit III [Talpa europaea]
          Length = 261

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 44/199 (22%), Positives = 85/199 (42%), Gaps = 15/199 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPIDVF 69
               + +   G   G  ++++S+             +    T+ + G    AG  P++  
Sbjct: 68  QGHHTPIVQKGLRYGMILFIISEVFFFAGFFWAFYHSSLAPTHELGGFWPPAGIHPLNPL 127

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           ++    ++T VLL S +S ++A  +       H  +  L +T   G+ F +++  E+   
Sbjct: 128 EVP--LLNTSVLLASGVSITWAHHSLMEGNRKH-MIQALFITIALGVYFTVLQAAEY--- 181

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                      + S+FF   G HGLHV  G  +L V  I+ LK    S +       + +
Sbjct: 182 YEAPFTISDGVYGSTFFMATGFHGLHVIIGTTFLTVCFIRQLKYHFTSKHHFGFEAAAWY 241

Query: 190 WHFLDLIWICVFSFVYLMG 208
           WHF+D++W+ ++  +Y  G
Sbjct: 242 WHFVDVVWLFLYVSIYWWG 260


>gi|194739369|gb|ACF94329.1| cytochrome c oxidase subunit III [Naja atra]
          Length = 261

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 38/198 (19%), Positives = 75/198 (37%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF     +             P  I+  +
Sbjct: 66  TYQGHHTEGVQMNMRYGMILFITSEVFFFLGFFWALYHVSLVPTPELGAEWPPTGINPLN 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +  K    + +  L++T   G+ F  +++ E+    
Sbjct: 126 PMEVPLLNTAVLLSSGATITWSHHTLMKGNKKEAIYALIITVVLGVYFTALQLSEYQ--- 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L V ++++ +      +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMIGTSFLLVCLMRMTRSHFTMTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDVVWLFLYISVYWWG 260


>gi|156878363|ref|YP_001434494.1| cytochrome c oxidase subunit III [Agkistrodon piscivorus]
 gi|94537510|gb|ABF29840.1| cytochrome c oxidase subunit 3 [Agkistrodon piscivorus]
          Length = 261

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 39/198 (19%), Positives = 77/198 (38%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF T   +             P  I+  +
Sbjct: 66  TYQGHHTLGVQKNMRYGMILFITSEVFFFLGFFWTLYHVSLVPTPELGAEWPPTGINPLN 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +  K    +    L++T   G+ F  +++ E+    
Sbjct: 126 PMDVPLLNTAVLLSSGATITWSHHTMMKGHKKEATYALMITIALGIYFTALQMSEYM--- 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L V ++++++    + +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMIGTSFLSVCLVRLIQFHFTTTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDIVWLFLYVSVYWWG 260


>gi|57281931|emb|CAD19452.1| cytochrome oxidase subunit 3 [Muscari botryoides]
          Length = 265

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 81/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGYHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T++L  S  + ++A  A    +   + V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTLILPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYWWGGI 265


>gi|237869134|ref|YP_002907458.1| cytochrome c oxidase subunit III [Chitala ornata]
 gi|237648830|dbj|BAH58928.1| cytochrome c oxidase subunit III [Chitala ornata]
          Length = 261

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 42/198 (21%), Positives = 80/198 (40%), Gaps = 15/198 (7%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPIDVFD 70
              +     G   G  +++ S+             +    T  + G     G AP+D F+
Sbjct: 69  GHHTPPVQKGLRFGMILFITSEVFFFLGFFWAFFHSSLAPTPELGGCWPPTGIAPLDPFE 128

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
           +    ++T VLL S ++ ++A  +             L +T   G  F  ++  E+    
Sbjct: 129 VP--LLNTAVLLASGVTVTWAHHSLMEGARKEAV-QSLALTILLGCYFTALQAMEY---Y 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                     + S+FF   G HGLHV  G  +L V +++ +K    S +       + +W
Sbjct: 183 EAPFTIADGVYGSTFFVATGFHGLHVIVGTTFLTVCLLRQIKYHFTSQHHFGFEAAAWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  +Y  G
Sbjct: 243 HFVDVVWLFLYVSIYWWG 260


