RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780478|ref|YP_003064891.1| hypothetical protein CLIBASIA_01815 [Candidatus Liberibacter asiaticus str. psy62] (161 letters) >gnl|CDD|34951 COG5389, COG5389, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 181 Score = 141 bits (357), Expect = 7e-35 Identities = 67/153 (43%), Positives = 95/153 (62%), Gaps = 4/153 (2%) Query: 5 SQVIDDLLDPFLRRRAGISMSLVSAWSEIVGSNIARCCRPEKIIWPNRTSIERQDISSDV 64 + V + +LDP LR+RAGI+ +L+ +W EI G +A RPE+IIWP R E Sbjct: 29 ADVANGILDPVLRKRAGINTALLQSWEEIAGDTLADRTRPERIIWPRRGREE----GPFQ 84 Query: 65 SGTLIIACEGSHALFLMHDQSKIIRNVNIFFGFCAIKRIRFLQRSMSIVNQAPSVSIPAL 124 G L+IACEG+ ALFL H+ +II VN F GF AI RIR +Q+ + + PS P L Sbjct: 85 PGVLVIACEGAAALFLQHETGEIIARVNGFLGFGAIGRIRIVQKPVKAPAKRPSTRPPPL 144 Query: 125 EKDDCEKIDKMTEGIKDEQLKRALIRFGHAVVG 157 + + +++D M EGI+D+ L++AL R G AV+ Sbjct: 145 DAAEEKRLDDMMEGIEDDALRQALERLGRAVLS 177 >gnl|CDD|147452 pfam05258, DUF721, Protein of unknown function (DUF721). This family contains several actinomycete proteins of unknown function. Length = 88 Score = 63.8 bits (156), Expect = 2e-11 Identities = 26/104 (25%), Positives = 45/104 (43%), Gaps = 17/104 (16%) Query: 3 HFSQVIDDLLDPFLRRRAGISMSLVSAWSEIVGSNIARCCRPEKIIWPNRTSIERQDISS 62 ++ +LL ++A L+ AW EIVG +A RP I Sbjct: 1 SLGDLLGELLKSRGLKKALALARLLQAWPEIVGPELAGHTRPVNI--------------- 45 Query: 63 DVSGTLIIACE-GSHALFLMHDQSKIIRNVNIFFGFCAIKRIRF 105 GTL++ + + A L + + +++ +N G A++RIRF Sbjct: 46 -RDGTLVVEVDSAAWATELRYQKPELLERLNERLGEEAVRRIRF 88 >gnl|CDD|146351 pfam03666, NPR3, Nitrogen Permease regulator of amino acid transport activity 3. This family, also known in yeasts as Rmd11, complexes with NPR2, pfam06218. This complex heterodimer is responsible for inactivating TORC1. an evolutionarily conserved protein complex that controls cell size via nutritional input signals, specifically, in response to amino acid starvation. Length = 424 Score = 29.7 bits (67), Expect = 0.39 Identities = 14/53 (26%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Query: 76 HALFLMHDQSKIIRNVNIF---FGFCAIKRIRFLQRSMSIVNQAPSVSIPALE 125 AL L+ D+ KII+++ K IR ++ + S++ A S +P + Sbjct: 260 FALLLLDDEKKIIKDLPTADSSPALALAKFIRHIKPTKSLLQLAQSSGLPLSQ 312 >gnl|CDD|29944 cd00951, KDGDH, 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases. The enzyme is involved in glucarate metabolism, and its mechanism presumbly involves a Schiff-base intermediate similar to members of DHDPS family. While in the case of Pseudomonas sp. 5-dehydro-4-deoxy-D-glucarate is degraded by KDGDH to 2,5-dioxopentanoate, in certain species of Enterobacteriaceae it is degraded instead to pyruvate and glycerate.. Length = 289 Score = 27.9 bits (62), Expect = 1.2 Identities = 10/35 (28%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Query: 6 QVIDDLLDPFLR---RRAGISMSLVSAWSEIVGSN 37 +++ D P++ RR G ++S+V A + +VG + Sbjct: 230 RLLRDFFLPYVDIRNRRKGYAVSIVKAGARLVGRD 264 >gnl|CDD|39753 KOG4553, KOG4553, KOG4553, Uncharacterized conserved protein [Function unknown]. Length = 1398 Score = 26.9 bits (59), Expect = 2.6 Identities = 9/29 (31%), Positives = 18/29 (62%) Query: 1 MIHFSQVIDDLLDPFLRRRAGISMSLVSA 29 +++ S+++D+L D R IS+ L+ A Sbjct: 479 ILNNSKLVDELFDYVCFMRGDISVRLIRA 507 >gnl|CDD|37820 KOG2609, KOG2609, KOG2609, Cyclin D-interacting protein GCIP [Cell cycle control, cell division, chromosome partitioning, RNA processing and modification]. Length = 228 Score = 26.1 bits (57), Expect = 4.1 Identities = 8/21 (38%), Positives = 13/21 (61%) Query: 126 KDDCEKIDKMTEGIKDEQLKR 146 K D E IDK+ + ++ + KR Sbjct: 158 KPDTEAIDKLVKDLEKQIKKR 178 >gnl|CDD|29465 cd02769, MopB_DMSOR-BSOR-TMAOR, The MopB_DMSOR-BSOR-TMAOR CD contains dimethylsulfoxide reductase (DMSOR), biotin sulfoxide reductase (BSOR), trimethylamine N-oxide reductase (TMAOR) and other related proteins. DMSOR always catalyzes the reduction of DMSO to dimethylsulfide, but its cellular location and oligomerization state are organism-dependent. For example, in Rhodobacter sphaeriodes and Rhodobacter capsulatus, it is an 82-kDa monomeric soluble protein found in the periplasmic space; in E. coli, it is membrane-bound and exists as a heterotrimer. BSOR catalyzes the reduction of biotin sulfixode to biotin, and is unique among Mo enzymes because no additional auxiliary proteins or cofactors are required. TMAOR is similar to DMSOR, but its only natural substrate is TMAO. Members of this CD belong to the molybdopterin_binding (MopB) superfamily of proteins.. Length = 609 Score = 25.5 bits (56), Expect = 7.0 Identities = 11/30 (36%), Positives = 14/30 (46%) Query: 42 CRPEKIIWPNRTSIERQDISSDVSGTLIIA 71 R I+ P TS+ER DI I+A Sbjct: 450 ARHADIVLPATTSLERNDIGGSGDNRYIVA 479 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.326 0.139 0.418 Gapped Lambda K H 0.267 0.0723 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,968,728 Number of extensions: 94132 Number of successful extensions: 239 Number of sequences better than 10.0: 1 Number of HSP's gapped: 237 Number of HSP's successfully gapped: 10 Length of query: 161 Length of database: 6,263,737 Length adjustment: 86 Effective length of query: 75 Effective length of database: 4,405,363 Effective search space: 330402225 Effective search space used: 330402225 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 53 (24.2 bits)