HHsearch results for GI: 254780479 and protein with PDBid: 2fb1_A

>2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein structure initiative; 2.50A {Bacteroides thetaiotaomicron vpi-5482} SCOP: a.4.5.68 d.113.1.6
Probab=95.97  E-value=0.024  Score=35.45  Aligned_cols=99  Identities=10%  Similarity=0.054  Sum_probs=57.6

Q ss_pred             EECCCEEEEEECCCCHHHHCCCCCCCCCCCCCCCHHHHHHCCCCCCCCEECC--CEEEEEEE-------EEEEEEEEEEE
Q ss_conf             4137605776457201320474421111346721588863010100002137--35899831-------59999999998
Q gi|254780479|r  246 ITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN--TITHTFTH-------FTLTLFVWKTI  316 (356)
Q Consensus       246 i~~~~kiLL~KRp~~gll~GLwEFP~~e~~~~~~~~~~~~~~~~~~~~~~l~--~ikH~fTH-------~~L~i~v~~~~  316 (356)
                      .+.+.++||.||... -+.|.|.+|++..+.+++.......+..++......  ..-++|++       ..+.+ +|.+.
T Consensus        24 ~~~~l~VLLvkR~~~-P~~g~WaLPGG~ve~gEs~~~Aa~Rel~EEtGl~~~~leql~~~~~~~Rdp~~~~isv-~y~al  101 (226)
T 2fb1_A           24 NEGEISLLLLKRNFE-PAMGEWSLMGGFVQKDESVDDAAKRVLAELTGLENVYMEQVGAFGAIDRDPGERVVSI-AYYAL  101 (226)
T ss_dssp             ETTEEEEEEEECSSS-SSTTCEECEEEECCTTSCHHHHHHHHHHHHHCCCSCEEEEEEEECCTTSSSSSCEEEE-EEEEE
T ss_pred             ECCCCEEEEEECCCC-CCCCCEECCCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCEEEE-EEEEE
T ss_conf             799658999984689-8999787980047799898899999999874666652389645258767787734789-99999


Q ss_pred             CCCCC------CCCCCEEECHHHHHHCCCCHHHHHHHH
Q ss_conf             07767------667813322788874799878999998
Q gi|254780479|r  317 VPQIV------IIPDSTWHDAQNLANAALPTVMKKALS  348 (356)
Q Consensus       317 ~~~~~------~~~~~~Wv~~~el~~~~LPs~~kKIL~  348 (356)
                      ++...      ...+..|++.+++.++++.  +..|++
T Consensus       102 v~~~~~~~~~~e~~~~~w~~~~~lp~LafD--H~~ii~  137 (226)
T 2fb1_A          102 ININEYDRELVQKHNAYWVNINELPALIFD--HPEMVD  137 (226)
T ss_dssp             CCTTSSCHHHHHHTTEEEEETTSCCCBSTT--HHHHHH
T ss_pred             ECCCCCCCCCCCCCCCEEECHHHHHHHHHH--HHHHHH
T ss_conf             648876666531001346445652000002--699999