RPSBLAST alignment for GI: 254780472 and conserved domain: MTH00141

>gnl|CDD|177199 MTH00141, COX3, cytochrome c oxidase subunit III; Provisional. Length = 259
 Score = 64.5 bits (158), Expect = 2e-11
 Identities = 46/187 (24%), Positives = 86/187 (45%), Gaps = 17/187 (9%)

Query: 32  LGFWIYLMSDCLMFAVFFVTY--AVLGKNYAAG----PAPIDVFDISGI-FVSTIVLLLS 84
            GF ++++S+   F  FF  Y  + L  +   G    P  I+  +   +  ++T VLL S
Sbjct: 79  WGFILFIVSEVCFFFAFFWAYFHSSLAPSVEIGCCWPPVGIEPLNPFQVPLLNTAVLLAS 138

Query: 85  SLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFII---MEIYEFAHLISMEAVPQRSAF 141
            ++ ++A  +          +  L +T   G+ F      E YE +  I+         +
Sbjct: 139 GVTVTWAHHSLMEGDY-KSALQGLGLTIILGVYFTFLQAGEYYEASFSIA------DGVY 191

Query: 142 LSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVF 201
            S+FF L G HGLHV  G  +L V ++++L     + +       + +WHF+D++W+ ++
Sbjct: 192 GSTFFVLTGFHGLHVIIGTTFLLVCLVRLLLGHFSTNHHFGFEAAAWYWHFVDVVWLFLY 251

Query: 202 SFVYLMG 208
             +Y  G
Sbjct: 252 LSIYWWG 258