BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780478|ref|YP_003064891.1| hypothetical protein CLIBASIA_01815 [Candidatus Liberibacter asiaticus str. psy62] (161 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780478|ref|YP_003064891.1| hypothetical protein CLIBASIA_01815 [Candidatus Liberibacter asiaticus str. psy62] Length = 161 Score = 329 bits (844), Expect = 1e-92, Method: Compositional matrix adjust. Identities = 161/161 (100%), Positives = 161/161 (100%) Query: 1 MIHFSQVIDDLLDPFLRRRAGISMSLVSAWSEIVGSNIARCCRPEKIIWPNRTSIERQDI 60 MIHFSQVIDDLLDPFLRRRAGISMSLVSAWSEIVGSNIARCCRPEKIIWPNRTSIERQDI Sbjct: 1 MIHFSQVIDDLLDPFLRRRAGISMSLVSAWSEIVGSNIARCCRPEKIIWPNRTSIERQDI 60 Query: 61 SSDVSGTLIIACEGSHALFLMHDQSKIIRNVNIFFGFCAIKRIRFLQRSMSIVNQAPSVS 120 SSDVSGTLIIACEGSHALFLMHDQSKIIRNVNIFFGFCAIKRIRFLQRSMSIVNQAPSVS Sbjct: 61 SSDVSGTLIIACEGSHALFLMHDQSKIIRNVNIFFGFCAIKRIRFLQRSMSIVNQAPSVS 120 Query: 121 IPALEKDDCEKIDKMTEGIKDEQLKRALIRFGHAVVGCSYL 161 IPALEKDDCEKIDKMTEGIKDEQLKRALIRFGHAVVGCSYL Sbjct: 121 IPALEKDDCEKIDKMTEGIKDEQLKRALIRFGHAVVGCSYL 161 >gi|255764476|ref|YP_003065238.2| two-component sensor histidine kinase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 792 Score = 24.6 bits (52), Expect = 0.90, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Query: 119 VSIPALEKDDCEKIDKMTEG-IKDEQLKRALIRFGHA 154 +S ALEK+ CE + + G K ++ R L FG A Sbjct: 253 ISSSALEKNFCETVSTLEHGNNKSYKIVRVLNSFGEA 289 >gi|254780669|ref|YP_003065082.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Liberibacter asiaticus str. psy62] Length = 301 Score = 21.6 bits (44), Expect = 8.2, Method: Compositional matrix adjust. Identities = 13/51 (25%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Query: 86 KIIRNVNIFFGFCAIKRIRFLQRSMSIVNQAPSVSIPALEKDDCEKIDKMT 136 +I R++ +GF + + Q+ +I + + IPAL C + D +T Sbjct: 105 EIFRDLKKKYGFPILTDVHTEQQCEAIADSVDILQIPALL---CRQTDLLT 152 >gi|254780965|ref|YP_003065378.1| hypothetical protein CLIBASIA_04330 [Candidatus Liberibacter asiaticus str. psy62] Length = 229 Score = 21.2 bits (43), Expect = 9.2, Method: Compositional matrix adjust. Identities = 19/74 (25%), Positives = 32/74 (43%), Gaps = 24/74 (32%) Query: 45 EKIIWPNRTSIERQDI------------SSDVSGTLIIACEGSH-------ALFLMHDQS 85 EK + P S R++ +++ SGTL+I GSH ++ ++D S Sbjct: 86 EKYLEPGYVSSYRKEALIGIVEVQYPYRANENSGTLLIPTVGSHIIDINDSSVHQLYDSS 145 Query: 86 KI-----IRNVNIF 94 I +RN +F Sbjct: 146 PIAKDFVLRNPGVF 159 >gi|254781099|ref|YP_003065512.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 468 Score = 21.2 bits (43), Expect = 9.6, Method: Compositional matrix adjust. Identities = 9/18 (50%), Positives = 13/18 (72%) Query: 135 MTEGIKDEQLKRALIRFG 152 M G+K E++KRAL+ G Sbjct: 293 MQLGLKVEEIKRALLSCG 310 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.326 0.139 0.418 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 100,078 Number of Sequences: 1233 Number of extensions: 3776 Number of successful extensions: 17 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 15 Number of HSP's gapped (non-prelim): 5 length of query: 161 length of database: 328,796 effective HSP length: 67 effective length of query: 94 effective length of database: 246,185 effective search space: 23141390 effective search space used: 23141390 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 35 (18.1 bits)