HHsearch alignment for GI: 254780479 and conserved domain: cd03429

>cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP. Like other members of the Nudix family, it requires a divalent cation, such as Mg2+ or Mn2+, for activity. Members of this family are also recognized by the Nudix motif, a highly conserved 23-residue block (GX5EX7REUXEEXGU, where U = I, L or V), that functions as a metal binding and catalytic site. A block of 8 conserved amino acids downstream of the nudix motif is thought to give NADH pyrophosphatase its specificity for NADH. NADH pyrophosphatase forms a dimer.
Probab=96.78  E-value=0.0086  Score=40.17  Aligned_cols=92  Identities=13%  Similarity=0.114  Sum_probs=60.2

Q ss_pred             EEEEECCCEEEEEECCCCHHHHCCCCCCCCCCCCCCCHHHHHHCCCCCCCCEECCCEEEEEEEE----EEEEEEEEEECC
Q ss_conf             0034137605776457201320474421111346721588863010100002137358998315----999999999807
Q gi|254780479|r  243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHF----TLTLFVWKTIVP  318 (356)
Q Consensus       243 ~vii~~~~kiLL~KRp~~gll~GLwEFP~~e~~~~~~~~~~~~~~~~~~~~~~l~~ikH~fTH~----~L~i~v~~~~~~  318 (356)
T Consensus         5 ~~V~~~~~~iLL~r~~~~~--~g~~~~~aG~ve~GEs~e~a~~REv~EE~gv~v~~i~y~~sqpwpfp~~Lm~~f~a~~~   82 (131)
T cd03429           5 VLVIDGGDRILLARQPRFP--PGMYSLLAGFVEPGESLEEAVRREVKEEVGIRVKNIRYVGSQPWPFPSSLMLGFTAEAD   82 (131)
T ss_pred             EEEEECCCEEEEECCCCCC--CCCEECCEEEECCCCCHHHCEEEEEEEEECCEECCEEEEEECCCCCCCEEEEEEEEEEC
T ss_conf             9999489889997056799--99594662664399997991189899871770221699887587998868999999976


Q ss_pred             C------CCCCCCCEEECHHHHHH
Q ss_conf             7------67667813322788874
Q gi|254780479|r  319 Q------IVIIPDSTWHDAQNLAN  336 (356)
Q Consensus       319 ~------~~~~~~~~Wv~~~el~~  336 (356)
T Consensus        83 ~~e~~~~~~Ei~earWfs~del~~  106 (131)
T cd03429          83 SGEIVVDDDELEDARWFSRDEVRA  106 (131)
T ss_pred             CCCCCCCHHHEEEEEEECHHHHHH
T ss_conf             997669931621677676999866