RPSBLAST alignment of GI: 254780472 and protein with PDBid: 1m56

>1m56_C Cytochrome C oxidase; membrane protein, oxidoreductase; HET: HEA PEH; 2.30A {Rhodobacter sphaeroides} SCOP: f.25.1.1 PDB: 1m57_C* Length = 266
 Score = 95.1 bits (236), Expect = 9e-21
 Identities = 43/191 (22%), Positives = 86/191 (45%), Gaps = 14/191 (7%)

Query: 29  GTYLGFWIYLMSDCLMFAVFFVTYAVLGKNYAAGPAP----------IDVFDISGI-FVS 77
           G   GF +++MS+ + F+ +F ++           +P          I  FD   +  ++
Sbjct: 78  GLRWGFILFIMSEVMFFSAWFWSFFKHALYPMGPESPIIDGIFPPEGIITFDPWHLPLIN 137

Query: 78  TIVLLLSSLSCSFAMLASATKRLIHKTVSWLLVTAFFGMIFIIMEIYEFAHLISMEAVPQ 137
           T++LL S  + ++A  A   +         L +    G +F + + YE++H         
Sbjct: 138 TLILLCSGCAATWAHHALVHENNRRDVAWGLALAIALGALFTVFQAYEYSH---AAFGFA 194

Query: 138 RSAFLSSFFALVGLHGLHVFFGLIWLFVLVIQILKKGLISGNQRRLICLSMFWHFLDLIW 197
            + + ++FF   G HG HV  G I+L V +I++ +                +WHF+D++W
Sbjct: 195 GNIYGANFFMATGFHGFHVIVGTIFLLVCLIRVQRGHFTPEKHVGFEAAIWYWHFVDVVW 254

Query: 198 ICVFSFVYLMG 208
           + +F+ +Y+ G
Sbjct: 255 LFLFASIYIWG 265