>gi|218453796|gb|ACK76665.1| cytochrome oxidase subunit III [Peromyscus polionotus sumneri]
 gi|218453798|gb|ACK76666.1| cytochrome oxidase subunit III [Peromyscus polionotus sumneri]
 gi|218453804|gb|ACK76669.1| cytochrome oxidase subunit III [Peromyscus polionotus allophrys]
 gi|218453806|gb|ACK76670.1| cytochrome oxidase subunit III [Peromyscus polionotus allophrys]
 gi|218453812|gb|ACK76673.1| cytochrome oxidase subunit III [Peromyscus polionotus ammobates]
 gi|218453814|gb|ACK76674.1| cytochrome oxidase subunit III [Peromyscus polionotus ammobates]
 gi|218453816|gb|ACK76675.1| cytochrome oxidase subunit III [Peromyscus polionotus ammobates]
          Length = 253

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 39/201 (19%), Positives = 80/201 (39%), Gaps = 15/201 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPID 67
                 + +   G   G  ++++S+             +    T+ + G     G  P++
Sbjct: 58  TYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLAPTHDLGGCWPPTGITPLN 117

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
             ++    ++T VLL S +S ++A  +        K  +         ++ I   I + +
Sbjct: 118 PLEVP--LLNTSVLLASGVSITWAHHSLMEG----KRSNMNQALLITILLGIYFTILQAS 171

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
                        + S+FF   G HGLHV  G  +L V +++ LK    S +       +
Sbjct: 172 EYFETPFSISDGVYGSTFFMATGFHGLHVIIGTTFLMVCLMRQLKYHFTSKHHFGFEAAA 231

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ ++  +Y  G
Sbjct: 232 WYWHFVDVVWLFLYVSIYWWG 252


>gi|218453792|gb|ACK76663.1| cytochrome oxidase subunit III [Peromyscus polionotus polionotus]
 gi|218453794|gb|ACK76664.1| cytochrome oxidase subunit III [Peromyscus polionotus polionotus]
          Length = 243

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 39/201 (19%), Positives = 80/201 (39%), Gaps = 15/201 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPID 67
                 + +   G   G  ++++S+             +    T+ + G     G  P++
Sbjct: 48  TYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLAPTHDLGGCWPPTGITPLN 107

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
             ++    ++T VLL S +S ++A  +        K  +         ++ I   I + +
Sbjct: 108 PLEVP--LLNTSVLLASGVSITWAHHSLMEG----KRSNMNQALLITILLGIYFTILQAS 161

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
                        + S+FF   G HGLHV  G  +L V +++ LK    S +       +
Sbjct: 162 EYFETPFSISDGVYGSTFFMATGFHGLHVIIGTTFLMVCLMRQLKYHFTSKHHFGFEAAA 221

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ ++  +Y  G
Sbjct: 222 WYWHFVDVVWLFLYVSIYWWG 242


>gi|218453790|gb|ACK76662.1| cytochrome oxidase subunit III [Peromyscus polionotus polionotus]
          Length = 243

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 39/201 (19%), Positives = 80/201 (39%), Gaps = 15/201 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPID 67
                 + +   G   G  ++++S+             +    T+ + G     G  P++
Sbjct: 48  TYQGHHTPIVQKGLRYGMILFIVSEVFFFTGFFWAFYHSSLAPTHDLGGCWPPTGITPLN 107

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
             ++    ++T VLL S +S ++A  +        K  +         ++ I   I + +
Sbjct: 108 PLEVP--LLNTSVLLASGVSITWAHHSLMEG----KRSNMNQALLITILLGIYFTILQAS 161

