BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780475|ref|YP_003064888.1| 50S ribosomal protein L33 [Candidatus Liberibacter asiaticus str. psy62] (55 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780475|ref|YP_003064888.1| 50S ribosomal protein L33 [Candidatus Liberibacter asiaticus str. psy62] Length = 55 Score = 109 bits (272), Expect = 9e-27, Method: Compositional matrix adjust. Identities = 55/55 (100%), Positives = 55/55 (100%) Query: 1 MAKAATIKIKLISSAGTGSFYVTKKNSRTMSGKMVKNKYDPVIRKHVEFKEGKIK 55 MAKAATIKIKLISSAGTGSFYVTKKNSRTMSGKMVKNKYDPVIRKHVEFKEGKIK Sbjct: 1 MAKAATIKIKLISSAGTGSFYVTKKNSRTMSGKMVKNKYDPVIRKHVEFKEGKIK 55 >gi|255764476|ref|YP_003065238.2| two-component sensor histidine kinase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 792 Score = 22.7 bits (47), Expect = 1.1, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%) Query: 7 IKIKLISSAGTGSFYVTKKNSRTMSGKMVKNKYD 40 I+IK+IS GSF ++ + K++ N D Sbjct: 667 IRIKVISDGKLGSFVADRQRLLQIFSKILSNAMD 700 >gi|254780772|ref|YP_003065185.1| surface antigen (D15) [Candidatus Liberibacter asiaticus str. psy62] Length = 781 Score = 22.7 bits (47), Expect = 1.1, Method: Compositional matrix adjust. Identities = 8/15 (53%), Positives = 10/15 (66%) Query: 39 YDPVIRKHVEFKEGK 53 YD VIR+ +E EG Sbjct: 379 YDSVIRRELELSEGD 393 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.314 0.127 0.338 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,264 Number of Sequences: 1233 Number of extensions: 863 Number of successful extensions: 4 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 55 length of database: 328,796 effective HSP length: 27 effective length of query: 28 effective length of database: 295,505 effective search space: 8274140 effective search space used: 8274140 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.1 bits) S2: 31 (16.5 bits)