PSIBLAST alignment of GI: 254780479 and protein with PDB id: 1kg6

>gi|27065214|pdb|1KG6|A Chain A, Crystal Structure Of The K142r Mutant Of E.Coli Muty (Core Fragment) Length = 225
 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 87/233 (37%), Positives = 129/233 (55%), Gaps = 11/233 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N+ R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVRRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIK 232
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWALYPGKKPK 225