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
                        + S+FF   G HGLHV  G  +L V +++ LK    S +       +
Sbjct: 162 EYFETPFSISDGVYGSTFFMATGFHGLHVIIGTTFLMVCLMRQLKYHFTSKHHFGFEAAA 221

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ ++  +Y  G
Sbjct: 222 WYWHFVDVVWLFLYVSIYWWG 242


>gi|251794162|ref|YP_003008893.1| cytochrome o ubiquinol oxidase subunit III [Paenibacillus sp.
           JDR-2]
 gi|247541788|gb|ACS98806.1| cytochrome o ubiquinol oxidase, subunit III [Paenibacillus sp.
           JDR-2]
          Length = 208

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 70/179 (39%), Positives = 110/179 (61%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFW++L++D ++F   F T++VL  +   GP P ++F++ G+   T +LL SS +   A
Sbjct: 31  LGFWMFLITDVILFGTLFATFSVLHNSTNGGPTPHEMFEMPGVIAETFILLTSSFTSGIA 90

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +L           + WL++TA  G  FI +E+ EF  ++        S + S+FF LVG 
Sbjct: 91  VLQMHKGNKK-GLIGWLIITALLGASFIFLEVSEFIKMVDEGVTIGTSGYWSAFFTLVGT 149

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HGLHV  GL W+  L+IQI K+G+    +R++  +S++WHFLD++WI V + VYLMGV+
Sbjct: 150 HGLHVSVGLCWMVGLMIQIGKRGITPVTKRKVTIVSLYWHFLDVVWIFVLTVVYLMGVM 208


>gi|165932821|ref|YP_001649610.1| cytochrome c oxidase polypeptide III [Rickettsia rickettsii str.
           Iowa]
 gi|165907908|gb|ABY72204.1| cytochrome c oxidase polypeptide III [Rickettsia rickettsii str.
           Iowa]
          Length = 308

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 46/206 (22%), Positives = 91/206 (44%), Gaps = 20/206 (9%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA--------------VLGKNYAAGPA 64
           + + +     G  +G  ++++++ + F VFF ++               V+ +     P 
Sbjct: 106 EHQHTSPVRKGLQIGMALFILTEIVFFGVFFASFLKSSLSPVGLLDGVWVVKQGIWPPPT 165

Query: 65  PIDVFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIY 124
                     F++T++LLLS  + ++A  A   K      V+ L +T   G+ F  M+ Y
Sbjct: 166 IKTFEPFDIPFINTLILLLSGTTVTWAHYALEEKNQKD-CVTALALTILLGIFFTTMQAY 224

Query: 125 EFAHLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGN--QRR 182
           E+    +         + S+F+   G HG HV  G I+L +   +  +    +       
Sbjct: 225 EY---YNAAFKFTDGIYASNFYLATGFHGAHVIIGTIFLIICYFRAKRGDFTTEGNGHLG 281

Query: 183 LICLSMFWHFLDLIWICVFSFVYLMG 208
             C + +WHF+D++W+ +F+FVY+ G
Sbjct: 282 FECAAWYWHFVDVVWLFLFTFVYIFG 307


>gi|155970514|gb|ABU41863.1| cytochrome c oxidase subunit 3 [Agkistrodon piscivorus]
          Length = 261

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 39/198 (19%), Positives = 77/198 (38%), Gaps = 9/198 (4%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNY------AAGPAPIDVFD 70
                 +         G  +++ S+   F  FF T   +             P  I+  +
Sbjct: 66  TYQGHHTLGVQKNMRYGMILFITSEVFFFLGFFWTLYHVSFVPTPELGAEWPPTGINPLN 125

Query: 71  ISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLI 130
              + +    +LLSS +       +  K    +    L++T   G+ F  +++ E+    
Sbjct: 126 PMDVPLLNTAVLLSSGATITWSHHTMMKGHKKEATYALMITIALGVYFTALQVSEYM--- 182

