HHsearch alignment for GI: 254780479 and conserved domain: pfam00730

>pfam00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein. This family contains a diverse range of structurally related DNA repair proteins. The superfamily is called the HhH-GPD family after its hallmark Helix-hairpin-helix and Gly/Pro rich loop followed by a conserved aspartate. This includes endonuclease III, EC:4.2.99.18 and MutY an A/G-specific adenine glycosylase, both have a C terminal 4Fe-4S cluster. The family also includes 8-oxoguanine DNA glycosylases. The methyl-CPG binding protein MBD4 also contains a related domain that is a thymine DNA glycosylase. The family also includes DNA-3-methyladenine glycosylase II EC:3.2.2.21 and other members of the AlkA family.
Probab=99.89  E-value=8.8e-23  Score=180.98  Aligned_cols=122  Identities=34%  Similarity=0.512  Sum_probs=113.8

Q ss_pred             HHHHHHHHCCHHHCCHHHHHHHHH--CCCHHHHHCCCHHHHHHHHHCCCHH-HHHHHHHHHHHHHHHCCCCCCCCHHHH-
Q ss_conf             644673116120332658998774--8997898729989999997404634-588999877675430057868731456-
Q gi|254780479|r   44 ISEIMLQQTTVKTVEPYFKKFMQK--WPTIFCLSSAKDEEILSAWAGLGYY-TRARNLKKCADIIVKKYEGNFPHKVEI-  119 (356)
Q Consensus        44 vseimlqqT~v~~v~~~~~~~~~~--~P~~~~la~a~~~~vl~~w~gLGyy-~Rar~l~~~a~~i~~~~~g~~P~~~~~-  119 (356)
T Consensus         1 V~~IlsQq~s~~~a~~i~~rl~~~~~~pt~~~l~~~~~~~l~~~i~~~G~~~~Ka~~I~~~a~~~~~~~~~~~~~~~~~~   80 (144)
T pfam00730         1 VSAILSQQTSDKAANKITKRLFERYGFPTPEDLAEADEEELRELIKGLGFYRRKAKYIKELARILVEGYLGLVPLDLEEL   80 (144)
T ss_pred             CEEEECCCCHHHHHHHHHHHHHHHHCCCCHHHHHCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCHHHH
T ss_conf             95542012349999999999999828989999985999999999870897699999999999888986289788611569


Q ss_pred             --HHHHHHHHHHHHHHHHHHHCCCE--EEECCCCHHHHHHHHHCCCCCCC
Q ss_conf             --88888777877667766434963--13124314666576519754573
Q gi|254780479|r  120 --LKKLPGIGDYTASAIVAIAFNHF--AVVVDTNIERIISRYFDIIKPAP  165 (356)
Q Consensus       120 --l~~LpGiG~yta~ai~s~a~~~~--~~~vD~Nv~RVl~R~~~~~~~~~  165 (356)
T Consensus        81 ~~L~~l~GIG~~ta~~~l~~~~~~~d~~~~~D~~v~r~~~rl~~~~~~~~  130 (144)
T pfam00730        81 EALLALPGVGRWTAEAVLLFALGRPDVFPAVDTHVRRVAKRLGLIKEKPT  130 (144)
T ss_pred             HHHHCCCCCCHHHHHHHHHHHCCCCCCEECCCHHHHHHHHHHCCCCCCCC
T ss_conf             99860889769999999999869998732644999999999779989999