RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780474|ref|YP_003064887.1| ubiquinol oxidase, subunit II [Candidatus Liberibacter asiaticus str. psy62] (332 letters) >gnl|CDD|182518 PRK10525, PRK10525, cytochrome o ubiquinol oxidase subunit II; Provisional. Length = 315 Score = 315 bits (808), Expect = 1e-86 Identities = 133/315 (42%), Positives = 189/315 (60%), Gaps = 14/315 (4%) Query: 14 KSLKFFFLFFSSVMLSGFEFIVMDPYGDIALQQASLIRIAVALMLLIVVPVFFSILFFAW 73 KSL + LF +V+LSG ++DP G I L+Q SLI A LML++V+P + FAW Sbjct: 8 KSLGWLSLFAGTVLLSGCNSALLDPKGQIGLEQRSLILTAFGLMLIVVIPAILMAVGFAW 67 Query: 74 KYRSTNKKARYDPKWCHSTLLELFVWLVPLVIVGFLAVITWDATHRMDPYAPLERISESK 133 KYR++NK A+Y P W HS +E VW VP++I+ FLAV+TW TH ++P PL Sbjct: 68 KYRASNKDAKYSPNWSHSNKVEAVVWTVPILIIIFLAVLTWKTTHALEPSKPL------- 120 Query: 134 SIAKNSKPLVVEVVALDWKWLFLLPEQQVAIINELVVPIDRPLEFRITASSVMNSFYIPG 193 A + KP+ +EVV++DWKW F+ PEQ +A +NE+ P + P+ F++T++SVMNSF+IP Sbjct: 121 --AHDEKPITIEVVSMDWKWFFIYPEQGIATVNEIAFPANVPVYFKVTSNSVMNSFFIPR 178 Query: 194 LAGQIYAMAGMETKLHAVMNKKGAYSGFSANYSGRGFSHMRFKFYGK-SEKGFEDWISKV 252 L QIYAMAGM+T+LH + N+ G Y G SA+YSG GFS M+FK F+ W++K Sbjct: 179 LGSQIYAMAGMQTRLHLIANEPGTYDGISASYSGPGFSGMKFKAIATPDRAEFDQWVAKA 238 Query: 253 KRQGTFLNR-QEYLLLKKPSERDSVRYFSPIEKGLYYSILNLCVHPGK---ICMDEMMRI 308 K+ +N + L PSE + V YFS ++ L+ ++N + GK + E Sbjct: 239 KQSPNTMNDMAAFEKLAAPSEYNPVEYFSSVKPDLFKDVINKFMGHGKSMDMTQPEGEHS 298 Query: 309 DALGGGGMRGIDRHS 323 G GM S Sbjct: 299 AHEGMEGMDMSHAES 313 >gnl|CDD|130500 TIGR01433, CyoA, cytochrome o ubiquinol oxidase subunit II. This enzyme catalyzes the oxidation of ubiquinol with the concomitant reduction of molecular oxygen to water. This acts as the terminal electron acceptor in the respiratory chain. Subunit II is responsible for binding and oxidation of the ubiquinone substrate. This sequence is closely related to QoxA, which oxidizes quinol in gram positive bacteria but which is in complex with subunits which utilize cytochromes a in the reduction of molecular oxygen. Slightly more distantly related is subunit II of cytochrome c oxidase which uses cyt. c as the oxidant. Length = 226 Score = 314 bits (805), Expect = 3e-86 Identities = 124/235 (52%), Positives = 162/235 (68%), Gaps = 9/235 (3%) Query: 19 FFLFFSSVMLSGFEFIVMDPYGDIALQQASLIRIAVALMLLIVVPVFFSILFFAWKYRST 78 LF SV+LSG ++DP G I L++ SLI A LMLL+V+PV LFFAWKYR+T Sbjct: 1 LSLFAGSVLLSGCNSALLDPKGQIGLEERSLILTAFGLMLLVVIPVILMTLFFAWKYRAT 60 Query: 79 NKKARYDPKWCHSTLLELFVWLVPLVIVGFLAVITWDATHRMDPYAPLERISESKSIAKN 138 NK A Y P W HST +E+ VW +P++I+ FL V+TW TH++DPY PL + Sbjct: 61 NKDADYSPNWHHSTKIEIVVWTIPILIIIFLGVLTWITTHKLDPYRPLA---------SD 111 Query: 139 SKPLVVEVVALDWKWLFLLPEQQVAIINELVVPIDRPLEFRITASSVMNSFYIPGLAGQI 198 KP+ +EVVALDWKWLF+ PEQ +A +NE+ P++ P+ F+IT++SVMNSF+IP L QI Sbjct: 112 VKPITIEVVALDWKWLFIYPEQGIATVNEIAFPVNTPINFKITSNSVMNSFFIPQLGSQI 171 Query: 199 YAMAGMETKLHAVMNKKGAYSGFSANYSGRGFSHMRFKFYGKSEKGFEDWISKVK 253 YAMAGM+TKLH + N+ G Y G SANYSG GFS M+FK F+ W++KVK Sbjct: 172 YAMAGMQTKLHLIANEPGVYDGISANYSGPGFSGMKFKAIATDRAAFDQWVAKVK 226 >gnl|CDD|130499 TIGR01432, QOXA, cytochrome aa3 