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
                   S + S FF   G HGLHV  G  +L V ++++++    + +         +W
Sbjct: 183 ETPFTISDSVYGSLFFVATGFHGLHVMIGTSFLSVCLVRLIQFHFTTTHHFGYEAAIWYW 242

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ ++  VY  G
Sbjct: 243 HFVDIVWLFLYVSVYWWG 260


>gi|206560506|ref|YP_002231270.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           cenocepacia J2315]
 gi|198036547|emb|CAR52444.1| cytochrome o ubiquinol oxidase subunit III [Burkholderia
           cenocepacia J2315]
          Length = 202

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 101/195 (51%), Positives = 130/195 (66%), Gaps = 7/195 (3%)

Query: 18  KDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVS 77
            D          +  GFW+YLM+DC++FA  F T+AVLG  YA G    ++FDI G+ V 
Sbjct: 13  HDDHPP----SHSVFGFWLYLMTDCVIFAALFATFAVLGHQYAGGQTAKELFDIPGVAVE 68

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T  LLLSS++  FAMLA+  K+     ++WL VT   G  F+ ME+ EF+HLI+  A PQ
Sbjct: 69  TAALLLSSITYGFAMLAA-YKQQRGALLAWLAVTFVLGAAFLAMELREFSHLIAEGAGPQ 127

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKG--LISGNQRRLICLSMFWHFLDL 195
           RSAFLS+FF LVG HGLHV  GL+W+ VL  QI+ +G  L   + RRL CLS+FWHFLD+
Sbjct: 128 RSAFLSAFFTLVGTHGLHVTAGLLWMLVLAAQIVFRGGDLTDRDLRRLTCLSLFWHFLDI 187

Query: 196 IWICVFSFVYLMGVV 210
           +WICVFSFVYL  V+
Sbjct: 188 VWICVFSFVYLASVI 202


>gi|17546579|ref|NP_519981.1| transmembrane cytochrome O ubiquinol oxidase (subunit III)
           oxidoreductase [Ralstonia solanacearum GMI1000]
 gi|17428878|emb|CAD15562.1| probable transmembrane cytochrome o ubiquinol oxidase (subunit III)
           oxidoreductase protein [Ralstonia solanacearum GMI1000]
          Length = 208

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 92/193 (47%), Positives = 122/193 (63%), Gaps = 4/193 (2%)

Query: 17  VKDKKESCVDHD---GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISG 73
             +       HD    T LGFW+YLMSDCL+FAV F T+ VL  + A GP    +F++  
Sbjct: 13  APEAAHPHPHHDTGFNTTLGFWLYLMSDCLIFAVLFATFGVLSGSTAGGPGGRQLFELPF 72

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           +   T++LL+SS +   A+L         + V WL VT   G +F+ ME+YEF+HL+   
Sbjct: 73  VLAETMLLLVSSYTFGIALL-KQDADAAPRMVRWLGVTFLLGALFVGMELYEFSHLLHEG 131

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
           A P  SA+LS+FF LVG HGLHV  GL+WL V++ Q+   GL    +RRL CLS+FWHFL
Sbjct: 132 AGPGVSAYLSAFFTLVGTHGLHVTAGLLWLAVMMHQVRHFGLDGVVRRRLACLSLFWHFL 191

Query: 194 DLIWICVFSFVYL 206
           DL+WICVF+FVYL
Sbjct: 192 DLVWICVFTFVYL 204


>gi|57282271|emb|CAD32364.1| cytochrome oxidase subunit 3 [Veratrum latifolium]
          Length = 265

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 80/199 (40%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGHHTKAVQLGPRYGSILFIVSEVMFLFAFFWASFHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T +L  S  + ++A  A    +     V  L+ T    ++    +  E+     
Sbjct: 131 EIPFLNTPILPSSGAAVTWAHHAILAGKEK-GAVYALVATVSLALVSTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF+  G HG HV  G ++L +  I+     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFSATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ +  F  +Y  G +
Sbjct: 247 FVDVVRLFPFVSIYRWGGI 265


