HHsearch alignment for GI: 254780479 and conserved domain: PRK05379

>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional.
Probab=95.00  E-value=0.11  Score=32.29  Aligned_cols=109  Identities=13%  Similarity=0.065  Sum_probs=58.2

Q ss_pred             EEEEEEEEECCCEEEEEECCCCHHHHCCCCCCCCCCCCCCCHHHHHHCCCCCCCCEE------CCCE--EEEEEEE----
Q ss_conf             232000341376057764572013204744211113467215888630101000021------3735--8998315----
Q gi|254780479|r  239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWIL------CNTI--THTFTHF----  306 (356)
Q Consensus       239 ~~~~~vii~~~~kiLL~KRp~~gll~GLwEFP~~e~~~~~~~~~~~~~~~~~~~~~~------l~~i--kH~fTH~----  306 (356)
T Consensus       203 vT~DaVVv-~~ghVLLIrR~~~-P~kG~WALPGGfv~~~Etl~~aa~REL~EETgl~~~~~~l~~~l~~~~vfd~P~Rdp  280 (340)
T PRK05379        203 VTVDAVVV-QSGHVLLVRRRAE-PGKGLWALPGGFVGQDETLLDACLRELREETGLKLPEPVLRGSIRDQQVFDHPGRSL  280 (340)
T ss_pred             EEEEEEEE-ECCEEEEEEECCC-CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCHHHCCCCCCCCCCCCCCCC
T ss_conf             65316999-8898999941899-988887589886999999899999988641268876203220012432478999999


Q ss_pred             --EEEEEEEEEECCCC--------CCCCCCEEECHHHHHHCCCCH--HHHHHHHH
Q ss_conf             --99999999980776--------766781332278887479987--89999984
Q gi|254780479|r  307 --TLTLFVWKTIVPQI--------VIIPDSTWHDAQNLANAALPT--VMKKALSA  349 (356)
Q Consensus       307 --~L~i~v~~~~~~~~--------~~~~~~~Wv~~~el~~~~LPs--~~kKIL~a  349 (356)
T Consensus       281 RGrvvt~a~~~~l~~~~lp~v~agDDA~~A~W~pl~el~~~~~~~feDH~~Il~~  335 (340)
T PRK05379        281 RGRTITHAFLFEFPAGELPAVKGGDDADKARWVPLAELAAMRDRMFEDHFQIITH  335 (340)
T ss_pred             CCCEEEEEEEEEECCCCCCCCCCCCCHHHCEEEEHHHHHHCHHHHHCCHHHHHHH
T ss_conf             8778999999972677667878998556577653999654777564409999999