HHsearch results for GI: 254780479 and protein with PDBid: 2fvv_A

>2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A*
Probab=96.54  E-value=0.0056  Score=39.93  Aligned_cols=102  Identities=9%  Similarity=0.131  Sum_probs=52.7

Q ss_pred             EECCCEEEEEECCCCHHHHCCCCCCCCCCCCCCCHHHHHHCCCCCCCCEECC--CEEEEEE----EEEEEEEEEEEE-CC
Q ss_conf             4137605776457201320474421111346721588863010100002137--3589983----159999999998-07
Q gi|254780479|r  246 ITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN--TITHTFT----HFTLTLFVWKTI-VP  318 (356)
Q Consensus       246 i~~~~kiLL~KRp~~gll~GLwEFP~~e~~~~~~~~~~~~~~~~~~~~~~l~--~ikH~fT----H~~L~i~v~~~~-~~  318 (356)
                      .++++++||.+|...   .|.|+||++..+.+++.......+..++......  .+...|.    .....+.++.+. ..
T Consensus        50 ~~~~~~vLlv~~~~~---~~~W~~PgG~ie~gE~~~~aa~RE~~EEtGl~~~~~~~~~~~~~~~~~~~~~v~~~~v~~~~  126 (194)
T 2fvv_A           50 SESEEEVLLVSSSRH---PDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVL  126 (194)
T ss_dssp             STTCCEEEEEECSSC---TTSEECSEEECCTTCCHHHHHHHHHHHHHCEEEEEEEEEEEEEETTTTEEEEEEEEEEEEEC
T ss_pred             ECCCCEEEEEEECCC---CCEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEEEECCCCCCCCEEEEEEEEEEEC
T ss_conf             789988999994179---99098974005799799999999999986973403169999867899857999999998704


Q ss_pred             C-----CCCCCCCEEECHHHHHHC-CCCHH-HHHHHHHC
Q ss_conf             7-----676678133227888747-99878-99999844
Q gi|254780479|r  319 Q-----IVIIPDSTWHDAQNLANA-ALPTV-MKKALSAG  350 (356)
Q Consensus       319 ~-----~~~~~~~~Wv~~~el~~~-~LPs~-~kKIL~al  350 (356)
                      .     .....+.+|++.+|+.++ ....+ +..+++.+
T Consensus       127 ~~~~~~~~E~~~~~W~~~~Ea~~ll~~~~p~~~~~l~~L  165 (194)
T 2fvv_A          127 EDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETL  165 (194)
T ss_dssp             SSCHHHHHHCCCEEEEEHHHHHHHHTTTCHHHHHHTCC-
T ss_pred             CCCCCCCCCCEEEEEECHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             788899873448899529999998756759999999999