quinol oxidase, subunit II. This enzyme catalyzes the oxidation of quinol with the concomitant reduction of molecular oxygen to water. This acts as the terminal electron acceptor in the respiratory chain. This subunit contains two transmembrane helices and a large external domain responsible for the binding and oxidation of quinol. QuoX is (presently) only found in gram positive bacteria of the Bacillus/Staphylococcus group. Like CyoA, the ubiquinol oxidase found in proteobacteria, the residues responsible for the ligation of Cu(a) and cytochrome c (found in the related cyt. c oxidases) are absent. Unlike CyoA, QoxA is in complex with a subunit I which contains cytochromes a similar to the cyt. c oxidases (as opposed to cytochromes b). Length = 217 Score = 163 bits (413), Expect = 7e-41 Identities = 73/219 (33%), Positives = 114/219 (52%), Gaps = 9/219 (4%) Query: 35 VMDPYGDIALQQASLIRIAVALMLLIVVPVFFSILFFAWKYRSTNKKARYDPKWCHSTLL 94 V++P G +A Q+ LI ++ ML+IV VF F KYR Y PK + +L Sbjct: 8 VLNPKGPVASSQSDLILYSIVFMLVIVFVVFVLFTIFLVKYRYRKDNGAYSPKMHGNAIL 67 Query: 95 ELFVWLVPLVIVGFLAVITWDATHRMDPYAPLERISESKSIAKNSKPLVVEVVALDWKWL 154 E ++P++IV LA+ T + + ++ K P+VV + DWKW Sbjct: 68 ETIWTVIPIIIVIALAIPTVKTIYDYE---------KAPKSTKEKDPMVVYATSADWKWF 118 Query: 155 FLLPEQQVAIINELVVPIDRPLEFRITASSVMNSFYIPGLAGQIYAMAGMETKLHAVMNK 214 F P++ + +N L +P DRP+ F++ ++ M SF+IP L GQ YAM GM + ++ Sbjct: 119 FSYPDEHIETVNYLNIPKDRPVLFKLQSADTMTSFWIPQLGGQKYAMTGMTMNWYLQADQ 178 Query: 215 KGAYSGFSANYSGRGFSHMRFKFYGKSEKGFEDWISKVK 253 G Y G +AN++G GF+ F SEK F+ W+ + K Sbjct: 179 VGTYRGRNANFNGEGFADQTFDVNAVSEKDFDKWVKETK 217 >gnl|CDD|163049 TIGR02866, CoxB, cytochrome c oxidase, subunit II. Cytochrome c oxidase is the terminal electron acceptor of mitochondria (and one of several possible acceptors in prokaryotes) in the electron transport chain of aerobic respiration. The enzyme couples the oxidation of reduced cytochrome c with the reduction of molecular oxygen to water. This process results in the pumping of four protons across the membrane which are used in the proton gradient powered synthesis of ATP. The oxidase contains two heme a cofactors and three copper atoms as well as other bound ions. Length = 201 Score = 110 bits (276), Expect = 7e-25 Identities = 63/216 (29%), Positives = 100/216 (46%), Gaps = 18/216 (8%) Query: 38 PYGDIALQQASLIRIAVALMLLIVVPVFFSILFFAWKYRSTNKKARYDPKWCHSTLLELF 97 P G+IA Q A+L +A+ I + V + + WK+R + + K + LE + Sbjct: 1 PAGEIAEQIATLWLFLLAVATTISLLVAALLAYVVWKFRRKGDEEK-PSKIHGNRALE-Y 58 Query: 98 VWLV-PLVIVGFLAVITWDATHRMDPYAPLERISESKSIAKNSKPLVVEVVALDWKWLFL 156 W V PL+IV L T T ++ + ++ L V+V W W F Sbjct: 59 TWTVIPLIIVVGLIAATVLGTLYLE-----------RPPPED--ALKVKVEGHQWYWSFD 105 Query: 157 LPEQQVAI--INELVVPIDRPLEFRITASSVMNSFYIPGLAGQIYAMAGMETKLHAVMNK 214 PE + +NELVVP P+ ++T+ V++SF++P L G+I A+ G L ++ Sbjct: 106 YPESRRGFTTVNELVVPAGTPVRLQVTSKDVIHSFWVPELGGKIDAIPGQYNALWFNADE 165 Query: 215 KGAYSGFSANYSGRGFSHMRFKFYGKSEKGFEDWIS 250 G Y G+ A G G S M FK + F+ +I Sbjct: 166 PGVYYGYCAELCGAGHSLMLFKVVVVEREEFDAYIE 201 >gnl|CDD|148220 pfam06481, COX_ARM, COX Aromatic Rich