HHsearch results for GI: 254780479 and protein with PDBid: 2o1c_A

>2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneopterin triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A
Probab=97.59  E-value=0.00033  Score=48.60  Aligned_cols=107  Identities=14%  Similarity=0.082  Sum_probs=61.6

Q ss_pred             EEEEEEECCCEEEEEECCCCHHHHCCCCCCCCCCCCCCCHHHHHHCCCCCCCCE------ECCC-------------EEE
Q ss_conf             200034137605776457201320474421111346721588863010100002------1373-------------589
Q gi|254780479|r  241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWI------LCNT-------------ITH  301 (356)
Q Consensus       241 ~~~vii~~~~kiLL~KRp~~gll~GLwEFP~~e~~~~~~~~~~~~~~~~~~~~~------~l~~-------------ikH  301 (356)
                      .+.++.++++++||.+|...   .|+|.||++..+.+++.......+..++...      ....             ..|
T Consensus        13 ~vvi~~~~~~~vLl~~r~~~---~~~W~~PgG~ve~gEs~~~aa~RE~~EEtG~~~~~~~~~~~~~~~~~~~~~~~~~~~   89 (150)
T 2o1c_A           13 LVVIYAQDTKRVLMLQRRDD---PDFWQSVTGSVEEGETAPQAAMREVKEEVTIDVVAEQLTLIDCQRTVEFEIFSHLRH   89 (150)
T ss_dssp             EEEEEETTTCEEEEEECSSS---TTCEESEEEECCTTCCHHHHHHHHHHHHHCCCHHHHTCCEEEEEEEEEEECCGGGGG
T ss_pred             EEEEEECCCCEEEEEEEECC---CCCEECCEEEECCCCCHHHHHHHHHHHHHCCCCCCCEEEEEEEECCCCCCCCEEEEE
T ss_conf             99999808998999998089---995999850466998999999899999859720012156765201001101205656


Q ss_pred             EEE--EEEEEEEEEEEECCC-----CCCCCCCEEECHHHHHHCCCCHHHHHHHHHC
Q ss_conf             983--159999999998077-----6766781332278887479987899999844
Q gi|254780479|r  302 TFT--HFTLTLFVWKTIVPQ-----IVIIPDSTWHDAQNLANAALPTVMKKALSAG  350 (356)
Q Consensus       302 ~fT--H~~L~i~v~~~~~~~-----~~~~~~~~Wv~~~el~~~~LPs~~kKIL~al  350 (356)
                      .+.  .+......+....+.     ..+..+++|++.+++.++.++-.++++|...
T Consensus        90 ~~~~~~~~~~~~~~~~~~~~~~~~~~~E~~~~~W~~~~e~~~~~~~~~~~~~i~~~  145 (150)
T 2o1c_A           90 RYAPGVTRNTESWFCLALPHERQIVFTEHLAYKWLDAPAAAALTKSWSNRQAIEQF  145 (150)
T ss_dssp             GBCTTCCEEEEEEEEEEESSCCCCCCSSSSCEEEEEHHHHHHHCSCHHHHHHHHHH
T ss_pred             EECCCCCCEEEEEEEEECCCCCCCCCCHHCEEEEEEHHHHHHCCCCHHHHHHHHHH
T ss_conf             63475332189999997388887787300057990499997546998899999999