BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780479|ref|YP_003064892.1| A/G-specific adenine
glycosylase [Candidatus Liberibacter asiaticus str. psy62]
         (356 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780479|ref|YP_003064892.1| A/G-specific adenine glycosylase [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040156|gb|ACT56952.1| A/G-specific adenine glycosylase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 356

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 356/356 (100%), Positives = 356/356 (100%)

Query: 1   MPQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
           MPQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY
Sbjct: 1   MPQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL
Sbjct: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITS 180
           KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITS
Sbjct: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITS 180

Query: 181 TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG 240
           TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG
Sbjct: 181 TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG 240

Query: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTIT 300
           AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTIT
Sbjct: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTIT 300

Query: 301 HTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVPQ 356
           HTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVPQ
Sbjct: 301 HTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVPQ 356


>gi|23501394|ref|NP_697521.1| A/G-specific adenine glycosylase [Brucella suis 1330]
 gi|254703841|ref|ZP_05165669.1| A/G-specific adenine glycosylase [Brucella suis bv. 3 str. 686]
 gi|261754493|ref|ZP_05998202.1| A/G-specific adenine glycosylase [Brucella suis bv. 3 str. 686]
 gi|23347290|gb|AAN29436.1| A/G-specific adenine glycosylase [Brucella suis 1330]
 gi|261744246|gb|EEY32172.1| A/G-specific adenine glycosylase [Brucella suis bv. 3 str. 686]
          Length = 358

 Score =  291 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 168/340 (49%), Positives = 221/340 (65%), Gaps = 1/340 (0%)

Query: 12  ILDWYDTNHRVLPWRTSP-KTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPT 70
           +L WYD +HRVLPWR +P    K  +  PY+VW+SEIMLQQTTV+ V+ YF +F+++WPT
Sbjct: 7   LLRWYDRHHRVLPWRVTPVDAAKGDVADPYRVWLSEIMLQQTTVEAVKSYFLRFIERWPT 66

Query: 71  IFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYT 130
           +  ++ A +++IL AWAGLGYY+RARNLKKCADI+V ++ G FP     LK+LPGIGDYT
Sbjct: 67  VRAMAKASEDDILRAWAGLGYYSRARNLKKCADIVVAEHGGEFPKSAAGLKELPGIGDYT 126

Query: 131 ASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQA 190
           ++AI AIAF     VVD N+ER+ISR + I  P P+    I     ++T   RPGDF QA
Sbjct: 127 SAAIAAIAFGEQVAVVDGNVERVISRLYAIDTPLPVAKAQICALMGQMTPPDRPGDFAQA 186

Query: 191 MMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDN 250
           MMDLGA ICT  +P C LCP+ K C+   E       +   K ++P+RTGA FIAI  D 
Sbjct: 187 MMDLGATICTPRRPACALCPLNKGCIALCERDPEDFPVKAPKAEKPVRTGAAFIAIAGDG 246

Query: 251 RILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLTL 310
            + LRKR    LL GM E+PGS W++  DG+   ++APF+A W    TITH FTHF L L
Sbjct: 247 SVYLRKRKGEGLLAGMTEVPGSGWTARIDGDATVNAAPFSAAWTPSGTITHVFTHFELRL 306

Query: 311 FVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            V++    +     +  W   + L   ALPTVMKKA++A 
Sbjct: 307 SVYRASNVRKQAANEGWWSTPEELCGEALPTVMKKAIAAA 346


>gi|254718666|ref|ZP_05180477.1| A/G-specific adenine glycosylase [Brucella sp. 83/13]
          Length = 358

 Score =  291 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 167/340 (49%), Positives = 223/340 (65%), Gaps = 1/340 (0%)

Query: 12  ILDWYDTNHRVLPWRTSP-KTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPT 70
           +L WYD +HRVLPWR +P    K  +  PY+VW+SEIMLQQTTV+ V+ YF +F+++WPT
Sbjct: 7   LLRWYDRHHRVLPWRVTPVDAAKGDVADPYRVWLSEIMLQQTTVEAVKSYFLRFVERWPT 66

Query: 71  IFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYT 130
           +  ++ A +++IL AWAGLGYY+RARNLKKCADI+V ++ G FP     LK+LPGIGDYT
Sbjct: 67  VRAMAKASEDDILRAWAGLGYYSRARNLKKCADIVVAEHGGEFPKSAAGLKELPGIGDYT 126

Query: 131 ASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQA 190
           ++AI AIAF     VVD N+ER+ISR + I  P P     I+    ++T   RPGDF QA
Sbjct: 127 SAAIAAIAFGEQVAVVDGNVERVISRLYAIDTPLPAAKAQIRALMGQMTPPDRPGDFAQA 186

Query: 191 MMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDN 250
           MMDLGA ICT  +P C LCP+ + C+   E       +   K ++P+RTGA FIAI+ D 
Sbjct: 187 MMDLGATICTPRRPACALCPLNEGCIALCERDPEDFPVKAPKAEKPVRTGAAFIAISGDG 246

Query: 251 RILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLTL 310
            + LRKR    LL GM E+PGS W++  DG+   ++APF+A W    TITH FTHF L L
Sbjct: 247 SVYLRKRKGEGLLAGMTEVPGSGWTARIDGDATVNAAPFSAAWTPSGTITHVFTHFELRL 306

Query: 311 FVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            V++    +     +  W   + L+  ALPTVMKKA++A 
Sbjct: 307 SVYRASNVRKQAANEGWWSKPEELSGEALPTVMKKAIAAA 346


>gi|265983648|ref|ZP_06096383.1| A/G-specific adenine glycosylase [Brucella sp. 83/13]
 gi|306837785|ref|ZP_07470649.1| A/G-specific adenine glycosylase [Brucella sp. NF 2653]
 gi|264662240|gb|EEZ32501.1| A/G-specific adenine glycosylase [Brucella sp. 83/13]
 gi|306407126|gb|EFM63341.1| A/G-specific adenine glycosylase [Brucella sp. NF 2653]
          Length = 375

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 167/340 (49%), Positives = 223/340 (65%), Gaps = 1/340 (0%)

Query: 12  ILDWYDTNHRVLPWRTSP-KTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPT 70
           +L WYD +HRVLPWR +P    K  +  PY+VW+SEIMLQQTTV+ V+ YF +F+++WPT
Sbjct: 24  LLRWYDRHHRVLPWRVTPVDAAKGDVADPYRVWLSEIMLQQTTVEAVKSYFLRFVERWPT 83

Query: 71  IFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYT 130
           +  ++ A +++IL AWAGLGYY+RARNLKKCADI+V ++ G FP     LK+LPGIGDYT
Sbjct: 84  VRAMAKASEDDILRAWAGLGYYSRARNLKKCADIVVAEHGGEFPKSAAGLKELPGIGDYT 143

Query: 131 ASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQA 190
           ++AI AIAF     VVD N+ER+ISR + I  P P     I+    ++T   RPGDF QA
Sbjct: 144 SAAIAAIAFGEQVAVVDGNVERVISRLYAIDTPLPAAKAQIRALMGQMTPPDRPGDFAQA 203

Query: 191 MMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDN 250
           MMDLGA ICT  +P C LCP+ + C+   E       +   K ++P+RTGA FIAI+ D 
Sbjct: 204 MMDLGATICTPRRPACALCPLNEGCIALCERDPEDFPVKAPKAEKPVRTGAAFIAISGDG 263

Query: 251 RILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLTL 310
            + LRKR    LL GM E+PGS W++  DG+   ++APF+A W    TITH FTHF L L
Sbjct: 264 SVYLRKRKGEGLLAGMTEVPGSGWTARIDGDATVNAAPFSAAWTPSGTITHVFTHFELRL 323

Query: 311 FVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            V++    +     +  W   + L+  ALPTVMKKA++A 
Sbjct: 324 SVYRASNVRKQAANEGWWSKPEELSGEALPTVMKKAIAAA 363


>gi|161618466|ref|YP_001592353.1| A/G-specific adenine glycosylase [Brucella canis ATCC 23365]
 gi|161335277|gb|ABX61582.1| A/G-specific adenine glycosylase [Brucella canis ATCC 23365]
          Length = 358

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 168/340 (49%), Positives = 221/340 (65%), Gaps = 1/340 (0%)

Query: 12  ILDWYDTNHRVLPWRTSP-KTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPT 70
           +L WYD +HRVLPWR +P    K  +  PY+VW+SEIMLQQTTV+ V+ YF +F+++WPT
Sbjct: 7   LLRWYDRHHRVLPWRVTPVDAAKGDVADPYRVWLSEIMLQQTTVEAVKSYFLRFIERWPT 66

Query: 71  IFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYT 130
           +  ++ A +++IL AWAGLGYY+RARNLKKCADI+V ++ G FP     LK+LPGIGDYT
Sbjct: 67  VRAMAKASEDDILHAWAGLGYYSRARNLKKCADIVVAEHGGEFPKSAAGLKELPGIGDYT 126

Query: 131 ASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQA 190
           ++AI AIAF     VVD N+ER+ISR + I  P P+    I     ++T   RPGDF QA
Sbjct: 127 SAAIAAIAFGEQVAVVDGNVERVISRLYAIDTPLPVAKAQICALMGQMTPPDRPGDFAQA 186

Query: 191 MMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDN 250
           MMDLGA ICT  +P C LCP+ K C+   E       +   K ++P+RTGA FIAI  D 
Sbjct: 187 MMDLGATICTPRRPACALCPLNKGCIALCERDPEDFPVKAPKAEKPVRTGAAFIAIAGDG 246

Query: 251 RILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLTL 310
            + LRKR    LL GM E+PGS W++  DG+   ++APF+A W    TITH FTHF L L
Sbjct: 247 SVYLRKRKGEGLLAGMTEVPGSGWTARIDGDATVNAAPFSAAWTPSGTITHVFTHFELRL 306

Query: 311 FVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            V++    +     +  W   + L   ALPTVMKKA++A 
Sbjct: 307 SVYRASNVRKQAANEGWWSTPEELCGEALPTVMKKAIAAA 346


>gi|260566905|ref|ZP_05837375.1| A/G-specific adenine glycosylase [Brucella suis bv. 4 str. 40]
 gi|260156423|gb|EEW91503.1| A/G-specific adenine glycosylase [Brucella suis bv. 4 str. 40]
          Length = 375

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 168/340 (49%), Positives = 221/340 (65%), Gaps = 1/340 (0%)

Query: 12  ILDWYDTNHRVLPWRTSP-KTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPT 70
           +L WYD +HRVLPWR +P    K  +  PY+VW+SEIMLQQTTV+ V+ YF +F+++WPT
Sbjct: 24  LLRWYDRHHRVLPWRVTPVDAAKGDVADPYRVWLSEIMLQQTTVEAVKSYFLRFIERWPT 83

Query: 71  IFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYT 130
           +  ++ A +++IL AWAGLGYY+RARNLKKCADI+V ++ G FP     LK+LPGIGDYT
Sbjct: 84  VRAMAKASEDDILRAWAGLGYYSRARNLKKCADIVVAEHGGEFPKSAAGLKELPGIGDYT 143

Query: 131 ASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQA 190
           ++AI AIAF     VVD N+ER+ISR + I  P P+    I     ++T   RPGDF QA
Sbjct: 144 SAAIAAIAFGEQVAVVDGNVERVISRLYAIDTPLPVAKAQICALMGQMTPPDRPGDFAQA 203

Query: 191 MMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDN 250
           MMDLGA ICT  +P C LCP+ K C+   E       +   K ++P+RTGA FIAI  D 
Sbjct: 204 MMDLGATICTPRRPACALCPLNKGCIALCERDPEDFPVKAPKAEKPVRTGAAFIAIAGDG 263

Query: 251 RILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLTL 310
            + LRKR    LL GM E+PGS W++  DG+   ++APF+A W    TITH FTHF L L
Sbjct: 264 SVYLRKRKGEGLLAGMTEVPGSGWTARIDGDATVNAAPFSAAWTPSGTITHVFTHFELRL 323

Query: 311 FVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            V++    +     +  W   + L   ALPTVMKKA++A 
Sbjct: 324 SVYRASNVRKQAANEGWWSTPEELCGEALPTVMKKAIAAA 363


>gi|306845121|ref|ZP_07477701.1| A/G-specific adenine glycosylase [Brucella sp. BO1]
 gi|306274536|gb|EFM56331.1| A/G-specific adenine glycosylase [Brucella sp. BO1]
          Length = 375

 Score =  290 bits (741), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 167/340 (49%), Positives = 222/340 (65%), Gaps = 1/340 (0%)

Query: 12  ILDWYDTNHRVLPWRTSP-KTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPT 70
           +L WYD +HRVLPWR +P    K  +  PY+VW+SEIMLQQTTV+ V+ YF +F+++WPT
Sbjct: 24  LLRWYDRHHRVLPWRVTPVDAAKGDVADPYRVWLSEIMLQQTTVEAVKSYFLRFVERWPT 83

Query: 71  IFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYT 130
           +  ++ A +++IL AWAGLGYY+RARNLKKCADI+V ++ G FP     LK+LPGIGDYT
Sbjct: 84  VRAMAKASEDDILRAWAGLGYYSRARNLKKCADIVVAEHGGEFPKSAAGLKELPGIGDYT 143