Motif. COX2 (Cytochrome O ubiquinol OXidase 2) is a major component of the respiratory complex during vegetative growth. It transfers electrons from a quinol to the binuclear centre of the catalytic subunit 1. The function of this region is not known. Length = 47 Score = 56.0 bits (136), Expect = 1e-08 Identities = 20/47 (42%), Positives = 27/47 (57%) Query: 253 KRQGTFLNRQEYLLLKKPSERDSVRYFSPIEKGLYYSILNLCVHPGK 299 K L+R YL L KPSE + V YFS ++ GL+ I+N + GK Sbjct: 1 KASPKTLDRATYLALAKPSENNPVEYFSSVDPGLFDDIVNKYMGGGK 47 >gnl|CDD|147912 pfam06011, TRP, Transient receptor potential (TRP) ion channel. This family of proteins are transient receptor potential (TRP) ion channels. They are essential for cellular viability and are involved in cell growth and cell wall synthesis. The genes for these proteins are homologous to polycystic kidney disease related ion channel genes. Length = 532 Score = 32.2 bits (74), Expect = 0.18 Identities = 17/83 (20%), Positives = 29/83 (34%), Gaps = 12/83 (14%) Query: 6 NWMGVSVGKSLKFFFLFFSSVM-LSGFEFIVMDPYGDIALQQASLIRIAVALMLLIVVP- 63 W G L+ +FF ++ LS ++F D + L AV + L++ Sbjct: 295 KWWPFLKGTLLRLVLIFFPPIVILSLWQFTQADSAAAVVL--------AVVFLALLLGLL 346 Query: 64 --VFFSILFFAWKYRSTNKKARY 84 F ++ A K Y Sbjct: 347 GWAAFRVISIARKSVRLYGNPAY 369 >gnl|CDD|185413 PTZ00047, PTZ00047, cytochrome c oxidase subunit II; Provisional. Length = 162 Score = 32.1 bits (73), Expect = 0.23 Identities = 16/61 (26%), Positives = 34/61 (55%) Query: 160 QQVAIINELVVPIDRPLEFRITASSVMNSFYIPGLAGQIYAMAGMETKLHAVMNKKGAYS 219 +Q+ + L +P + F ITA+ V++S+ +P L + A+ G K++ + ++G + Sbjct: 67 RQLEVDKRLTLPTRTHIRFLITATDVIHSWSVPSLGIKADAIPGRLHKINTFILREGVFY 126 Query: 220 G 220 G Sbjct: 127 G 127 >gnl|CDD|116854 pfam08270, PRD_Mga, M protein trans-acting positive regulator (MGA) PRD domain. Mga is a DNA-binding protein that activates the expression of several important virulence genes in group A streptococcus in response to changing environmental conditions. This corresponds to the PRD like region. Length = 217 Score = 30.3 bits (69), Expect = 0.78 Identities = 14/38 (36%), Positives = 19/38 (50%) Query: 230 FSHMRFKFYGKSEKGFEDWISKVKRQGTFLNRQEYLLL 267 F FK Y +K EDW++++ G LN YLL Sbjct: 174 FYQGNFKLYKILKKIVEDWLAEIGGSGMLLNHHLYLLC 211 >gnl|CDD|177630 PHA03394, lef-8, DNA-directed RNA polymerase subunit beta-like protein; Provisional. Length = 865 Score = 28.7 bits (65), Expect = 2.2 Identities = 15/34 (44%), Positives = 20/34 (58%) Query: 277 RYFSPIEKGLYYSILNLCVHPGKICMDEMMRIDA 310 R SPIE L +IL + H G IC+ + +RID Sbjct: 427 RNRSPIELKLANNILFVNHHEGMICIKKKLRIDN 460 >gnl|CDD|185245 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional. Length = 921 Score = 28.5 bits (64), Expect = 2.8 Identities = 10/31 (32%), Positives = 15/31 (48%) Query: 107 GFLAVITWDATHRMDPYAPLERISESKSIAK 137 F+ +I ++P P R+ E SIAK Sbjct: 327 RFVDIINKTGPAALEPRLPENRLDELGSIAK 357 >gnl|CDD|179489 PRK02870, PRK02870, heat shock protein HtpX; Provisional. Length = 336 Score = 28.1 bits (63), Expect = 3.6 Identities = 13/45 (28%), Positives = 22/45 (48%) Query: 8 MGVSVGKSLKFFFLFFSSVMLSGFEFIVMDPYGDIALQQASLIRI 