>gi|57282235|emb|CAD32346.1| cytochrome oxidase subunit 3 [Spiranthes spiralis]
          Length = 265

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 83/199 (41%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVT--YAVLGKNYAAG----PAPIDVFDI- 71
           +   +     G   G  ++++S+ +    FF    ++ L      G    P  I V D  
Sbjct: 71  EGYHTKAVQLGPRYGSILFIVSEVMFLFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPR 130

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T++L  S  + ++A  A    +   + V  L+ T    ++F   +  E+     
Sbjct: 131 EIPFLNTLILPSSGAAVTWAHHAILAGKEK-RAVYALVATVSLALVFTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
             +    S + S+FF   G HG HV  G ++L +  ++     L   +       + +WH
Sbjct: 187 APSTISDSIYGSTFFLATGFHGFHVIIGTLFLIICCLRQYLGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++ + +F  +Y  G +
Sbjct: 247 FVDVVRLFLFVSIYWWGGI 265


>gi|163745862|ref|ZP_02153221.1| cytochrome c oxidase, subunit III [Oceanibulbus indolifex HEL-45]
 gi|161380607|gb|EDQ05017.1| cytochrome c oxidase, subunit III [Oceanibulbus indolifex HEL-45]
          Length = 268

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 46/198 (23%), Positives = 89/198 (44%), Gaps = 9/198 (4%)

Query: 20  KKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYA--------VLGKNYAAGPAPIDVFDI 71
              + V   G   GF +++MS+ + F  +F ++             +    P    V   
Sbjct: 69  GDHTGVVRIGLRYGFILFIMSEVMFFVAWFWSFFKQALYPMYEYAGSTYLKPEIHAVDAF 128

Query: 72  SGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL-I 130
               ++T+VLLLS  + ++A  A A +      ++ L +    G+ F  ++ +E+  L +
Sbjct: 129 HLPLINTLVLLLSGCAVTWAHHALAHENNRKDLIAGLAIAVVLGVFFTALQAFEYYELLV 188

Query: 131 SMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFW 190
             +       + SSFF   G HG HV  G I+LF+ +++ ++              + +W
Sbjct: 189 HDDWTFGGDMYFSSFFMATGFHGFHVIIGTIFLFICLLRAMRGHFTPERHVGFEAAAWYW 248

Query: 191 HFLDLIWICVFSFVYLMG 208
           HF+D++W+ +F  VY+ G
Sbjct: 249 HFVDVVWLFLFFAVYMWG 266


>gi|229101461|ref|ZP_04232202.1| Quinol oxidase subunit 3 [Bacillus cereus Rock3-28]
 gi|228681949|gb|EEL36085.1| Quinol oxidase subunit 3 [Bacillus cereus Rock3-28]
          Length = 200

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 70/179 (39%), Positives = 107/179 (59%), Gaps = 1/179 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++FA  F +Y VL    A GP P  +F++  + + T++LL SS +C   
Sbjct: 22  LGFWIFLGAEIMLFATLFASYLVLAGRTADGPTPAQLFELKTLLIQTLLLLTSSFTCGIV 81

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +            + W ++T   G  F+  EI EF   +   A  Q SAFLS+FF L+G 
Sbjct: 82  IHEMRKHNQK-AMLGWFILTLLLGAGFLFFEIEEFILYVGEGATIQTSAFLSAFFVLLGT 140

Query: 152 HGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMGVV 210
           HG HV  G+IW   ++IQILK+GL     R++  +S++WHFLDL+W+ +++ VYL G+V
Sbjct: 141 HGAHVTGGIIWAICVIIQILKRGLTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMV 199