Query: 131 ASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQA 190
           ++AI AIAF     VVD N+ER+ISR + I  P P     I+    ++T   RPGDF QA
Sbjct: 144 SAAIAAIAFGEQVAVVDGNVERVISRLYAIDTPLPAAKAQIRALMGQMTPPDRPGDFAQA 203

Query: 191 MMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDN 250
           MMDLGA ICT  +P C LCP+ + C+   E       +   K ++P+RTGA FIAI  D 
Sbjct: 204 MMDLGATICTPRRPACALCPLNEGCIALCERDPEDFPVKAPKAEKPVRTGAAFIAIAGDG 263

Query: 251 RILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLTL 310
            + LRKR    LL GM E+PGS W++  DG+   ++APF+A W    TITH FTHF L L
Sbjct: 264 SVYLRKRKGEGLLAGMTEVPGSGWTARIDGDATVNAAPFSAAWTPSGTITHVFTHFELRL 323

Query: 311 FVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            V++    +     +  W   + L+  ALPTVMKKA++A 
Sbjct: 324 SVYRASNVRKQAANEGWWSKPEELSGEALPTVMKKAIAAA 363


>gi|163842775|ref|YP_001627179.1| A/G-specific adenine glycosylase [Brucella suis ATCC 23445]
 gi|225627000|ref|ZP_03785039.1| A/G-specific adenine glycosylase [Brucella ceti str. Cudo]
 gi|225852029|ref|YP_002732262.1| A/G-specific adenine glycosylase [Brucella melitensis ATCC 23457]
 gi|254701296|ref|ZP_05163124.1| A/G-specific adenine glycosylase [Brucella suis bv. 5 str. 513]
 gi|254707780|ref|ZP_05169608.1| A/G-specific adenine glycosylase [Brucella pinnipedialis
           M163/99/10]
 gi|254709636|ref|ZP_05171447.1| A/G-specific adenine glycosylase [Brucella pinnipedialis B2/94]
 gi|256031129|ref|ZP_05444743.1| A/G-specific adenine glycosylase [Brucella pinnipedialis M292/94/1]
 gi|256044206|ref|ZP_05447113.1| A/G-specific adenine glycosylase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256060626|ref|ZP_05450792.1| A/G-specific adenine glycosylase [Brucella neotomae 5K33]
 gi|256113021|ref|ZP_05453918.1| A/G-specific adenine glycosylase [Brucella melitensis bv. 3 str.
           Ether]
 gi|256159205|ref|ZP_05457016.1| A/G-specific adenine glycosylase [Brucella ceti M490/95/1]
 gi|256254532|ref|ZP_05460068.1| A/G-specific adenine glycosylase [Brucella ceti B1/94]
 gi|256368946|ref|YP_003106452.1| A/G-specific adenine glycosylase [Brucella microti CCM 4915]
 gi|260168260|ref|ZP_05755071.1| A/G-specific adenine glycosylase [Brucella sp. F5/99]
 gi|261221710|ref|ZP_05935991.1| A/G-specific adenine glycosylase [Brucella ceti B1/94]
 gi|261324623|ref|ZP_05963820.1| A/G-specific adenine glycosylase [Brucella neotomae 5K33]
 gi|261751838|ref|ZP_05995547.1| A/G-specific adenine glycosylase [Brucella suis bv. 5 str. 513]
 gi|265988207|ref|ZP_06100764.1| A/G-specific adenine glycosylase [Brucella pinnipedialis M292/94/1]
 gi|265990622|ref|ZP_06103179.1| A/G-specific adenine glycosylase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265994454|ref|ZP_06107011.1| A/G-specific adenine glycosylase [Brucella melitensis bv. 3 str.
           Ether]
 gi|265997673|ref|ZP_06110230.1| A/G-specific adenine glycosylase [Brucella ceti M490/95/1]
 gi|294851868|ref|ZP_06792541.1| A/G-specific adenine glycosylase [Brucella sp. NVSL 07-0026]
 gi|163673498|gb|ABY37609.1| A/G-specific adenine glycosylase [Brucella suis ATCC 23445]
 gi|225618657|gb|EEH15700.1| A/G-specific adenine glycosylase [Brucella ceti str. Cudo]
 gi|225640394|gb|ACO00308.1| A/G-specific adenine glycosylase [Brucella melitensis ATCC 23457]
 gi|255999104|gb|ACU47503.1| A/G-specific adenine glycosylase [Brucella microti CCM 4915]
 gi|260920294|gb|EEX86947.1| A/G-specific adenine glycosylase [Brucella ceti B1/94]
 gi|261300603|gb|EEY04100.1| A/G-specific adenine glycosylase [Brucella neotomae 5K33]
 gi|261741591|gb|EEY29517.1| A/G-specific adenine glycosylase [Brucella suis bv. 5 str. 513]
 gi|262552141|gb|EEZ08131.1| A/G-specific adenine glycosylase [Brucella ceti M490/95/1]
 gi|262765567|gb|EEZ11356.1| A/G-specific adenine glycosylase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263001406|gb|EEZ13981.1| A/G-specific adenine glycosylase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|264660404|gb|EEZ30665.1| A/G-specific adenine glycosylase [Brucella pinnipedialis M292/94/1]
 gi|294820457|gb|EFG37456.1| A/G-specific adenine glycosylase [Brucella sp. NVSL 07-0026]
 gi|326408523|gb|ADZ65588.1| A/G-specific adenine glycosylase [Brucella melitensis M28]
 gi|326538240|gb|ADZ86455.1| A/G-specific adenine glycosylase [Brucella melitensis M5-90]
          Length = 358

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 168/340 (49%), Positives = 222/340 (65%), Gaps = 1/340 (0%)

Query: 12  ILDWYDTNHRVLPWRTSP-KTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPT 70
           +L WYD +HRVLPWR +P    K  +  PY+VW+SEIMLQQTTV+ V+ YF +F+++WPT
Sbjct: 7   LLRWYDRHHRVLPWRVTPVDAAKGDVADPYRVWLSEIMLQQTTVEAVKSYFLRFIERWPT 66

Query: 71  IFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYT 130
           +  ++ A +++IL AWAGLGYY+RARNLKKCADI+V ++ G FP     LK+LPGIGDYT
Sbjct: 67  VRAMAKASEDDILRAWAGLGYYSRARNLKKCADIVVAEHGGEFPKSAAGLKELPGIGDYT 126

Query: 131 ASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQA 190
           ++AI AIAF     VVD N+ER+ISR + I  P P+    I+    ++T   RPGDF QA
Sbjct: 127 SAAIAAIAFGEQVAVVDGNVERVISRLYAIDTPLPVAKAQIRALMGQMTPPDRPGDFAQA 186

Query: 191 MMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDN 250
           MMDLGA ICT  +P C LCP+ K C+   E       +   K ++P+RTGA FIAI  D 
Sbjct: 187 MMDLGATICTPRRPACALCPLNKGCIALCERDPEDFPVKAPKAEKPVRTGAAFIAIAGDG 246

Query: 251 RILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLTL 310
            + LRKR    LL GM E+PGS W++  DG+   ++APF+A W    TITH FTHF L L
Sbjct: 247 SVYLRKRKGEGLLAGMTEVPGSGWTARIDGDATVNAAPFSAAWTPSGTITHVFTHFELRL 306

Query: 311 FVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            V++    +     +  W   + L   ALPTVMKKA++A 
Sbjct: 307 SVYRASNVRKQAANEGWWSTPEELCGEALPTVMKKAIAAA 346


>gi|306842224|ref|ZP_07474888.1| A/G-specific adenine glycosylase [Brucella sp. BO2]
 gi|306287666|gb|EFM59110.1| A/G-specific adenine glycosylase [Brucella sp. BO2]
          Length = 358

 Score =  289 bits (740), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 168/340 (49%), Positives = 223/340 (65%), Gaps = 1/340 (0%)

Query: 12  ILDWYDTNHRVLPWRTSP-KTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPT 70
           +L WYD +HR+LPWR +P    K  +  PY+VW+SEIMLQQTTV+ V+ YF +F+++WPT
Sbjct: 7   LLRWYDRHHRILPWRVTPVDAAKGDVADPYRVWLSEIMLQQTTVEAVKSYFLRFVERWPT 66

Query: 71  IFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYT 130
           +  ++ A +++IL AWAGLGYY+RARNLKKCADI+V ++ G FP     LK+LPGIGDYT
Sbjct: 67  VRAMAKASEDDILRAWAGLGYYSRARNLKKCADIVVAEHGGEFPKSAAGLKELPGIGDYT 126

Query: 131 ASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQA 190
           ++AI AIAF     VVD N+ER+ISR + I  P P     I+    ++T   RPGDF QA
Sbjct: 127 SAAIAAIAFGEQVAVVDGNVERVISRLYAIDTPLPAAKAQIRALMGQMTPPDRPGDFAQA 186

Query: 191 MMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDN 250
           MMDLGA ICT  +P C LCP+ + C+  SE       +   K ++P+RTGA FIAI  D 
Sbjct: 187 MMDLGATICTPRRPACALCPLNEGCIARSERDPEDFPVKAPKAEKPVRTGAAFIAIAGDG 246

Query: 251 RILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLTL 310
            + LRKR    LL GM E+PGS W++  DG+   H+APF+A W    TITH FTHF L L
Sbjct: 247 SVYLRKRKGEGLLAGMTEVPGSGWTARIDGDATVHAAPFSAAWTPSGTITHVFTHFELRL 306

Query: 311 FVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            V++    +     +  W   + L+  ALPTVMKKA++A 
Sbjct: 307 SVYRASNVRKQAANEGWWSKPEELSGEALPTVMKKAIAAA 346


>gi|148558903|ref|YP_001258507.1| A/G-specific adenine glycosylase [Brucella ovis ATCC 25840]
 gi|148370160|gb|ABQ60139.1| A/G-specific adenine glycosylase [Brucella ovis ATCC 25840]
          Length = 358

 Score =  289 bits (740), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 168/340 (49%), Positives = 221/340 (65%), Gaps = 1/340 (0%)

Query: 12  ILDWYDTNHRVLPWRTSP-KTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPT 70
           +L WYD +HRVLPWR +P    K  +  PY+VW+SEIMLQQTTV+ V+ YF +F+++WPT
Sbjct: 7   LLRWYDRHHRVLPWRVTPVDAAKGDVADPYRVWLSEIMLQQTTVEAVKSYFLRFIERWPT 66

Query: 71  IFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYT 130
           +  ++ A +++IL AWAGLGYY+RARNLKKCADI+V +  G FP     LK+LPGIGDYT
Sbjct: 67  VRAMAKASEDDILRAWAGLGYYSRARNLKKCADIVVAENGGEFPKSAAGLKELPGIGDYT 126

Query: 131 ASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQA 190
           ++AI AIAF     VVD N+ER+ISR + I  P P+    I+    ++T   RPGDF QA
Sbjct: 127 SAAIAAIAFGEQVAVVDGNVERVISRLYAIDTPLPVAKAQIRALMGQMTPPDRPGDFAQA 186

Query: 191 MMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDN 250
           MMDLGA ICT  +P C LCP+ K C+   E       +   K ++P+RTGA FIAI  D 
Sbjct: 187 MMDLGATICTPRRPACALCPLNKGCIALCERDPEDFPVKAPKAEKPVRTGAAFIAIAGDG 246

Query: 251 RILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLTL 310
            + LRKR    LL GM E+PGS W++  DG+   ++APF+A W    TITH FTHF L L
Sbjct: 247 SVYLRKRKGEGLLAGMTEVPGSGWTARIDGDATVNAAPFSAAWTPSGTITHVFTHFELRL 306

Query: 311 FVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            V++    +     +  W   + L   ALPTVMKKA++A 
Sbjct: 307 SVYRASNVRKQAANEGWWSTPEELCGEALPTVMKKAIAAA 346


>gi|62289474|ref|YP_221267.1| A/G-specific adenine glycosylase [Brucella abortus bv. 1 str.
           9-941]
 gi|82699399|ref|YP_413973.1| hypothetical protein BAB1_0518 [Brucella melitensis biovar Abortus
           2308]
 gi|237814963|ref|ZP_04593961.1| A/G-specific adenine glycosylase [Brucella abortus str. 2308 A]
 gi|254688785|ref|ZP_05152039.1| A/G-specific adenine glycosylase [Brucella abortus bv. 6 str. 870]
 gi|254693268|ref|ZP_05155096.1| A/G-specific adenine glycosylase [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696914|ref|ZP_05158742.1| A/G-specific adenine glycosylase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254729817|ref|ZP_05188395.1| A/G-specific adenine glycosylase [Brucella abortus bv. 4 str. 292]
 gi|256257031|ref|ZP_05462567.1| A/G-specific adenine glycosylase [Brucella abortus bv. 9 str. C68]
 gi|260754272|ref|ZP_05866620.1| A/G-specific adenine glycosylase [Brucella abortus bv. 6 str. 870]
 gi|260883296|ref|ZP_05894910.1| A/G-specific adenine glycosylase [Brucella abortus bv. 9 str. C68]
 gi|261213518|ref|ZP_05927799.1| A/G-specific adenine glycosylase [Brucella abortus bv. 3 str.
           Tulya]
 gi|62195606|gb|AAX73906.1| MutY, A/G-specific adenine glycosylase [Brucella abortus bv. 1 str.
           9-941]
 gi|82615500|emb|CAJ10474.1| HhH-GPD:Iron-sulfur cluster loop:Endonuclease III, FCL:A/G-specific
           adenine glycosylase MutY [Brucella melitensis biovar
           Abortus 2308]
 gi|237789800|gb|EEP64010.1| A/G-specific adenine glycosylase [Brucella abortus str. 2308 A]
 gi|260674380|gb|EEX61201.1| A/G-specific adenine glycosylase [Brucella abortus bv. 6 str. 870]
 gi|260872824|gb|EEX79893.1| A/G-specific adenine glycosylase [Brucella abortus bv. 9 str. C68]
 gi|260915125|gb|EEX81986.1| A/G-specific adenine glycosylase [Brucella abortus bv. 3 str.
           Tulya]
          Length = 358

