RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780478|ref|YP_003064891.1| hypothetical protein CLIBASIA_01815 [Candidatus Liberibacter asiaticus str. psy62] (161 letters) >gnl|CDD|185176 PRK15273, PRK15273, putative fimbrial outer membrane usher protein SteB; Provisional. Length = 881 Score = 27.8 bits (61), Expect = 1.2 Identities = 25/74 (33%), Positives = 30/74 (40%), Gaps = 21/74 (28%) Query: 9 DDLLDPFLRRRAGISMSLVSAWSEIVGSNIARCCRPEKIIWPNRTSIERQ---------D 59 D +L P LR A EIVG IAR K+ W R E Q D Sbjct: 261 DQMLPPKLRGYA----------PEIVG--IARSNAKVKVSWQGRVLYETQVPAGPFRIQD 308 Query: 60 ISSDVSGTLIIACE 73 ++ VSGTL + E Sbjct: 309 LNQSVSGTLHVTVE 322 >gnl|CDD|132293 TIGR03249, KdgD, 5-dehydro-4-deoxyglucarate dehydratase. 5-dehydro-4-deoxyglucarate dehydratase not only catalyzes the dehydration of the substrate (diol to ketone + water), but causes the decarboxylation of the intermediate product to yield 2-oxoglutarate semialdehyde (2,5-dioxopentanoate). The gene for the enzyme is usually observed in the vicinity of transporters and dehydratases handling D-galactarate and D-gluconate as well as aldehyde dehydrogenases which convert the product to alpha-ketoglutarate. Length = 296 Score = 26.6 bits (59), Expect = 3.2 Identities = 9/36 (25%), Positives = 18/36 (50%), Gaps = 3/36 (8%) Query: 6 QVIDDLLDPFL---RRRAGISMSLVSAWSEIVGSNI 38 ++ + + P R+ G ++S++ A EIVG Sbjct: 235 EIYKEFILPINEIRNRKKGYAVSIIKAGMEIVGLPA 270 >gnl|CDD|179610 PRK03620, PRK03620, 5-dehydro-4-deoxyglucarate dehydratase; Provisional. Length = 303 Score = 26.3 bits (59), Expect = 3.4 Identities = 10/31 (32%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Query: 8 IDDLLDPFLR---RRAGISMSLVSAWSEIVG 35 +DD P++ R+ G ++S+V A + +VG Sbjct: 239 LDDFFLPYVALRNRKKGYAVSIVKAGARLVG 269 >gnl|CDD|181345 PRK08274, PRK08274, tricarballylate dehydrogenase; Validated. Length = 466 Score = 26.0 bits (58), Expect = 4.2 Identities = 9/19 (47%), Positives = 12/19 (63%) Query: 132 IDKMTEGIKDEQLKRALIR 150 + ++T G DE L R LIR Sbjct: 75 LLRVTGGRTDEALARLLIR 93 >gnl|CDD|149819 pfam08878, DUF1837, Domain of unknown function (DUF1837). This family of proteins are functionally uncharacterized. Length = 236 Score = 26.1 bits (58), Expect = 4.8 Identities = 11/53 (20%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 99 AIKRIRFLQRSMSIVNQAPSVSIPALEKDDCEKIDKMTEGIKDEQLKRALIRF 151 AIK +L + + N+ +P L DC+ E + + K+ + Sbjct: 158 AIKD--YLDPNSPLDNKKNKRGVPCLIGFDCDAYPAHPEHQEIDDYKKEIKNE 208 >gnl|CDD|129695 TIGR00607, rad52, recombination protein rad52. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). Length = 161 Score = 25.2 bits (55), Expect = 7.9 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 8/38 (21%) Query: 123 ALEKDDCEKIDKMTEGIKDEQLKRALIRFGHAVVGCSY 160 A EK +K E + D LKRAL FG+A+ C Y Sbjct: 101 AFEK--AKK-----EAVTD-ALKRALRNFGNALGNCLY 130 >gnl|CDD|182977 PRK11121, nrdG, anaerobic ribonucleotide reductase-activating protein; Provisional. Length = 154 Score = 25.3 bits (56), Expect = 8.0 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 11/52 (21%) Query: 6 QVIDDLLDPFLRRRAGISMS--------LVSAWSEIVGSNIARCCRPEKIIW 49 Q+I DL D ++R+ G+S+S V ++V A C P K IW Sbjct: 54 QIIADLNDTRIKRQ-GLSLSGGDPLHPQNVPDILKLVQRVKAEC--PGKDIW 102 >gnl|CDD|151213 pfam10727, Rossmann-like, Rossmann-like domain. This family of proteins contain a Rossmann-like domain. Length = 111 Score = 24.9 bits (54), Expect = 9.9 Identities = 8/16 (50%), Positives = 8/16 (50%) Query: 144 LKRALIRFGHAVVGCS 159 L AL R GH V S Sbjct: 12 LGEALERAGHVVHAIS 27 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.326 0.139 0.418 Gapped Lambda K H 0.267 0.0715 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,636,946 Number of extensions: 154553 Number of successful extensions: 376 Number of sequences better than 10.0: 1 Number of HSP's gapped: 376 Number of HSP's successfully gapped: 14 Length of query: 161 Length of database: 5,994,473 Length adjustment: 86 Effective length of query: 75 Effective length of database: 4,136,185 Effective search space: 310213875 Effective search space used: 310213875 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 53 (24.2 bits)