>gi|207081107|gb|ACI22836.1| cytochrome c oxidase subunit III [Peromyscus polionotus subgriseus]
 gi|296492421|gb|ADH29731.1| cytochrome c oxidase subunit III [Peromyscus polionotus
           leucocephalus]
 gi|296492469|gb|ADH29763.1| cytochrome c oxidase subunit III [Peromyscus polionotus]
          Length = 255

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 39/201 (19%), Positives = 80/201 (39%), Gaps = 15/201 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPID 67
                 + +   G   G  ++++S+             +    T+ + G     G  P++
Sbjct: 60  TYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLAPTHDLGGCWPPTGITPLN 119

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
             ++    ++T VLL S +S ++A  +        K  +         ++ I   I + +
Sbjct: 120 PLEVP--LLNTSVLLASGVSITWAHHSLMEG----KRSNMNQALLITILLGIYFTILQAS 173

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
                        + S+FF   G HGLHV  G  +L V +++ LK    S +       +
Sbjct: 174 EYFETPFSISDGVYGSTFFMATGFHGLHVIIGTTFLMVCLMRQLKYHFTSKHHFGFEAAA 233

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ ++  +Y  G
Sbjct: 234 WYWHFVDVVWLFLYVSIYWWG 254


>gi|332974366|gb|EGK11294.1| cytochrome c oxidase, subunit III [Desmospora sp. 8437]
          Length = 207

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 63/192 (32%), Positives = 111/192 (57%), Gaps = 1/192 (0%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVST 78
           + +++ ++     +GFW++L ++  +FA     Y  L  ++  GP   ++F +  + +ST
Sbjct: 17  EPEKATLEGKNKIVGFWLFLAAESTLFATEMGAYVALKGSHLNGPPSQELFQLPMVALST 76

Query: 79  IVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQR 138
           ++LL+SSL+    +++  T     K ++W  +T   G  F+ +E YEF   +        
Sbjct: 77  LILLVSSLTSVLGVMSMHTGDAR-KMLTWFGLTVLLGAAFLGLETYEFMEYVHEGHTLTG 135

Query: 139 SAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWI 198
           SAF SSF+ L+G HG HV FG++W+  LVIQ  KKG+      +    S++WHF+D++WI
Sbjct: 136 SAFASSFYLLLGTHGAHVLFGVLWILGLVIQGAKKGITVHTAPKFYLASLYWHFIDVVWI 195

Query: 199 CVFSFVYLMGVV 210
            +F+ VYLMG++
Sbjct: 196 FIFTVVYLMGMI 207


>gi|323488486|ref|ZP_08093731.1| cytochrome c oxidase, subunit III [Planococcus donghaensis MPA1U2]
 gi|323397854|gb|EGA90655.1| cytochrome c oxidase, subunit III [Planococcus donghaensis MPA1U2]
          Length = 208

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 67/197 (34%), Positives = 110/197 (55%), Gaps = 3/197 (1%)

Query: 16  YVKDKKESCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAG--PAPIDVFDISG 73
           +    + + ++    ++GFW+ L ++ + FA  F TY  L     +G   +   +F++  
Sbjct: 12  WPDHPETATLEGKNKFVGFWLLLAAETVTFASLFATYLALKDKGPSGMEFSAAGLFELPL 71

Query: 74  IFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISME 133
           +F  T++LL SSL+  +AM             +WL +T   G+ F+ +EIYEF H + + 
Sbjct: 72  VFAMTMILLTSSLTSVYAMHHMKNYNFK-AMQAWLAITVLLGLTFLGLEIYEFNHYVHIG 130

Query: 134 AVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFL 193
                SAF S+FF LVG HG HV FGL W   L+++  K+GL   N  +    S++WHF+
Sbjct: 131 FGYTNSAFSSAFFTLVGTHGAHVLFGLSWFIALMLRNAKRGLNMYNAPKFYLASLYWHFI 190