 Score =  289 bits (740), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 167/340 (49%), Positives = 221/340 (65%), Gaps = 1/340 (0%)

Query: 12  ILDWYDTNHRVLPWRTSP-KTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPT 70
           +L WYD +HRVLPWR +P    K  +  PY+VW+SEIMLQQTTV+ V+ YF +F+++WPT
Sbjct: 7   LLRWYDRHHRVLPWRVTPVDAAKGDVADPYRVWLSEIMLQQTTVEAVKSYFLRFIERWPT 66

Query: 71  IFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYT 130
           +  ++ A +++IL AWAGLGYY+RARNLKKCADI+V ++ G FP     LK+LPGIGDYT
Sbjct: 67  VRAMAKASEDDILRAWAGLGYYSRARNLKKCADIVVAEHGGEFPKSAAGLKELPGIGDYT 126

Query: 131 ASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQA 190
           ++AI AIAF     VVD N+ER+ISR + I  P P+    I+    ++T   RP DF QA
Sbjct: 127 SAAIAAIAFGEQVAVVDGNVERVISRLYAIDTPLPVAKAQIRALMGQMTPPDRPSDFAQA 186

Query: 191 MMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDN 250
           MMDLGA ICT  +P C LCP+ K C+   E       +   K ++P+RTGA FIAI  D 
Sbjct: 187 MMDLGATICTPRRPACALCPLNKGCIALCERDPEDFPVKAPKAEKPVRTGAAFIAIAGDG 246

Query: 251 RILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLTL 310
            + LRKR    LL GM E+PGS W++  DG+   ++APF+A W    TITH FTHF L L
Sbjct: 247 SVYLRKRKGEGLLAGMTEVPGSGWTARIDGDATVNAAPFSAAWTPSGTITHVFTHFELRL 306

Query: 311 FVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            V++    +     +  W   + L   ALPTVMKKA++A 
Sbjct: 307 SVYRASNVRKQAANEGWWSTPEELCGEALPTVMKKAIAAA 346


>gi|261757724|ref|ZP_06001433.1| A/G-specific adenine glycosylase [Brucella sp. F5/99]
 gi|261737708|gb|EEY25704.1| A/G-specific adenine glycosylase [Brucella sp. F5/99]
          Length = 382

 Score =  289 bits (740), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 168/340 (49%), Positives = 222/340 (65%), Gaps = 1/340 (0%)

Query: 12  ILDWYDTNHRVLPWRTSP-KTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPT 70
           +L WYD +HRVLPWR +P    K  +  PY+VW+SEIMLQQTTV+ V+ YF +F+++WPT
Sbjct: 31  LLRWYDRHHRVLPWRVTPVDAAKGDVADPYRVWLSEIMLQQTTVEAVKSYFLRFIERWPT 90

Query: 71  IFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYT 130
           +  ++ A +++IL AWAGLGYY+RARNLKKCADI+V ++ G FP     LK+LPGIGDYT
Sbjct: 91  VRAMAKASEDDILRAWAGLGYYSRARNLKKCADIVVAEHGGEFPKSAAGLKELPGIGDYT 150

Query: 131 ASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQA 190
           ++AI AIAF     VVD N+ER+ISR + I  P P+    I+    ++T   RPGDF QA
Sbjct: 151 SAAIAAIAFGEQVAVVDGNVERVISRLYAIDTPLPVAKAQIRALMGQMTPPDRPGDFAQA 210

Query: 191 MMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDN 250
           MMDLGA ICT  +P C LCP+ K C+   E       +   K ++P+RTGA FIAI  D 
Sbjct: 211 MMDLGATICTPRRPACALCPLNKGCIALCERDPEDFPVKAPKAEKPVRTGAAFIAIAGDG 270

Query: 251 RILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLTL 310
            + LRKR    LL GM E+PGS W++  DG+   ++APF+A W    TITH FTHF L L
Sbjct: 271 SVYLRKRKGEGLLAGMTEVPGSGWTARIDGDATVNAAPFSAAWTPSGTITHVFTHFELRL 330

Query: 311 FVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            V++    +     +  W   + L   ALPTVMKKA++A 
Sbjct: 331 SVYRASNVRKQAANEGWWSTPEELCGEALPTVMKKAIAAA 370


>gi|17987725|ref|NP_540359.1| A/G-specific adenine glycosylase [Brucella melitensis bv. 1 str.
           16M]
 gi|260563565|ref|ZP_05834051.1| A/G-specific adenine glycosylase [Brucella melitensis bv. 1 str.
           16M]
 gi|261315266|ref|ZP_05954463.1| A/G-specific adenine glycosylase [Brucella pinnipedialis
           M163/99/10]
 gi|261317169|ref|ZP_05956366.1| A/G-specific adenine glycosylase [Brucella pinnipedialis B2/94]
 gi|265999582|ref|ZP_05466999.2| A/G-specific adenine glycosylase [Brucella melitensis bv. 2 str.
           63/9]
 gi|17983444|gb|AAL52623.1| a/g-specific adenine glycosylase [Brucella melitensis bv. 1 str.
           16M]
 gi|260153581|gb|EEW88673.1| A/G-specific adenine glycosylase [Brucella melitensis bv. 1 str.
           16M]
 gi|261296392|gb|EEX99888.1| A/G-specific adenine glycosylase [Brucella pinnipedialis B2/94]
 gi|261304292|gb|EEY07789.1| A/G-specific adenine glycosylase [Brucella pinnipedialis
           M163/99/10]
 gi|263094798|gb|EEZ18536.1| A/G-specific adenine glycosylase [Brucella melitensis bv. 2 str.
           63/9]
          Length = 375

 Score =  289 bits (739), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 168/340 (49%), Positives = 222/340 (65%), Gaps = 1/340 (0%)

Query: 12  ILDWYDTNHRVLPWRTSP-KTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPT 70
           +L WYD +HRVLPWR +P    K  +  PY+VW+SEIMLQQTTV+ V+ YF +F+++WPT
Sbjct: 24  LLRWYDRHHRVLPWRVTPVDAAKGDVADPYRVWLSEIMLQQTTVEAVKSYFLRFIERWPT 83

Query: 71  IFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYT 130
           +  ++ A +++IL AWAGLGYY+RARNLKKCADI+V ++ G FP     LK+LPGIGDYT
Sbjct: 84  VRAMAKASEDDILRAWAGLGYYSRARNLKKCADIVVAEHGGEFPKSAAGLKELPGIGDYT 143

Query: 131 ASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQA 190
           ++AI AIAF     VVD N+ER+ISR + I  P P+    I+    ++T   RPGDF QA
Sbjct: 144 SAAIAAIAFGEQVAVVDGNVERVISRLYAIDTPLPVAKAQIRALMGQMTPPDRPGDFAQA 203

Query: 191 MMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDN 250
           MMDLGA ICT  +P C LCP+ K C+   E       +   K ++P+RTGA FIAI  D 
Sbjct: 204 MMDLGATICTPRRPACALCPLNKGCIALCERDPEDFPVKAPKAEKPVRTGAAFIAIAGDG 263

Query: 251 RILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLTL 310
            + LRKR    LL GM E+PGS W++  DG+   ++APF+A W    TITH FTHF L L
Sbjct: 264 SVYLRKRKGEGLLAGMTEVPGSGWTARIDGDATVNAAPFSAAWTPSGTITHVFTHFELRL 323

Query: 311 FVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            V++    +     +  W   + L   ALPTVMKKA++A 
Sbjct: 324 SVYRASNVRKQAANEGWWSTPEELCGEALPTVMKKAIAAA 363


>gi|260757491|ref|ZP_05869839.1| A/G-specific adenine glycosylase [Brucella abortus bv. 4 str. 292]
 gi|260761315|ref|ZP_05873658.1| A/G-specific adenine glycosylase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260667809|gb|EEX54749.1| A/G-specific adenine glycosylase [Brucella abortus bv. 4 str. 292]
 gi|260671747|gb|EEX58568.1| A/G-specific adenine glycosylase [Brucella abortus bv. 2 str.
           86/8/59]
          Length = 381

 Score =  289 bits (739), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 167/340 (49%), Positives = 221/340 (65%), Gaps = 1/340 (0%)

Query: 12  ILDWYDTNHRVLPWRTSP-KTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPT 70
           +L WYD +HRVLPWR +P    K  +  PY+VW+SEIMLQQTTV+ V+ YF +F+++WPT
Sbjct: 30  LLRWYDRHHRVLPWRVTPVDAAKGDVADPYRVWLSEIMLQQTTVEAVKSYFLRFIERWPT 89

Query: 71  IFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYT 130
           +  ++ A +++IL AWAGLGYY+RARNLKKCADI+V ++ G FP     LK+LPGIGDYT
Sbjct: 90  VRAMAKASEDDILRAWAGLGYYSRARNLKKCADIVVAEHGGEFPKSAAGLKELPGIGDYT 149

Query: 131 ASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQA 190
           ++AI AIAF     VVD N+ER+ISR + I  P P+    I+    ++T   RP DF QA
Sbjct: 150 SAAIAAIAFGEQVAVVDGNVERVISRLYAIDTPLPVAKAQIRALMGQMTPPDRPSDFAQA 209

Query: 191 MMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDN 250
           MMDLGA ICT  +P C LCP+ K C+   E       +   K ++P+RTGA FIAI  D 
Sbjct: 210 MMDLGATICTPRRPACALCPLNKGCIALCERDPEDFPVKAPKAEKPVRTGAAFIAIAGDG 269

Query: 251 RILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLTL 310
            + LRKR    LL GM E+PGS W++  DG+   ++APF+A W    TITH FTHF L L
Sbjct: 270 SVYLRKRKGEGLLAGMTEVPGSGWTARIDGDATVNAAPFSAAWTPSGTITHVFTHFELRL 329

Query: 311 FVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            V++    +     +  W   + L   ALPTVMKKA++A 
Sbjct: 330 SVYRASNVRKQAANEGWWSTPEELCGEALPTVMKKAIAAA 369


>gi|189023723|ref|YP_001934491.1| A/G-specific adenine glycosylase [Brucella abortus S19]
 gi|260545774|ref|ZP_05821515.1| A/G-specific adenine glycosylase [Brucella abortus NCTC 8038]
 gi|297247887|ref|ZP_06931605.1| A/G-specific adenine glycosylase [Brucella abortus bv. 5 str.
           B3196]
 gi|189019295|gb|ACD72017.1| A/G-specific adenine glycosylase [Brucella abortus S19]
 gi|260097181|gb|EEW81056.1| A/G-specific adenine glycosylase [Brucella abortus NCTC 8038]
 gi|297175056|gb|EFH34403.1| A/G-specific adenine glycosylase [Brucella abortus bv. 5 str.
           B3196]
          Length = 375

 Score =  289 bits (739), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 167/340 (49%), Positives = 221/340 (65%), Gaps = 1/340 (0%)

Query: 12  ILDWYDTNHRVLPWRTSP-KTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPT 70
           +L WYD +HRVLPWR +P    K  +  PY+VW+SEIMLQQTTV+ V+ YF +F+++WPT
Sbjct: 24  LLRWYDRHHRVLPWRVTPVDAAKGDVADPYRVWLSEIMLQQTTVEAVKSYFLRFIERWPT 83

Query: 71  IFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYT 130
           +  ++ A +++IL AWAGLGYY+RARNLKKCADI+V ++ G FP     LK+LPGIGDYT
Sbjct: 84  VRAMAKASEDDILRAWAGLGYYSRARNLKKCADIVVAEHGGEFPKSAAGLKELPGIGDYT 143

Query: 131 ASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQA 190
           ++AI AIAF     VVD N+ER+ISR + I  P P+    I+    ++T   RP DF QA
Sbjct: 144 SAAIAAIAFGEQVAVVDGNVERVISRLYAIDTPLPVAKAQIRALMGQMTPPDRPSDFAQA 203

Query: 191 MMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDN 250
           MMDLGA ICT  +P C LCP+ K C+   E       +   K ++P+RTGA FIAI  D 
Sbjct: 204 MMDLGATICTPRRPACALCPLNKGCIALCERDPEDFPVKAPKAEKPVRTGAAFIAIAGDG 263

Query: 251 RILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLTL 310
            + LRKR    LL GM E+PGS W++  DG+   ++APF+A W    TITH FTHF L L
Sbjct: 264 SVYLRKRKGEGLLAGMTEVPGSGWTARIDGDATVNAAPFSAAWTPSGTITHVFTHFELRL 323

Query: 311 FVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            V++    +     +  W   + L   ALPTVMKKA++A 
Sbjct: 324 SVYRASNVRKQAANEGWWSTPEELCGEALPTVMKKAIAAA 363