52 M + S+ F F +MLSG E+ + P ++LQ+ L + Sbjct: 76 MSLVAVISILVTFQNFDKIMLSGTEYKEITPENALSLQERQLYNV 120 >gnl|CDD|163155 TIGR03147, cyt_nit_nrfF, cytochrome c nitrite reductase, accessory protein NrfF. Length = 126 Score = 27.8 bits (62), Expect = 3.6 Identities = 11/37 (29%), Positives = 20/37 (54%), Gaps = 3/37 (8%) Query: 83 RYDPKWCHSTLLELFVWLVPLVIVGFLAVITWDATHR 119 Y+P + TLL +WL+P++++ V+ W R Sbjct: 92 LYNPPFKWQTLL---LWLLPVLLLLLAFVLLWRVRRR 125 >gnl|CDD|162509 TIGR01734, D-ala-DACP-lig, D-alanine--poly(phosphoribitol) ligase, subunit 1. This model represents the enzyme (also called D-alanine-D-alanyl carrier protein ligase) which activates D-alanine as an adenylate via the reaction D-ala + ATP -> D-ala-AMP + PPi, and further catalyzes the condensation of the amino acid adenylate with the D-alanyl carrier protein (D-ala-ACP). The D-alanine is then further transferred to teichoic acid in the biosynthesis of lipoteichoic acid (LTA) and wall teichoic acid (WTA) in gram positive bacteria, both polysacchatides. Length = 502 Score = 27.4 bits (61), Expect = 5.8 Identities = 20/91 (21%), Positives = 28/91 (30%), Gaps = 28/91 (30%) Query: 102 PLVIVGFLAVITWDATHR---MDPYAPLERISESKSIAKNSKPLVVEVVALDWKWLFLLP 158 P ++V FL I + H +D P ERI A LV+ L Sbjct: 61 PHMLVAFLGSIK--SGHAYIPVDTSIPSERIEMIIEAAG--PELVIHTAEL--------- 107 Query: 159 EQQVAIINELVVPIDRPLEFRITASSVMNSF 189 ID IT S++ + Sbjct: 108 ------------SIDAVGTQIITLSALEQAE 126 >gnl|CDD|152283 pfam11847, DUF3367, Domain of unknown function (DUF3367). This domain is functionally uncharacterized. This domain is found in bacteria and archaea. This presumed domain is typically between 667 to 694 amino acids in length. Length = 677 Score = 27.0 bits (60), Expect = 7.3 Identities = 17/65 (26%), Positives = 28/65 (43%), Gaps = 10/65 (15%) Query: 53 AVALMLLIVVPVFFSILFFAWKYRSTNKKARYDPKWCHSTLLELFVWLVPLVIVG----- 107 A A + ++ + + +L A R R W + LL W+VPL+++G Sbjct: 169 ATATLAALLPALLW-LLCHARGRR----WWRLLAWWLLAVLLASAWWIVPLLVLGRYGPP 223 Query: 108 FLAVI 112 FL I Sbjct: 224 FLDFI 228 >gnl|CDD|178837 PRK00068, PRK00068, hypothetical protein; Validated. Length = 970 Score = 26.5 bits (59), Expect = 8.8 Identities = 17/61 (27%), Positives = 28/61 (45%), Gaps = 7/61 (11%) Query: 59 LIVVPVFFSILFFAWKYR--STNKKARYDPKWCHSTLLE----LFVWLVPLVIVGFLAVI 112 L+V + F L+ A++ R K DP + ++E LF+ +P +G LA I Sbjct: 69 LLVGGIVFISLWLAYRSRPVFVPKADSNDPVARYRAVVEKRLRLFLIGIP-SFIGLLAGI 127 Query: 113 T 113 Sbjct: 128 F 128 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.326 0.141 0.437 Gapped Lambda K H 0.267 0.0744 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 5,624,289 Number of extensions: 364100 Number of successful extensions: 1086 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1075 Number of HSP's successfully gapped: 55 Length of query: 332 Length of database: 5,994,473 Length adjustment: 94 Effective length of query: 238 Effective length of database: 3,963,321 Effective search space: 943270398 Effective search space used: 943270398 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 57 (25.7 bits)