HHsearch alignment for GI: 254780479 and conserved domain: COG0122

>COG0122 AlkA 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase [DNA replication, recombination, and repair].
Probab=99.07  E-value=3.4e-09  Score=85.24  Aligned_cols=164  Identities=20%  Similarity=0.309  Sum_probs=117.1

Q ss_pred             HHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCHHHCCHHHHHHHHH----------CCCHHHHHCCCHH
Q ss_conf             999999962899887548554445678704676644673116120332658998774----------8997898729989
Q gi|254780479|r   11 KILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQK----------WPTIFCLSSAKDE   80 (356)
Q Consensus        11 ~ll~w~~~~~R~lpwr~~~~~~~~~~~~py~v~vseimlqqT~v~~v~~~~~~~~~~----------~P~~~~la~a~~~   80 (356)
T Consensus        78 ~l~~i~~~~~~-~~~~~~~g~~~~~~~d~fe~lv~aI~~QqvS~~~A~~i~~rl~~~~g~~~~~~~~fptpe~l~~~~~~  156 (285)
T COG0122          78 DLAPIIDALGP-LPLLRAPGLRLPLAPDPFEALVRAILSQQVSVAAAAKIWARLVSLYGNALEIYHSFPTPEQLAAADEE  156 (285)
T ss_pred             CHHHHHHHCCC-CCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHCCHH
T ss_conf             59999986465-65445556556666678999999999765059999999999999818766656679899999847999


Q ss_pred             HHHHHHHCCCHH-HHHHHHHHHHHHHHHCC---CCCCC--C--HHHHHHHHHHHHHHHHHHHHHHHCCCE--EEECCCCH
Q ss_conf             999997404634-58899987767543005---78687--3--145688888777877667766434963--13124314
Q gi|254780479|r   81 EILSAWAGLGYY-TRARNLKKCADIIVKKY---EGNFP--H--KVEILKKLPGIGDYTASAIVAIAFNHF--AVVVDTNI  150 (356)
Q Consensus        81 ~vl~~w~gLGyy-~Rar~l~~~a~~i~~~~---~g~~P--~--~~~~l~~LpGiG~yta~ai~s~a~~~~--~~~vD~Nv  150 (356)
T Consensus       157 ~l~----~~g~s~~Ka~yi~~~A~~~~~g~~~~~~l~~~~~e~a~e~L~~i~GIG~WTAe~~llf~lgr~dvfP~~D~~l  232 (285)
T COG0122         157 ALR----RCGLSGRKAEYIISLARAAAEGELDLSELKPLSDEEAIEELTALKGIGPWTAEMFLLFGLGRPDVFPADDLGL  232 (285)
T ss_pred             HHH----HHCCCHHHHHHHHHHHHHHHCCCCCHHHHCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCCCCCHHHHH
T ss_conf             998----8378577899999999999859965676625889999999873788679999999998168898677155999


Q ss_pred             HHHHHHHHCCCCCCCHHHHHHHHHHHCCCCC
Q ss_conf             6665765197545735689998741025785
Q gi|254780479|r  151 ERIISRYFDIIKPAPLYHKTIKNYARKITST  181 (356)
Q Consensus       151 ~RVl~R~~~~~~~~~~~~k~l~~~~~~~~~~  181 (356)
T Consensus       233 r~~~~~~~~~--~~~~~~~~~~~~~e~w~p~  261 (285)
T COG0122         233 RRAIKKLYRL--PTRPTEKEVRELAERWGPY  261 (285)
T ss_pred             HHHHHHHHCC--CCCCHHHHHHHHHHHCCCH
T ss_conf             9999997257--8785088999998505678