>gi|254712948|ref|ZP_05174759.1| A/G-specific adenine glycosylase [Brucella ceti M644/93/1]
 gi|254716698|ref|ZP_05178509.1| A/G-specific adenine glycosylase [Brucella ceti M13/05/1]
 gi|261218504|ref|ZP_05932785.1| A/G-specific adenine glycosylase [Brucella ceti M13/05/1]
 gi|261320646|ref|ZP_05959843.1| A/G-specific adenine glycosylase [Brucella ceti M644/93/1]
 gi|260923593|gb|EEX90161.1| A/G-specific adenine glycosylase [Brucella ceti M13/05/1]
 gi|261293336|gb|EEX96832.1| A/G-specific adenine glycosylase [Brucella ceti M644/93/1]
          Length = 358

 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 168/340 (49%), Positives = 222/340 (65%), Gaps = 1/340 (0%)

Query: 12  ILDWYDTNHRVLPWRTSP-KTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPT 70
           +L WYD +HRVLPWR +P    K  +  PY+VW+SEIMLQQTTV+ V+ YF +F+++WPT
Sbjct: 7   LLRWYDRHHRVLPWRVTPVDAAKGDVADPYRVWLSEIMLQQTTVEAVKSYFLRFIERWPT 66

Query: 71  IFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYT 130
           +  ++ A +++IL AWAGLGYY+RARNLKKCADI+V ++ G FP     LK+LPGIGDYT
Sbjct: 67  VRAMAKASEDDILRAWAGLGYYSRARNLKKCADIVVAEHGGEFPKSAAGLKELPGIGDYT 126

Query: 131 ASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQA 190
           ++AI AIAF     VVD N+ER+ISR + I  P P+    I+    ++T   RPGDF QA
Sbjct: 127 SAAIAAIAFGEQVAVVDGNVERVISRLYTIDTPLPVAKAQIRALMGQMTPPDRPGDFAQA 186

Query: 191 MMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDN 250
           MMDLGA ICT  +P C LCP+ K C+   E       +   K ++P+RTGA FIAI  D 
Sbjct: 187 MMDLGATICTPRRPACALCPLNKGCIALCERDPEDFPVKAPKAEKPVRTGAAFIAIAGDG 246

Query: 251 RILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLTL 310
            + LRKR    LL GM E+PGS W++  DG+   ++APF+A W    TITH FTHF L L
Sbjct: 247 SVYLRKRKGEGLLAGMTEVPGSGWTARIDGDATVNAAPFSAAWTPSGTITHVFTHFELRL 306

Query: 311 FVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            V++    +     +  W   + L   ALPTVMKKA++A 
Sbjct: 307 SVYRASNVRKQAANEGWWSTPEELCGEALPTVMKKAIAAA 346


>gi|315122065|ref|YP_004062554.1| A/G-specific adenine glycosylase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495467|gb|ADR52066.1| A/G-specific adenine glycosylase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 355

 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 280/356 (78%), Positives = 308/356 (86%), Gaps = 1/356 (0%)

Query: 1   MPQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
           MPQ E+ IQ  IL+WYD NHR LPWR  PKT KSSLP PY +W+SEIMLQQTTV TVEPY
Sbjct: 1   MPQYENTIQIDILNWYDINHRTLPWRIPPKTNKSSLPDPYTIWLSEIMLQQTTVTTVEPY 60

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           FKKFMQKWPTIFCLSSA +EEILSAWAGLGYYTRARNLKKCAD+IV+KYEG+FP+K +IL
Sbjct: 61  FKKFMQKWPTIFCLSSATEEEILSAWAGLGYYTRARNLKKCADVIVQKYEGDFPNKEDIL 120

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITS 180
           KKLPGIGDYTASAIVAIAFNHFAVV+DTNIERIISR F I K  PLY KTIK+YAR ITS
Sbjct: 121 KKLPGIGDYTASAIVAIAFNHFAVVIDTNIERIISRCFAITKSLPLYKKTIKSYARTITS 180

Query: 181 TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG 240
            SRPGDFVQAMMDLGALICT+ KPLC LCPIQK CLTFS G+SHLLGI T  KK+P R G
Sbjct: 181 ASRPGDFVQAMMDLGALICTAKKPLCHLCPIQKKCLTFSRGESHLLGI-TCPKKKPARVG 239

Query: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTIT 300
           A+F+AIT+DNRILLRKRT TRLL+GMDELPGS WS+ KDG ID  +APF ANW LCNTIT
Sbjct: 240 AIFLAITSDNRILLRKRTKTRLLKGMDELPGSDWSAKKDGEIDVGNAPFLANWTLCNTIT 299

Query: 301 HTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVPQ 356
           HTFTHF L LF+WKT+VPQI+ IP+S W   Q+L N ALPTVMKKA+SAGGIKVP+
Sbjct: 300 HTFTHFNLKLFIWKTVVPQIISIPESKWCYVQDLTNIALPTVMKKAISAGGIKVPK 355


>gi|110633122|ref|YP_673330.1| A/G-specific DNA-adenine glycosylase [Mesorhizobium sp. BNC1]
 gi|110284106|gb|ABG62165.1| A/G-specific DNA-adenine glycosylase [Chelativorans sp. BNC1]
          Length = 374

 Score =  286 bits (730), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 164/347 (47%), Positives = 215/347 (61%), Gaps = 1/347 (0%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKT-EKSSLPSPYKVWISEIMLQQTTVKTVEPYFKK 63
           E      +L WYD +HR LPWR  P        P PY VW+SEIMLQQTTV  V+PYF+K
Sbjct: 15  ETSFAEDLLLWYDRHHRRLPWRMPPAMIRGGERPDPYSVWLSEIMLQQTTVSAVKPYFEK 74

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           F+ +WPT+  L++A+ ++++ AWAGLGYY+RARNLKKCA+ + +++ G FP     LK L
Sbjct: 75  FLARWPTVEALAAAETDDVMKAWAGLGYYSRARNLKKCAEAVAERHGGRFPATEAGLKDL 134

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSR 183
           PGIGDYTA+AI AIAFN  A VVD N+ER+++R   I  P P     I+N    +   +R
Sbjct: 135 PGIGDYTAAAIAAIAFNRPAAVVDGNVERVVTRLKAIETPLPAAKPEIRNVVEALLPQAR 194

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVF 243
           PGDF QAMMDLGA ICT  +P C LCP+ ++C+  +        I   K  +P+R GA F
Sbjct: 195 PGDFAQAMMDLGATICTPRRPSCILCPVGEHCMARALKAQERFPIKAAKADKPLRQGAAF 254

Query: 244 IAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTF 303
           +A+  D  +LLR+R    LL GM E+P SAW++ +DG     +APF  +W  C  ITH F
Sbjct: 255 VAVRADGSVLLRQRPEKGLLGGMTEVPTSAWTARQDGESTRAAAPFPGSWTSCGAITHVF 314

Query: 304 THFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           THF L L V++  VP         W   + L   ALPTVMKKA+ A 
Sbjct: 315 THFALNLSVFRAEVPDFEAPSGHWWSAPRELRGEALPTVMKKAIEAA 361


>gi|254428977|ref|ZP_05042684.1| A/G-specific adenine glycosylase [Alcanivorax sp. DG881]
 gi|196195146|gb|EDX90105.1| A/G-specific adenine glycosylase [Alcanivorax sp. DG881]
          Length = 358

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 119/363 (32%), Positives = 178/363 (49%), Gaps = 17/363 (4%)

Query: 1   MPQP---EHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKT 56
           MP            +LDWYD + R  LPW+           +PY+VW+SEIMLQQT V T
Sbjct: 1   MPSTSLTPQDFSQALLDWYDQHGRQDLPWQHP--------RTPYQVWVSEIMLQQTQVST 52

Query: 57  VEPYFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHK 116
           V PYF++FM ++P +  L+ A+ +E+L  W GLGYY RARNL KCA  +++ Y+G FP  
Sbjct: 53  VIPYFERFMARFPDVKTLALAEQDEVLHLWTGLGYYARARNLHKCAQQLLENYQGEFPDT 112

Query: 117 VEILKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNY 174
           VE +  LPGIG  TA AI+A +    A ++D N++R+++R   +            +   
Sbjct: 113 VEEVATLPGIGPSTAGAILAQSRGVRAPILDGNVKRVLARLHAVPGWPGKKPVESRLWEL 172

Query: 175 ARKITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKK 234
           +   T  +R  D+ QA+MDLGA +C    P C  CP+ + C   + G          KK 
Sbjct: 173 SEHYTPHARLADYTQAIMDLGATLCRRGNPDCASCPVNRGCEAHANGNPQDYPGKKPKKA 232

Query: 235 RPMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWI 294
            P+RT  + I    + R+ L +R    +  G+   P +   S  D  +   +    A+  
Sbjct: 233 LPVRTTVMLILRDRNGRVWLEQRPQQGIWGGLWCFPQTDDESQMDDALRVRAFDARADSQ 292

Query: 295 LCNTITHTFTHFTLTLFVWKTIV-PQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIK 353
             +   HTF+H+ L +   +  V P      D  W D Q+     L   +KK L   G+ 
Sbjct: 293 PLDPFRHTFSHYHLDIVPLEVAVDPAGTRDSDGRWVDPQSPGTLGLAAPVKKLL--AGLD 350

Query: 354 VPQ 356
            P+
Sbjct: 351 APR 353


>gi|239831360|ref|ZP_04679689.1| A/G-specific adenine glycosylase [Ochrobactrum intermedium LMG
           3301]
 gi|239823627|gb|EEQ95195.1| A/G-specific adenine glycosylase [Ochrobactrum intermedium LMG
           3301]
          Length = 396

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 166/343 (48%), Positives = 224/343 (65%), Gaps = 1/343 (0%)

Query: 9   QSKILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTVEPYFKKFMQK 67
            +K+L WYD +HRVLPWR SP  + S +   PY+VW+SEIMLQQTTV+ V+ YF KF+++
Sbjct: 42  STKLLHWYDRHHRVLPWRISPSEQASGIRPDPYRVWLSEIMLQQTTVEAVKSYFVKFIER 101

Query: 68  WPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIG 127
           WP +  ++ A +++IL AWAGLGYY+RARNLKKCAD +V++++G FP     LK+LPGIG
Sbjct: 102 WPAVQAMALASEDDILRAWAGLGYYSRARNLKKCADAVVRQHDGKFPGSAAALKELPGIG 161

Query: 128 DYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDF 187
           DYT++AI AIAF     VVD N+ER+ISR + I  P P     I+    ++T   RPGDF
Sbjct: 162 DYTSAAIAAIAFGEAVAVVDGNVERVISRLYTIDTPLPAAKPEIRALMGQLTPIDRPGDF 221

Query: 188 VQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAIT 247
            QAMMDLGA ICT  +P C +CP+  +C+           +   K ++P+RTGA FIAI 
Sbjct: 222 AQAMMDLGATICTPRRPACAICPLNDDCMALKSRDPEEFPVKAPKAEKPIRTGAAFIAIA 281

Query: 248 NDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFT 307
           +D  + LRKR +  LL GM E+PGS W++  DG+    +APF A W    +ITH FTHF 
Sbjct: 282 DDGSVFLRKRKDEGLLAGMTEVPGSPWTARIDGDTTIDAAPFPAQWTASGSITHVFTHFE 341

Query: 308 LTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           L L V+++         D  W     L++ ALPTVMKKA++A 
Sbjct: 342 LRLSVYRSENVSKAASSDGWWSLPTELSDEALPTVMKKAITAA 384


>gi|153007952|ref|YP_001369167.1| A/G-specific adenine glycosylase [Ochrobactrum anthropi ATCC 49188]
 gi|151559840|gb|ABS13338.1| A/G-specific adenine glycosylase [Ochrobactrum anthropi ATCC 49188]
          Length = 364

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 169/343 (49%), Positives = 221/343 (64%), Gaps = 1/343 (0%)

Query: 9   QSKILDWYDTNHRVLPWRTSPKTEKSS-LPSPYKVWISEIMLQQTTVKTVEPYFKKFMQK 67
            +K+L WYD +HRVLPWR SP  + S   P PY+VW+SEIMLQQTTV+ V+ YF KF+++
Sbjct: 10  STKLLRWYDRHHRVLPWRVSPSEQASGVKPDPYRVWLSEIMLQQTTVEAVKSYFVKFVER 69

Query: 68  WPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIG 127
           WPT+  ++ A +++IL AWAGLGYY+RARNLKKCA+ +  +++G FP     LK+LPGIG
Sbjct: 70  WPTVQAMAKASEDDILRAWAGLGYYSRARNLKKCANAVALQHDGKFPDNAIALKELPGIG 129

Query: 128 DYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDF 187
           DYT++AI AIAF   A VVD N+ER+ISR + I  P P     I+    ++T   RPGDF
Sbjct: 130 DYTSAAIAAIAFGEAAAVVDGNVERVISRLYTIDTPLPAAKAEIRALMGQMTPIDRPGDF 189

Query: 188 VQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAIT 247
            QAMMDLGA ICT  +P C +CP   +C            +   K ++P+RTGA FIAI 
Sbjct: 190 AQAMMDLGATICTPRRPACAICPFNNDCSALKSRDPEEFPVKAPKAEKPIRTGAAFIAIA 249