Query: 194 DLIWICVFSFVYLMGVV 210
           D++W+ +F+ VYLMGV+
Sbjct: 191 DVVWVFIFTVVYLMGVI 207


>gi|205373048|ref|ZP_03225854.1| CtaE [Bacillus coahuilensis m4-4]
          Length = 216

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 62/189 (32%), Positives = 100/189 (52%), Gaps = 1/189 (0%)

Query: 23  SCVDHDGTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPA-PIDVFDISGIFVSTIVL 81
           + V     + GFW +L  + ++FA  F TY  L      G     ++FD+  +FV+T++L
Sbjct: 27  TNVRRKNKFYGFWFFLGGETVLFASLFATYLALKDKVLPGQKVAAEIFDLPLVFVATMLL 86

Query: 82  LLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAF 141
           L SSL+  +AM                +  A       +     + ++ +       SAF
Sbjct: 87  LTSSLTSVYAMHHMKNYNFRGMVAWLFITVALGAAFLGLEVYEFYHYVHAYGHTFTSSAF 146

Query: 142 LSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVF 201
            S+F+ALVG HGLHV FGL+W+  L+I+  K+GL   N  +    S++WHF+D++W+ +F
Sbjct: 147 GSAFYALVGTHGLHVAFGLLWITTLLIRNRKRGLSLYNAPKFYVASLYWHFIDVVWVFIF 206

Query: 202 SFVYLMGVV 210
           + VYLMG+V
Sbjct: 207 TVVYLMGLV 215


>gi|148978617|ref|ZP_01815044.1| cytochrome o ubiquinol oxidase, subunit III [Vibrionales bacterium
           SWAT-3]
 gi|145962283|gb|EDK27565.1| cytochrome o ubiquinol oxidase, subunit III [Vibrionales bacterium
           SWAT-3]
          Length = 205

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 95/182 (52%), Positives = 120/182 (65%), Gaps = 1/182 (0%)

Query: 29  GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSC 88
               GFW+YLMSDC++FA  F TYAVL     AGP   D+F++  +FV T++LL SS++ 
Sbjct: 25  NKLFGFWVYLMSDCVLFATLFATYAVLESGSIAGPTGKDIFELPFVFVETMMLLFSSITF 84

Query: 89  SFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFAL 148
            F M+A   +  +     WL VT   G+ FI ME+YEF HLI+    PQ SAFLS+FF L
Sbjct: 85  GFGMIAMKRQD-VAGLKKWLKVTFLLGLAFICMEVYEFHHLIAEGYGPQESAFLSAFFTL 143

Query: 149 VGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVFSFVYLMG 208
           VG HGLHV FGLIW+ V   Q+  KGL      R  CLS+FWHFLD++WICVF+ VYLMG
Sbjct: 144 VGTHGLHVTFGLIWMAVAYHQLSTKGLNDNMSMRFQCLSLFWHFLDIVWICVFTIVYLMG 203

Query: 209 VV 210
           V+
Sbjct: 204 VM 205


>gi|57282283|emb|CAD32370.1| cytochrome oxidase subunit 3 [Asphodelus sp. Quagliariello 16105]
          Length = 265

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 44/199 (22%), Positives = 86/199 (43%), Gaps = 11/199 (5%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLMFAV--FFVTYAVLGKNYAAG----PAPIDVFDIS 72
           +   +     G   GF ++++S+ + F    +  +++ L      G    P  I V D  
Sbjct: 71  EGYHTKAVQLGLRYGFILFIVSEVMFFFAFFWASSHSSLAPTVEIGGIWPPKGIGVLDPW 130

Query: 73  -GIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLIS 131
              F++T++L  S  + ++A  A    +   + V  L+ T    ++F   +  E+     
Sbjct: 131 EIPFLNTLILPSSGAAVTWAHHAILAGKEK-RAVYALIATVSLALVFTGFQGMEY---YQ 186