Query: 248 NDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFT 307
            D  ILLRKR    LL GM E+PGS W++  DG+    +APF A+W    +ITH FTHF 
Sbjct: 250 GDGSILLRKRKGEGLLAGMTEVPGSHWTARIDGDATIAAAPFPAHWNASGSITHVFTHFE 309

Query: 308 LTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           L L V+++         D  W     L++ ALPTVMKKA+ A 
Sbjct: 310 LRLTVYRSENVSKSASADGWWSRPDELSDEALPTVMKKAIIAA 352


>gi|222085160|ref|YP_002543690.1| A/G-specific adenine glycosylase [Agrobacterium radiobacter K84]
 gi|221722608|gb|ACM25764.1| A/G-specific adenine glycosylase [Agrobacterium radiobacter K84]
          Length = 362

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 158/343 (46%), Positives = 212/343 (61%), Gaps = 1/343 (0%)

Query: 9   QSKILDWYDTNHRVLPWRTSPK-TEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQK 67
            + +L WYD +HR LPWR SP    +   P PY +W+SE+MLQQTTV  V+ YF KF+ +
Sbjct: 10  AASLLAWYDRHHRDLPWRISPPMAARGIRPDPYHIWLSEVMLQQTTVPAVKAYFAKFLAR 69

Query: 68  WPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIG 127
           WPT+  L++A  +++++AWAGLGYY RARNLKKCA+ +  ++ G FP   + L+ LPGIG
Sbjct: 70  WPTVGDLAAAPTDDVMAAWAGLGYYARARNLKKCAEAVAAEHGGRFPDTEDGLRALPGIG 129

Query: 128 DYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDF 187
           DYTA+A+ AIAFN  A V+D N+ER+ISR + I  P P     +K     +T   RPGDF
Sbjct: 130 DYTAAAVAAIAFNRQAAVMDGNVERVISRLYAISTPLPAGKPLMKQKVALLTPADRPGDF 189

Query: 188 VQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAIT 247
            QAMMDLGA ICT  +P C LCP    C   +        +   KK++P+R GA F+A+ 
Sbjct: 190 AQAMMDLGATICTPKRPACALCPFNNACEALASHDPEHFPVKAAKKEKPVRQGAAFVAVN 249

Query: 248 NDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFT 307
            D  I LR+R  + LL GM E+P + W++  DG   T +APF A+W    T+TH FTHF 
Sbjct: 250 GDGEIYLRRRIASGLLGGMTEVPTTGWTARIDGETSTDAAPFPADWQAAGTVTHVFTHFE 309

Query: 308 LTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           L L +++  V       D  W    NL   ALPTVMKKA++  
Sbjct: 310 LRLSIYRAQVAAGANRNDGWWEPVTNLEAQALPTVMKKAITQA 352


>gi|114707682|ref|ZP_01440577.1| A/G-specific adenine glycosylase protein [Fulvimarina pelagi
           HTCC2506]
 gi|114536926|gb|EAU40055.1| A/G-specific adenine glycosylase protein [Fulvimarina pelagi
           HTCC2506]
          Length = 353

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 155/354 (43%), Positives = 207/354 (58%), Gaps = 4/354 (1%)

Query: 1   MPQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTVEP 59
           MP P   +  +IL WYD N R +PWR  PK  +       YK+W+SEIMLQQTTV  V+P
Sbjct: 1   MPLPPSSLSEEILAWYDRNARDMPWRLGPKARREGHRPDAYKIWLSEIMLQQTTVAAVKP 60

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           +F +F+ +WPT+  L++A+  EI++ WAGLGYY+RARNL  CA  +V+ + G FP     
Sbjct: 61  FFARFVNRWPTVGDLANAEASEIMAEWAGLGYYSRARNLHVCAKEVVENHGGAFPRTAAA 120

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKIT 179
           LK LPGIGDYT++AI +IAF+  A VVD NIER+I+R + I  P P     +K     +T
Sbjct: 121 LKALPGIGDYTSAAIASIAFDEAAPVVDGNIERVITRLYRISAPLPGAKPHVKEKVTGLT 180

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              RPGDF QAMMDLGA IC    P C LCP  + C   S G      +   K+  P RT
Sbjct: 181 PKDRPGDFAQAMMDLGATICVPRSPSCLLCPAAEQCEARSHGDQTAYPVKAAKRPVPQRT 240

Query: 240 G-AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
           G A     ++D  + LR+R  + +L GM E P +AWS+ KDG      APF A+W+    
Sbjct: 241 GAAFVATRSSDGAVWLRRRPASGMLGGMAEAPSTAWSARKDGETGADVAPFKADWMHVGA 300

Query: 299 ITHTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALS-AGG 351
           I H FTHF LTL V++  +       +  W     +A+  LPT+M+K +  A G
Sbjct: 301 IAHGFTHFKLTLEVYRAEIDAEPSN-EGWWAARHEIADQGLPTLMRKVVDKALG 353


>gi|116250851|ref|YP_766689.1| A/G-specific adenine glycosylase [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115255499|emb|CAK06575.1| putative A/G-specific adenine glycosylase [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 367

 Score =  274 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 165/351 (47%), Positives = 223/351 (63%), Gaps = 5/351 (1%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTVEPYFKK 63
           +  +   +LDWYD +HR LPWR SP      +   PY+VW+SE+MLQQTTV+ V+PYF++
Sbjct: 7   DTPLAKPLLDWYDRHHRDLPWRVSPGMAARGVKADPYRVWLSEVMLQQTTVQAVKPYFER 66

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           F+Q+WP +  L++A+++ +++AWAGLGYY RARNLKKCA  + K++ G FP   E LK L
Sbjct: 67  FLQRWPEVTDLAAAENDAVMAAWAGLGYYARARNLKKCAAAVAKEHGGIFPDTEEGLKSL 126

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSR 183
           PGIGDYTA+A+ AIAFN  A V+D N+ER+ISR + I  P P     ++     +T   R
Sbjct: 127 PGIGDYTAAAVAAIAFNRQAAVMDGNVERVISRLYAISTPLPAAKPAMREKVALLTPADR 186

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVF 243
           PGDF QAMMDLGA ICT  +P C LCP +  C         L  +   KK++P+R GA F
Sbjct: 187 PGDFAQAMMDLGATICTPKRPACSLCPFRGACEALKLSDPELFPVKAAKKEKPVRYGAAF 246

Query: 244 IAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTF 303
           IA+T D  ILLR+R ++ LL GM E+P +AW++  DG     +APF A W    T+ H F
Sbjct: 247 IAVTGDGEILLRRRIDSGLLGGMTEVPTTAWTARIDGETSADAAPFDAAWQSSGTVIHVF 306

Query: 304 THFTLTLFVWKTIVPQIVIIPDST----WHDAQNLANAALPTVMKKALSAG 350
           THF L L +W+  +   V + D      W    NL   ALPT+MKKA++A 
Sbjct: 307 THFELRLSIWRAAIAAKVAMDDGRNDGWWEPVTNLEAQALPTIMKKAIAAA 357


>gi|325292180|ref|YP_004278044.1| A/G-specific adenine glycosylase [Agrobacterium sp. H13-3]
 gi|325060033|gb|ADY63724.1| A/G-specific adenine glycosylase [Agrobacterium sp. H13-3]
          Length = 382

 Score =  273 bits (698), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 167/345 (48%), Positives = 215/345 (62%), Gaps = 3/345 (0%)

Query: 9   QSKILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTVEPYFKKFMQK 67
              +L WYD +HR LPWRTSP          PY VW+SE+MLQQTTV+ V+PYF KF+  
Sbjct: 26  AQMLLAWYDRHHRELPWRTSPAMAAQGKRADPYHVWLSEVMLQQTTVQAVKPYFLKFLAT 85

Query: 68  WPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIG 127
           WP +  L++A  E++++AWAGLGYY RARNLKKCA+ + K + G FP   E LKKLPGIG
Sbjct: 86  WPHVSDLAAAPVEDVMAAWAGLGYYARARNLKKCAEAVAKDHGGVFPDTEEGLKKLPGIG 145

Query: 128 DYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDF 187
           DYT++A+ AIAFN  A V+D N+ER+ISR F I  P P     +K    ++T + RPGDF
Sbjct: 146 DYTSAAVAAIAFNRQAAVMDGNVERVISRLFAIDAPLPGSKPAMKAKVAELTPSDRPGDF 205

Query: 188 VQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAIT 247
            QAMMDLGA ICT  +P C LCP   +CL  +  +     +   KK +P+R GA F+A+ 
Sbjct: 206 AQAMMDLGATICTPKRPACALCPFNGDCLALTHDEPERFPVKAAKKAKPVRLGAAFVAVN 265

Query: 248 NDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFT 307
               ILLR+R  + LL GM E+P +AW++  DG  DT  APF A+W     I H FTHF 
Sbjct: 266 ASGEILLRRRIESGLLGGMTEVPTTAWTARVDGGTDTSHAPFAASWQAAGVIVHVFTHFE 325

Query: 308 LTLFVWKTIVPQIVI--IPDSTWHDAQNLANAALPTVMKKALSAG 350
           L L V++  VP  +     D  W    NL   ALPTVMKK ++  
Sbjct: 326 LRLTVYRAQVPDGLETGADDGWWEPVTNLDAQALPTVMKKVIAQA 370


>gi|227821135|ref|YP_002825105.1| putative A/G-specific adenine glycosylase [Sinorhizobium fredii
           NGR234]
 gi|227340134|gb|ACP24352.1| putative A/G-specific adenine glycosylase [Sinorhizobium fredii
           NGR234]
          Length = 362

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 158/340 (46%), Positives = 219/340 (64%), Gaps = 1/340 (0%)

Query: 12  ILDWYDTNHRVLPWRTSPK-TEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPT 70
           +LDWYD +HR LPWR SP    + ++  PY VW+SE+MLQQTTV+ V+ YF KF++ WP 
Sbjct: 15  LLDWYDRHHRDLPWRVSPPMAARGAVADPYHVWLSEVMLQQTTVQAVKAYFDKFLRLWPR 74

Query: 71  IFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYT 130
           +  L++A+ EE++ AWAGLGYY RARNLKKCA+++ +++ G FP + E LK LPG+GDYT
Sbjct: 75  VEDLAAAETEEVMKAWAGLGYYARARNLKKCAEVVAREHGGRFPDREEGLKSLPGVGDYT 134

Query: 131 ASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQA 190
           A+AI AIAFN  + V+D N+ER+ISR + I  P P     ++    ++T   RPGDF QA
Sbjct: 135 AAAIAAIAFNRHSAVLDGNVERVISRLYAIETPLPAAKPEMRRLVSELTPLDRPGDFAQA 194

Query: 191 MMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDN 250
           MMDLGA IC   +P C LCP + NC   +            +K++P+R GA F+AI   +
Sbjct: 195 MMDLGATICAPKRPACALCPFRGNCRALTVADPETFPRKAARKEKPLRLGAAFVAIDRSD 254

Query: 251 RILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLTL 310
            + LRKR ++ LL GM E+PG+ W++ +DG     + PF A W  C T+TH FTHF L L
Sbjct: 255 AVYLRKRADSGLLGGMTEVPGTDWTARRDGETSIEAGPFAAAWEACGTVTHVFTHFELRL 314

Query: 311 FVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            V++  V  +    +  W    +L   ALPTVMKKA++  
Sbjct: 315 SVYRAEVGDMAACAEGWWEPIASLKAQALPTVMKKAITQA 354


>gi|260460277|ref|ZP_05808529.1| A/G-specific adenine glycosylase [Mesorhizobium opportunistum
           WSM2075]
 gi|259033922|gb|EEW35181.1| A/G-specific adenine glycosylase [Mesorhizobium opportunistum
           WSM2075]
          Length = 357

 Score =  272 bits (694), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 162/352 (46%), Positives = 219/352 (62%), Gaps = 6/352 (1%)

Query: 9   QSKILDWYDTNHRVLPWRTSP-KTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQK 67
            S++L WYD +HR LPWR +P +  + + P PY++W+SE+MLQQTTV+ V+ YF+ F++K
Sbjct: 6   ASRLLAWYDVHHRELPWRVTPREHARGARPDPYRIWLSEVMLQQTTVEAVKSYFRAFVEK 65

Query: 68  WPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIG 127
           WP +  L++A  E+++ AWAGLGYY+RARNLK CAD +V    G FP     L+ LPGIG
Sbjct: 66  WPDVEALAAAPTEDVMKAWAGLGYYSRARNLKACAD-LVAARGGRFPDTEAALRDLPGIG 124

Query: 128 DYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDF 187
            YT++AI AIAF+  A VVD N+ER+ISR F I  P       I+ +  ++   +RPGDF
Sbjct: 125 AYTSAAITAIAFDRPAAVVDGNVERVISRLFSITTPLSEAKGEIRAHVERMVPATRPGDF 184

Query: 188 VQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAIT 247
            QAMMDLGA ICT  +P C LCP++++C     G      +   K  +P R GA F+A+ 
Sbjct: 185 AQAMMDLGATICTPRRPRCMLCPLREDCSAVVSGDPEHFPVRLPKADKPRRRGAAFVAMR 244

Query: 248 NDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFT 307
           +D  ILLRKR +  LL GM E+P +AW++  DG I   +APF ANW     I H FTHF 
Sbjct: 245 DDGAILLRKRPDKGLLGGMTEVPTTAWTARIDGAITEAAAPFPANWRHAGQIAHVFTHFA 304

Query: 308 LTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG---GIKVPQ 356
           L L V++  V          W  A  ++  ALPTVMKKA+ A      K P+
Sbjct: 305 LELDVFRAEVDS-AAPAGHFWSLAHEISGEALPTVMKKAIEAAIPGATKKPR 355


>gi|327191941|gb|EGE58923.1| A/G-specific adenine glycosylase protein [Rhizobium etli CNPAF512]
          Length = 571

 Score =  270 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 167/355 (47%), Positives = 228/355 (64%), Gaps = 5/355 (1%)

Query: 1   MPQPEHIIQSKILDWYDTNHRVLPWRTSPK-TEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           +  P+      +LDWYD +HR LPWR SP    +   P PY+VW+SE+MLQQTTV+ V+P
Sbjct: 207 ITTPDTPHAQPLLDWYDRHHRDLPWRVSPGMAARGVKPDPYRVWLSEVMLQQTTVQAVKP 266

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF++F+ +WP +  L++A+++ +++AWAGLGYY RARNLKKCA+ + +++ G FP     
Sbjct: 267 YFERFLARWPEVTDLAAAENDAVMAAWAGLGYYARARNLKKCAEAVAQEHGGVFPDSEAG 326

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKIT 179
           LK LPGIGDYTA+A+ AIAFN  A V+D N+ER+ISR + I  P P     +KN   ++T
Sbjct: 327 LKALPGIGDYTAAAVAAIAFNRQAAVMDGNVERVISRLYAIETPLPAAKPLMKNKVARLT 386

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              RPGDF QAMMDLGA ICT  +P C LCP +  C         L  +   KK++P+R 
Sbjct: 387 PADRPGDFAQAMMDLGATICTPKRPACSLCPFRVACQALKLSDPELFPVKAAKKEKPVRQ 446

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           GA F+A+T D  ILLR+R  + LL GM E+P +AW++  DG     +APF A W  C T+
Sbjct: 447 GAAFVAVTEDGEILLRRRAESGLLGGMTEVPTTAWTARIDGETSVAAAPFNAAWQACGTV 506

Query: 300 THTFTHFTLTLFVWKTIV---PQIVIIPDSTWHDA-QNLANAALPTVMKKALSAG 350
            H FTHF L L +W+  +   PQI    +  W +   NL   ALPT+MKKA++A 
Sbjct: 507 IHVFTHFELRLSIWRAAIAAKPQIGNATNDEWWEPVTNLEVQALPTIMKKAIAAA 561


>gi|86356643|ref|YP_468535.1| A/G-specific adenine glycosylase protein [Rhizobium etli CFN 42]
 gi|86280745|gb|ABC89808.1| A/G-specific adenine glycosylase protein [Rhizobium etli CFN 42]
          Length = 367

 Score =  269 bits (688), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 165/347 (47%), Positives = 221/347 (63%), Gaps = 5/347 (1%)

Query: 9   QSKILDWYDTNHRVLPWRTSPK-TEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQK 67
              +LDWYD +HR LPWR SP    +   P PY+VW+SE+MLQQTTV+ V+PYF+KF+++
Sbjct: 11  AKPLLDWYDRHHRDLPWRISPGMAARGVKPDPYRVWLSEVMLQQTTVQAVKPYFEKFLER 70

Query: 68  WPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIG 127
           WP +  L++A+ + +++ WAGLGYY RARNLKKCA+ + K++ G FP   E LK LPGIG
Sbjct: 71  WPEVTDLAAAESDAVMATWAGLGYYARARNLKKCAEAVAKEHGGVFPDTEEGLKSLPGIG 130

Query: 128 DYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDF 187
           DYTA+A+ AIAFN  A V+D N+ER+ISR + I  P P     +K     +T + RPGDF
Sbjct: 131 DYTAAAVAAIAFNRQAAVMDGNVERVISRLYAIEAPLPAAKPAMKAKVALLTPSGRPGDF 190

Query: 188 VQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAIT 247
            QAMMDLGA ICT  +P C LCP +  C         L  +   KK++P+R GA FIA++
Sbjct: 191 AQAMMDLGATICTPKRPACSLCPFRNACQALKLSDPELFPVKAAKKEKPVRHGAAFIAVS 250

Query: 248 NDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFT 307
            D  ILLR+R  + LL GM E+P +AW++  DG   + +APF A W  C T+ H FTHF 
Sbjct: 251 GDGEILLRRRAESGLLGGMTEVPTTAWTARLDGETSSAAAPFEAAWQACGTVIHVFTHFE 310

Query: 308 LTLFVWKTIVPQIVIIPDST----WHDAQNLANAALPTVMKKALSAG 350
           L L +W+  +       D      W    NL   ALPT+MKKA++A 
Sbjct: 311 LRLSIWRVAIAAKPKSRDGVNDEWWEPVTNLEAQALPTIMKKAIAAA 357


>gi|192360375|ref|YP_001981053.1| A / G specific adenine glycosylase [Cellvibrio japonicus Ueda107]
 gi|190686540|gb|ACE84218.1| A / G specific adenine glycosylase [Cellvibrio japonicus Ueda107]
          Length = 371

 Score =  269 bits (688), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 116/362 (32%), Positives = 178/362 (49%), Gaps = 15/362 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M          IL W+D + R  LPW+           +PY+VW+SEIMLQQT V TV P
Sbjct: 1   MASTNTAFSKAILAWFDRHGRKHLPWQQ--------GITPYRVWLSEIMLQQTQVTTVIP 52

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF++F+ ++P +  L++A  +E+L  W GLGYY RARNL +CA  +V +Y G FP  V  
Sbjct: 53  YFERFVARFPDVQSLAAAPIDEVLHLWTGLGYYARARNLHRCAQTVVSQYGGEFPGTVAE 112

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHK--TIKNYARK 177
           L  LPGIG  TA AIV+IAF   A ++D N++R+++RY  +           T+   A  
Sbjct: 113 LADLPGIGRSTAGAIVSIAFGKRAAILDGNVKRVLARYHAVEGWPGQTDVLSTLWEIAET 172

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
            T  +R   + QAMMD+GA +CT +KP C LCP+++ C+  ++G          KK  P 
Sbjct: 173 YTPKTRANHYTQAMMDMGATLCTRSKPRCELCPVREGCIAHAQGNPQDYPGKKPKKALPE 232

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
           ++  + +       +LL +R    +  G+   P  A     + + +       A+    +
Sbjct: 233 KSVQLLMVRDPAGDVLLEQRPAQGIWGGLWSFPELALEQDVEAHAERLFGSL-ASLETWD 291

Query: 298 TITHTFTHFTLTLFVWKT---IVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
           +  HTF+H+ L +         V + V      W++        L   +KK L       
Sbjct: 292 SYRHTFSHYHLDITPVLVQLNRVHKAVAQSGYHWYNPHQPDELGLAAPVKKLLQQLAQLD 351

Query: 355 PQ 356
           P+
Sbjct: 352 PR 353


>gi|110835146|ref|YP_694005.1| A/G specific adenine glycosylase [Alcanivorax borkumensis SK2]
 gi|110648257|emb|CAL17733.1| A/G specific adenine glycosylase [Alcanivorax borkumensis SK2]
          Length = 358

 Score =  269 bits (687), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 116/363 (31%), Positives = 176/363 (48%), Gaps = 17/363 (4%)

Query: 1   MPQ---PEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKT 56
           MP+           +LDWYD + R  LPW+           +PY+VWISEIMLQQT V T
Sbjct: 1   MPKYSLSPEHFSQALLDWYDQHGRQDLPWQHP--------RTPYQVWISEIMLQQTQVNT 52

Query: 57  VEPYFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHK 116
           V PYF++FM+ +P +  L+ AK +E+L  W GLGYY RARNL KCA  +++ Y G+FP+ 
Sbjct: 53  VIPYFQRFMEHFPDVKTLALAKQDEVLHLWTGLGYYARARNLHKCAQQLLENYAGDFPNT 112

Query: 117 VEILKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNY 174
           VE +  LPGIG  TA AI+A +    A ++D N++R+++R   +            +   
Sbjct: 113 VEEVATLPGIGPSTAGAILAQSRGIRAPILDGNVKRVLARLHAVPGWPGKKPVESRLWEL 172

Query: 175 ARKITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKK 234
           A   T   R  D+ QA+MDLGA +C  + P C  CP++  C   + G          KK 
Sbjct: 173 AEHYTPDHRLADYTQAIMDLGATLCRRSTPDCTACPVKTGCQAHANGNPQDYPGKKPKKT 232

Query: 235 RPMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWI 294
            P+RT  + I    + ++ L +R    +  G+   P +         + T +     +  
Sbjct: 233 LPVRTTVMLILRDREGQVWLEQRPQQGIWGGLWCFPQTCAMEQVHHALQTRAFDARGDTQ 292

Query: 295 LCNTITHTFTHFTLTLFVWKTIVPQIVIIP-DSTWHDAQNLANAALPTVMKKALSAGGIK 353
                 HTF+H+ L +   +  V        +  W + QN     L   +KK L++    
Sbjct: 293 QLPPFRHTFSHYHLDIEPLEVAVDTAGPCDNNGRWVNPQNPGKLGLAAPVKKLLASLS-- 350

Query: 354 VPQ 356
            P+
Sbjct: 351 APR 353


>gi|182677741|ref|YP_001831887.1| A/G-specific adenine glycosylase [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182633624|gb|ACB94398.1| A/G-specific adenine glycosylase [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 383

 Score =  268 bits (685), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 150/348 (43%), Positives = 209/348 (60%), Gaps = 7/348 (2%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
           E  +   +L WYD + R LPWR  P  +      PY VW+SEIMLQQTTV  V+PY+  F
Sbjct: 12  EPSVSRALLAWYDAHRRDLPWRAKPGEQA----DPYAVWLSEIMLQQTTVTAVKPYYATF 67

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           + +WP +  L++A  + +L  WAGLGYY+RARNL  CA ++++++ G FP +  +L+ LP
Sbjct: 68  LGQWPRLEDLAAAPLDAVLRQWAGLGYYSRARNLHACAIMVMQRHGGVFPAEESLLRALP 127

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRP 184
           GIG YTA+AI AIA    AVVVD N+ER+ISR F I  P P     I+    ++T   R 
Sbjct: 128 GIGAYTAAAIAAIAHGRRAVVVDGNVERVISRLFAIESPLPEAKAVIRAETDRLTPNERA 187

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
           GDF QAMMDLG++ICT  +P C LCP+   C+  +EG++    I   K+++P+R G  F 
Sbjct: 188 GDFAQAMMDLGSMICTPRQPQCLLCPLAAFCVAKAEGRAGEFPIKAPKREKPIRHGVAFF 247

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILC-NTITHTF 303
               D  +LL +R    LL GM E+PG AW+ T D       AP  A+W      +TH F
Sbjct: 248 LRRGDGAVLLTRRPARGLLGGMMEIPGGAWNETPDLE-PLRLAPVAADWQRLEGEVTHVF 306

Query: 304 THFTLTLFVWKTIVPQIVIIPDS-TWHDAQNLANAALPTVMKKALSAG 350
           THF L L V+    P  + +PD   +   ++L   ALP++M+KA++AG
Sbjct: 307 THFALRLSVYAAKAPSTLKVPDGCRFVAEEDLDAEALPSLMRKAVAAG 354


>gi|126460895|ref|YP_001042009.1| A/G-specific adenine glycosylase [Rhodobacter sphaeroides ATCC
           17029]
 gi|126102559|gb|ABN75237.1| A/G-specific DNA-adenine glycosylase [Rhodobacter sphaeroides ATCC
           17029]
          Length = 367

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 143/352 (40%), Positives = 202/352 (57%), Gaps = 8/352 (2%)

Query: 8   IQSKILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
           I +++L WYD + RV+PWR  P   ++     PY+VW+SEIMLQQTTV  V  YF++F  
Sbjct: 13  ISARLLAWYDRHARVMPWRVGPAERRAGHRPDPYRVWLSEIMLQQTTVAAVRDYFRRFTD 72

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           +WP +  L++A D ++++ WAGLGYY RARNL K A  +V  + G FP   + L  LPG+
Sbjct: 73  RWPDVEALAAAPDADVMAEWAGLGYYARARNLLKGARAVVALHGGRFPETRDGLLSLPGV 132

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGD 186
           G YTA+A+ +IAF+  A VVD N+ER++SR F +  P P     +   A  +T   RPGD
Sbjct: 133 GPYTAAAVASIAFDEPATVVDGNVERVVSRLFAVETPLPAAKPELTRLAATLTPQERPGD 192

Query: 187 FVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAI 246
             QAMMDLGA ICT  KP+C LCP++ +C     G    L     K ++P+R G ++IA+
Sbjct: 193 HAQAMMDLGATICTPRKPVCSLCPLRPDCEGHRAGLEAELPRKAPKAEKPVREGRLWIAV 252

Query: 247 TNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN-TITHTFTH 305
             D  +LL  R    +L GM   PG+ W    D +     AP  A+W      + HTFTH
Sbjct: 253 RADGAVLLETRPERGMLGGMLGWPGTDW----DRSGGPAGAPLEADWRETGVEVRHTFTH 308