Query: 132 MEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWH 191
                  S + S+FF   G HG HV  G I+L +  I+  +  L   +       + +WH
Sbjct: 187 APFTISDSIYGSTFFLATGFHGFHVIIGTIFLIICGIRQYRGHLTKEHHVGFEAAAWYWH 246

Query: 192 FLDLIWICVFSFVYLMGVV 210
           F+D++W+ +F  +Y  G +
Sbjct: 247 FVDVVWLFLFVSIYWGGGI 265


>gi|112253881|ref|YP_717136.1| cytochrome c oxidase subunit 3 [Brassica napus]
 gi|37591083|dbj|BAC98885.1| cytochrome c oxidase subunit 3 [Brassica napus]
          Length = 265

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 42/201 (20%), Positives = 85/201 (42%), Gaps = 15/201 (7%)

Query: 19  DKKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPIDVF 69
           +   + V   G   GF ++++S+ +           +       + G     G   +D +
Sbjct: 71  EGHHTKVVQLGLRYGFILFIVSEVMFFFAFFWAFFHSSLAPAVEIGGIWPPKGIGVLDPW 130

Query: 70  DISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHL 129
           +I   F++T++LL S  + ++A  A    +   + V  L+ T    ++F   +  E+   
Sbjct: 131 EIP--FLNTLILLSSGAAVTWAHHAILAGKEK-RAVYALVATVLLALVFTGFQGMEY--- 184

Query: 130 ISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMF 189
                    S + S+FF   G HG HV  G ++L +  I+     L   +       + +
Sbjct: 185 YQAPFTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAAAWY 244

Query: 190 WHFLDLIWICVFSFVYLMGVV 210
           WHF+D++W+ +F  +Y  G +
Sbjct: 245 WHFVDVVWLFLFVSIYWWGGI 265


>gi|164519757|gb|ABY59927.1| cytochrome c oxidase subunit III [Homo sapiens]
          Length = 261

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 41/201 (20%), Positives = 82/201 (40%), Gaps = 15/201 (7%)

Query: 17  VKDKKESCVDHDGTYLGFWIYLMSDCLM---------FAVFFVTYAVLGKNYAAGPAPID 67
                 +     G   G  +++ S+             +    T  + G     G  P++
Sbjct: 66  TYQGHHTPPVQKGLRYGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGGHWPPTGITPLN 125

Query: 68  VFDISGIFVSTIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFA 127
             ++    ++T VLL S +S ++A  +       ++ +  LL+T   G+ F +++  E+ 
Sbjct: 126 PLEVP--LLNTSVLLASGVSITWAHHSLMENN-RNQMIQALLITILLGLYFTLLQASEY- 181

Query: 128 HLISMEAVPQRSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLS 187
                        + S+FF   G HGLHV  G  +L +  I+ L     S +       +
Sbjct: 182 --FESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKHHFGFEAAA 239

Query: 188 MFWHFLDLIWICVFSFVYLMG 208
            +WHF+D++W+ ++  +Y  G
Sbjct: 240 WYWHFVDVVWLFLYVSIYWWG 260


>gi|167463409|ref|ZP_02328498.1| cytochrome aa3 quinol oxidase (subunit III) [Paenibacillus larvae
           subsp. larvae BRL-230010]
          Length = 206

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 69/175 (39%), Positives = 106/175 (60%), Gaps = 1/175 (0%)

Query: 32  LGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAPIDVFDISGIFVSTIVLLLSSLSCSFA 91
           LGFWI+L ++ ++F+  F T+ VL    A GP P D+F+I G+ + T +LL SS +C  A
Sbjct: 28  LGFWIFLGAEIVLFSTLFATFMVLVNRVADGPTPQDLFEIKGVLIQTFLLLTSSFTCGIA 87

Query: 92  MLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQRSAFLSSFFALVGL 151
           +     + +    V WL++T   G+ F+  EI EF   +   A    SAF SSFF L G 
Sbjct: 88  VHELRRR