Query: 306 FTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKK--ALSAGGIKVP 355
           F L L V    V +  +    ++        AALPT+M+K  +++A  I+ P
Sbjct: 309 FHLRLEVLVAQVAEGAVPARGSFVPRAEFRPAALPTLMRKGWSVAAAAIRHP 360


>gi|15964681|ref|NP_385034.1| A/G-specific adenine glycosylase protein [Sinorhizobium meliloti
           1021]
 gi|307304259|ref|ZP_07584011.1| A/G-specific adenine glycosylase [Sinorhizobium meliloti BL225C]
 gi|307320564|ref|ZP_07599979.1| A/G-specific adenine glycosylase [Sinorhizobium meliloti AK83]
 gi|15073859|emb|CAC45500.1| Probable A/G-specific adenine glycosylase [Sinorhizobium meliloti
           1021]
 gi|306893840|gb|EFN24611.1| A/G-specific adenine glycosylase [Sinorhizobium meliloti AK83]
 gi|306902727|gb|EFN33320.1| A/G-specific adenine glycosylase [Sinorhizobium meliloti BL225C]
          Length = 366

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 160/353 (45%), Positives = 216/353 (61%), Gaps = 6/353 (1%)

Query: 4   PEHIIQSKILDWYDTNHRVLPWRTSPKT-EKSSLPSPYKVWISEIMLQQTTVKTVEPYFK 62
           P+    + +L+WYD +HR LPWR  P    K ++  PY+VW+SE+MLQQTTV+ V+ YF+
Sbjct: 6   PQAASAALLLEWYDRHHRDLPWRVPPAAARKGAVADPYRVWLSEVMLQQTTVQAVKAYFE 65

Query: 63  KFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKK 122
           KF+  WPT+  L++A  E+++ AWAGLGYY RARNLKKCA+ + + + G FP   E LK 
Sbjct: 66  KFLALWPTVGDLAAADTEDVMKAWAGLGYYARARNLKKCAEAVARDHGGRFPDSEEGLKA 125

Query: 123 LPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTS 182
           LPGIGDYTA+AI AIAFN  + V+D N+ER+ISR   +  P P     ++   + +T   
Sbjct: 126 LPGIGDYTAAAIAAIAFNRASAVLDGNVERVISRLHAVETPLPAAKPEMRALVQALTPAD 185

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
           RPGDF QAMMDLGA ICT  +P C LCP + +C                KK++P+R GA 
Sbjct: 186 RPGDFAQAMMDLGATICTPKRPACSLCPFRTDCRALKTADPETFPRKAAKKEKPLRLGAA 245

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHT 302
           F+A+     + LRKR  T LL GM E+PG+ W+S +DG+    + PF A W  C T+ H 
Sbjct: 246 FVAVDGLEAVYLRKRPETGLLGGMTEVPGTDWTSRRDGDTSIDAHPFPAEWEPCGTVNHV 305

Query: 303 FTHFTLTLFVWKTIVPQIVIIP-----DSTWHDAQNLANAALPTVMKKALSAG 350
           FTHF L L V++  V +  I          W    +L   ALPTVMKKA++  
Sbjct: 306 FTHFELHLSVFRARVGRADIGEARTDTSGWWEPLASLRAQALPTVMKKAIAKA 358


>gi|77462005|ref|YP_351509.1| A/G-specific DNA-adenine glycosylase [Rhodobacter sphaeroides
           2.4.1]
 gi|77386423|gb|ABA77608.1| A/G-specific DNA-adenine glycosylase [Rhodobacter sphaeroides
           2.4.1]
          Length = 367

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 143/352 (40%), Positives = 203/352 (57%), Gaps = 8/352 (2%)

Query: 8   IQSKILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
           I +++L WYD + RV+PWR  P   ++     PY+VW+SEIMLQQTTV  V  YF++F  
Sbjct: 13  ISARLLAWYDRHARVMPWRVGPAERRAGHRPDPYRVWLSEIMLQQTTVAAVRDYFRRFTD 72

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           +WP +  L++A D ++++ WAGLGYY RARNL K A  +V  + G FP   + L  LPG+
Sbjct: 73  RWPDVEALAAAPDADVMAEWAGLGYYARARNLLKGARAVVALHGGRFPETRDGLLSLPGV 132

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGD 186
           G YTA+A+ +IAF+  A VVD N+ER++SR F +  P P     +   A  +T   RPGD
Sbjct: 133 GPYTAAAVASIAFDEPATVVDGNVERVVSRLFAVETPLPAAKPELTRLAATLTPQVRPGD 192

Query: 187 FVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAI 246
             QAMMDLGA ICT  KP+C LCP++ +C     G    L     K ++P+R G ++IA+
Sbjct: 193 HAQAMMDLGATICTPRKPVCSLCPLRPDCEGHRAGLEAELPRKAPKAEKPVREGRLWIAV 252

Query: 247 TNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN-TITHTFTH 305
             D  +LL  R    +L GM   PG+ W    D +     AP  A+W      + HTFTH
Sbjct: 253 RADGAVLLETRPERGMLGGMLGWPGTDW----DRSGGPAGAPLEADWRETGVEVRHTFTH 308

Query: 306 FTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKK--ALSAGGIKVP 355
           F L L V    V +  +    ++    +   AALPT+M+K  +++A  I+ P
Sbjct: 309 FHLRLEVLVAQVAEAALPARGSFVPRADFRPAALPTLMRKGWSVAAAAIRHP 360


>gi|319408231|emb|CBI81884.1| A/G-specific adenine glycosylase MutY [Bartonella schoenbuchensis
           R1]
          Length = 352

 Score =  267 bits (681), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 168/344 (48%), Positives = 219/344 (63%), Gaps = 4/344 (1%)

Query: 6   HIIQSKILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTVEPYFKKF 64
           H I S++L WYD NHR LPWR +PK +   +   PYKVW+SEIMLQQTTV+TV+PYFKKF
Sbjct: 2   HEISSRLLSWYDQNHRHLPWRITPKEQMEGIRPDPYKVWLSEIMLQQTTVETVKPYFKKF 61

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           ++ WP +  LS A  ++I+ AWAGLGYY+RARNLK CA  +V+ Y+G FP  V+ L+ LP
Sbjct: 62  LKLWPNLSSLSQASQDDIMKAWAGLGYYSRARNLKNCAHQLVENYKGEFPQSVKTLRTLP 121

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRP 184
           GIGDYTA+AI AIAF H   VVD N+ERII+R F I    P     IK   +KIT  +RP
Sbjct: 122 GIGDYTAAAIAAIAFEHPVAVVDGNVERIITRLFAITSVLPKAKSEIKEKTQKITDLNRP 181

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
           GDF QAMMDLGA ICT  KP C LCP+Q  C       +    +   KK R  +TG  F+
Sbjct: 182 GDFAQAMMDLGATICTPRKPSCLLCPLQNLCKAKKMHITEAFPVKAPKKARLFKTGVAFV 241

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFT 304
            +  + +I L K+ + RLL GM ++P    ++ ++   +  +APF ANW     +TH FT
Sbjct: 242 VLNKNKQIYLEKQQSNRLLNGMTQIPNHIGTNGEN---ELQNAPFQANWQFKGQVTHIFT 298

Query: 305 HFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALS 348
           HF+L L V+         + +  W D  +L+  ALPTVMKKA+S
Sbjct: 299 HFSLKLDVYCVDNISETKLQNGWWCDIHDLSKEALPTVMKKAIS 342


>gi|15888141|ref|NP_353822.1| A/G-specific adenine glycosylase [Agrobacterium tumefaciens str.
           C58]
 gi|15155777|gb|AAK86607.1| A/G-specific adenine glycosylase [Agrobacterium tumefaciens str.
           C58]
          Length = 367

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 165/355 (46%), Positives = 217/355 (61%), Gaps = 5/355 (1%)

Query: 1   MPQP--EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTV 57
           M Q          +L WYD +HR LPWRTSP          PY VW+SE+MLQQTTV+ V
Sbjct: 1   MLQKTAPSSYAQMLLAWYDRHHRELPWRTSPAMAARGKRADPYHVWLSEVMLQQTTVQAV 60

Query: 58  EPYFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKV 117
           +PYF KF+  WP +  L++A  E++++AWAGLGYY RARNLKKCA+ + +++ G FP   
Sbjct: 61  KPYFLKFLAAWPRVDDLATAPVEDVMAAWAGLGYYARARNLKKCAEAVAREHGGVFPDTE 120

Query: 118 EILKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARK 177
           E LK+LPGIGDYT++A+ AIAFN  A V+D N+ER+ISR F I  P P     +K    +
Sbjct: 121 EGLKQLPGIGDYTSAAVAAIAFNRQAAVMDGNVERVISRLFAIDAPLPGSKPAMKAKVAE 180

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T   RPGDF QAMMDLGA ICT  +P C LCP    CL  +  +     +   KK +P+
Sbjct: 181 LTPAERPGDFAQAMMDLGATICTPKRPACALCPFNGACLALTRDEPERFPVKAAKKAKPV 240

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
           R GA F+A+  +  ILLR+R ++ LL GM E+P +AW++  DG  +   APF A W +  
Sbjct: 241 RLGAAFVAVNTEGEILLRRRIDSGLLGGMTEVPTTAWTARMDGGTEVSHAPFAAGWQMAG 300

Query: 298 TITHTFTHFTLTLFVWKTIVPQIVI--IPDSTWHDAQNLANAALPTVMKKALSAG 350
            I H FTHF L L V++  VP  +     D  W    NL   ALPTVMKK ++  
Sbjct: 301 VIGHVFTHFELRLTVYRAQVPDGLQTGPDDGWWEPVTNLDAQALPTVMKKVIAEA 355


>gi|150395767|ref|YP_001326234.1| A/G-specific adenine glycosylase [Sinorhizobium medicae WSM419]
 gi|150027282|gb|ABR59399.1| A/G-specific adenine glycosylase [Sinorhizobium medicae WSM419]
          Length = 370

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 163/360 (45%), Positives = 219/360 (60%), Gaps = 11/360 (3%)

Query: 2   PQPEHIIQSKILDWYDTNHRVLPWRTSPK-TEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
           P+P     + +L WYD +HR LPWR SP    K ++  PY VW+SE+MLQQTTVK V+ Y
Sbjct: 3   PEPATDAAALLLGWYDRHHRDLPWRISPPMARKGAVADPYHVWLSEVMLQQTTVKAVKAY 62

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           F+KF+  WPT+  L++A  E+++ AWAGLGYY RARNLKKCA+ +V+ + G FP + E L
Sbjct: 63  FQKFLALWPTVGDLAAADTEDVMKAWAGLGYYARARNLKKCAEAVVRDHGGRFPDREEEL 122

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITS 180
           K LPGIGDYTA+AI AIAFN  + V+D N+ER+ISR   +  P P     ++     +T 
Sbjct: 123 KALPGIGDYTAAAIAAIAFNRRSAVLDGNVERVISRLHAVETPLPAAKPEMRALVHTLTP 182

Query: 181 TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG 240
             RPGDF QAMMDLGA ICT  +P C LCP + +C                +K++P+R G
Sbjct: 183 LGRPGDFAQAMMDLGATICTPKRPACSLCPFRADCRALKIADPETFPRKAPRKEKPLRLG 242

Query: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTIT 300
           A F+AI +   + LRKR  T LL GM E+PG+ W+S +DG+    + PF A W  C T++
Sbjct: 243 AAFVAIDDCEAVYLRKRPETGLLGGMTEIPGTEWTSRRDGDTSVDAHPFPAPWEPCGTVS 302

Query: 301 HTFTHFTLTLFVWKTIVPQIVIIP----------DSTWHDAQNLANAALPTVMKKALSAG 350
           H FTHF L L V++  V ++                 W    +L   ALPTVMKKA++  
Sbjct: 303 HVFTHFELRLSVFRASVVRVSEGGAGAGAAPAGTSGWWEPLDSLKAQALPTVMKKAIAKA 362


>gi|13476250|ref|NP_107820.1| adenine glycosylase [Mesorhizobium loti MAFF303099]
 gi|14027011|dbj|BAB53965.1| adenine glycosylase [Mesorhizobium loti MAFF303099]
          Length = 396

 Score =  266 bits (679), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 159/343 (46%), Positives = 209/343 (60%), Gaps = 3/343 (0%)

Query: 9   QSKILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTVEPYFKKFMQK 67
            S++L WYD +HR LPWR SP+     +   PY++W+SE+MLQQTTV+ V+ YF+ F++K
Sbjct: 45  ASRLLAWYDVHHRELPWRVSPREHARGVRPDPYRIWLSEVMLQQTTVEAVKSYFRAFVEK 104

Query: 68  WPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIG 127
           WP +  L++A  E+++ AWAGLGYY+RARNLK CAD +V    G FP     L+ LPGIG
Sbjct: 105 WPDVEALAAAPTEDVMKAWAGLGYYSRARNLKACAD-LVAARGGRFPDTEADLRDLPGIG 163

Query: 128 DYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDF 187
            YT++AI AIAF+  A VVD N+ER+ISR F I  P       I+     +   +RPGDF
Sbjct: 164 AYTSAAITAIAFDRPAAVVDGNVERVISRLFSIRTPLNEAKTEIRALVEAMVPAARPGDF 223

Query: 188 VQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAIT 247
            QAMMDLGA ICT  +P C LCP+++NC     G      +   K  +P R GA F+AI 
Sbjct: 224 AQAMMDLGATICTPRRPRCMLCPLRENCSAVVSGDPENFPVRLPKADKPQRRGAAFVAIR 283

Query: 248 NDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFT 307
            D  +LLRKR    LL GM E+P +AW++  DG     +APF   W    TITH FTHF 
Sbjct: 284 EDGAMLLRKRPEKGLLGGMTEVPTTAWTARVDGATTQAAAPFPGEWRRAGTITHVFTHFA 343

Query: 308 LTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           L L V+   + +        W  A  ++  ALPTVMKKA+ A 
Sbjct: 344 LELEVFHAHI-KGDAPAGHFWSHAHEISGEALPTVMKKAIEAA 385


>gi|307151293|ref|YP_003886677.1| A/G-specific adenine glycosylase [Cyanothece sp. PCC 7822]
 gi|306981521|gb|ADN13402.1| A/G-specific adenine glycosylase [Cyanothece sp. PCC 7822]
          Length = 368

 Score =  266 bits (679), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 117/358 (32%), Positives = 174/358 (48%), Gaps = 18/358 (5%)

Query: 7   IIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
            ++  +L WY  +HR LPWR           +PY +W+SE+MLQQT V TV PYF ++++
Sbjct: 16  ELRQLLLSWYQKHHRDLPWRN--------QRNPYYIWVSEVMLQQTQVATVIPYFHRWLE 67

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PTI  L+ A+ + +L AW GLGYY RARNL K A +I+K Y G FP+ +  +  LPGI
Sbjct: 68  RFPTIDDLAQAELQPVLKAWEGLGYYARARNLHKAAKLIIKNYNGFFPNSLAEVLSLPGI 127

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGD 186
           G  TA  I++ AFN    ++D N++R++SR   +  P       +   +  I     P D
Sbjct: 128 GRTTAGGILSAAFNQPVSILDGNVKRVLSRLIALSVPPSQALPQLWALSDHILDPDNPRD 187

Query: 187 FVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAI 246
           F QA+MDLGA +CT   P C  CP Q  C  +++G    L +       P +   V +  
Sbjct: 188 FNQALMDLGATVCTRANPKCDQCPWQGYCQAYNKGIQSRLPMREESTPIPHKRIGVAVIY 247

Query: 247 TNDNRILLRKRTNTRLLEGMDELPGSAWSSTK------DGNIDTHSAPFTANWILCNTIT 300
            +   IL+ +R   +LL G+ E PG    + +         I    A          T+ 
Sbjct: 248 NHQEEILIDRRPTDKLLGGLWEFPGGKIEADETVSDCIKREILEELAIEIEVGEHIITVD 307

Query: 301 HTFTHFTLTLFVWKTI----VPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
           H +THF ++LFV         PQ +   +  W     L     P    K + A   + 
Sbjct: 308 HAYTHFRVSLFVHACRYLGGEPQPIGCEEIRWVKLDELDQFPFPKANIKIIEALKERH 365


>gi|241203453|ref|YP_002974549.1| A/G-specific adenine glycosylase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857343|gb|ACS55010.1| A/G-specific adenine glycosylase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 367

 Score =  266 bits (679), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 164/351 (46%), Positives = 222/351 (63%), Gaps = 5/351 (1%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTVEPYFKK 63
           +  +   +LDWYD +HR LPWR SP      +   PY+VW+SE+MLQQTTV+ V+PYF++
Sbjct: 7   DTPLAKPLLDWYDRHHRELPWRVSPGMAARGVKADPYRVWLSEVMLQQTTVQAVKPYFER 66

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           F+Q+WP +  L++A+++ +++AWAGLGYY RARNLKKCA+ +  ++ G FP   E LK L
Sbjct: 67  FLQRWPEVTDLAAAENDAVMAAWAGLGYYARARNLKKCAEAVANEHGGVFPDTEEDLKSL 126

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSR 183
           PGIGDYTA+A+ AIAFN  A V+D N+ER+ISR + I  P P     ++     +T   R
Sbjct: 127 PGIGDYTAAAVAAIAFNRQAAVMDGNVERVISRLYAIATPLPAAKPAMREKVALLTPADR 186

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVF 243
           PGDF QAMMDLGA ICT  +P C LCP +  C         L  +   KK++P+R GA F
Sbjct: 187 PGDFAQAMMDLGATICTPKRPACSLCPFRGACEALKLSDPELFPVKAAKKEKPVRYGAAF 246

Query: 244 IAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTF 303
           IA+T D  ILLR+R ++ LL GM E+P +AW++  DG     +APF A W    T+ H F
Sbjct: 247 IAVTGDGEILLRRRIDSGLLGGMTEVPTTAWTARIDGETSAAAAPFEAAWQASGTVIHVF 306

Query: 304 THFTLTLFVWKTIVPQIVI----IPDSTWHDAQNLANAALPTVMKKALSAG 350
           THF L L +W+  +   V       D  W    NL   ALPT+MKKA++A 
Sbjct: 307 THFELRLSIWRAAIAAKVAMDDGPNDGWWEPVTNLEAQALPTIMKKAIAAA 357


>gi|332559932|ref|ZP_08414254.1| A/G-specific adenine glycosylase [Rhodobacter sphaeroides WS8N]
 gi|332277644|gb|EGJ22959.1| A/G-specific adenine glycosylase [Rhodobacter sphaeroides WS8N]
          Length = 367

 Score =  265 bits (678), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 144/352 (40%), Positives = 205/352 (58%), Gaps = 8/352 (2%)

Query: 8   IQSKILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
           I +++L WYD + RV+PWR  P   ++ L   PY+VW+SEIMLQQTTV  V  YF++F +
Sbjct: 13  ISARLLVWYDRHARVMPWRVGPAERRAGLRPDPYRVWLSEIMLQQTTVAAVRDYFRRFTE 72

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           +WP +  L++A D ++++ WAGLGYY RARNL K A  +V  + G FP   + L  LPG+
Sbjct: 73  RWPDVEALAAAPDADVMAEWAGLGYYARARNLLKGARAVVALHGGRFPGTRDGLLSLPGV 132

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGD 186
           G YTA+A+ +IAF+  A VVD N+ER++SR F +  P P     +   A  +T   RPGD
Sbjct: 133 GPYTAAAVASIAFDEPATVVDGNVERVVSRLFAVETPLPAAKPELTRLAATLTPQERPGD 192

Query: 187 FVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAI 246
             QAMMDLGA ICT  KP+C LCP++ +C     G    L     K ++P+R G ++IA+
Sbjct: 193 HAQAMMDLGATICTPRKPVCSLCPLRPDCEGHRAGLEAELPRKAPKAEKPVREGRLWIAV 252

Query: 247 TNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN-TITHTFTH 305
             D  +LL  R    +L GM   PG+ W    D +     AP  A+W      + HTFTH
Sbjct: 253 RADGAVLLETRPERGMLGGMLGWPGTDW----DRSGGPAGAPLEADWRDTGVEVRHTFTH 308

Query: 306 FTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKK--ALSAGGIKVP 355
           F L L V    V +  +    ++    +   AALPT+M+K  +++A  I+ P
Sbjct: 309 FHLRLEVLVAQVAEAAVPARGSFVPRADFRPAALPTLMRKGWSVAAAAIRHP 360


>gi|209548258|ref|YP_002280175.1| A/G-specific adenine glycosylase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534014|gb|ACI53949.1| A/G-specific adenine glycosylase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 365

 Score =  265 bits (678), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 169/353 (47%), Positives = 225/353 (63%), Gaps = 3/353 (0%)

Query: 1   MPQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSS-LPSPYKVWISEIMLQQTTVKTVEP 59
           +  P+      +LDWYD +HR LPWR SP        P PY+VW+SE+MLQQTTV+ V+P
Sbjct: 3   ITTPDTPTAKPLLDWYDRHHRDLPWRISPGMAAGGVKPDPYRVWLSEVMLQQTTVQAVKP 62

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF KF+Q+WP +  L++A+++ +++AWAGLGYY RARNLKKCA+ + K++ G FP   E 
Sbjct: 63  YFAKFLQRWPEVTDLAAAENDAVMAAWAGLGYYARARNLKKCAEAVAKEHGGVFPDTEEG 122

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKIT 179
           LK LPGIGDYTA+A+ AIAFN  A V+D N+ER+ISR + I  P P     +K    ++T
Sbjct: 123 LKSLPGIGDYTAAAVAAIAFNRQAAVMDGNVERVISRLYAIETPLPAGKPLMKEKVARLT 182

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             +RPGDF QAMMDLGA ICT  +P C LCP +  C         L  +   KK++P+R 
Sbjct: 183 PATRPGDFAQAMMDLGATICTPKRPACSLCPFRGACAALKLSDPELFPVKAAKKEKPVRQ 242

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           GA F+A+T D  ILLR+R  + LL GM E+P +AW++  DG     +APF A W  C T+
Sbjct: 243 GAAFVAVTADGEILLRRRAESGLLGGMTEVPTTAWTARLDGETSAAAAPFEAAWQACGTV 302

Query: 300 THTFTHFTLTLFVWKTIVPQIVI--IPDSTWHDAQNLANAALPTVMKKALSAG 350
            H FTHF L L +W+  +   V     D  W    NL   ALPT+MKKA++A 
Sbjct: 303 IHVFTHFELRLLIWRAAIAGKVDDRPNDGWWEPVTNLEAQALPTIMKKAIAAA 355


>gi|307546609|ref|YP_003899088.1| A/G-specific adenine glycosylase [Halomonas elongata DSM 2581]
 gi|307218633|emb|CBV43903.1| A/G-specific adenine glycosylase [Halomonas elongata DSM 2581]
          Length = 373

 Score =  265 bits (678), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 119/352 (33%), Positives = 183/352 (51%), Gaps = 14/352 (3%)

Query: 4   PEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFK 62
           P    Q ++LDW+D + R  LPW+           +PY+VW+SEIMLQQT V TV PYF+
Sbjct: 10  PPETFQRRLLDWFDVHGRHDLPWQQD--------RTPYRVWVSEIMLQQTQVTTVIPYFE 61

Query: 63  KFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKK 122
           +FM+++P +  L++A  +E+L  W GLGYY R RNL K A +++++++G FP        
Sbjct: 62  RFMERFPDVEALAAADQDEVLHLWTGLGYYARGRNLHKAARVVMEEHDGAFPVHSLEAMA 121

Query: 123 -LPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPGIG  TA AI+A +    AV++D N++R+++R   +      P   + + + A + T
Sbjct: 122 ELPGIGRSTAGAIIAQSTGRRAVILDGNVKRVLTRLHAVEGWPGRPAVERRLWSLAERYT 181

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              R  DF QAMMDLGA +C   +P C  CP + +CL    G+      +  KK  P R 
Sbjct: 182 PDERVIDFTQAMMDLGATLCRRGRPECGRCPFETDCLAHERGEERRFPESKPKKALPTRQ 241

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +   +  R+LL +R  + L  G+  LP           +D H+     +    +T 
Sbjct: 242 TLMLLLQDDQGRVLLEQRPPSGLWGGLWSLPQFEDPEALLAWLDQHAPGAELDGK-WSTF 300

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPDST-WHDAQNLANAALPTVMKKALSAG 350
           THTF+HF L +      V  +  + +S  W D  + AN  L   +K  L + 
Sbjct: 301 THTFSHFRLEITPQPARVAHLDAVGESRLWFDPADPANIGLAAPVKGLLESL 352


>gi|158337045|ref|YP_001518220.1| A/G-specific adenine glycosylase [Acaryochloris marina MBIC11017]
 gi|158307286|gb|ABW28903.1| A/G-specific adenine glycosylase [Acaryochloris marina MBIC11017]
          Length = 368

 Score =  265 bits (677), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 112/366 (30%), Positives = 174/366 (47%), Gaps = 21/366 (5%)

Query: 4   PEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKK 63
           P   +++ +  WY  + R LPWR +          PY +W+SEIMLQQT VKTV PY+++
Sbjct: 10  PIAKLRTALRTWYQESGRDLPWRQT--------QDPYAIWVSEIMLQQTQVKTVIPYYQR 61

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           ++ ++PTI  L++A  +++L  W GLGYY RARNL + A  +V  ++G FP + + +  L
Sbjct: 62  WLAQFPTIASLAAAPQQDVLKVWQGLGYYARARNLHRAAQQVVADWDGTFPEQFDQVMSL 121

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSR 183
           PGIG  TA  I++ AFN    ++D N++RI+ R   I +P       +   +  +     
Sbjct: 122 PGIGRTTAGGILSAAFNQPTPILDGNVKRILVRLLAIQQPPKKVLADLWEASTALLDPEY 181

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVF 243
           P +F QA MDLGA +CT  +P C  CP + +C  +       L +   K   P +   V 
Sbjct: 182 PREFNQAFMDLGATLCTPKQPQCDRCPWRSDCQAYRHQLQTTLPMTEQKAPVPHKQIGVA 241

Query: 244 IAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKD------GNIDTHSAPFTANWILCN 297
           +   + N+IL+ KR    LL G+ E PG      +         I               
Sbjct: 242 VIWNDQNQILIDKRPQKGLLGGLWEFPGGKVEPQESVEDCIRREIKEELGIEIGVDDHLI 301

Query: 298 TITHTFTHFTLTLFVWKTI----VPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGG-- 351
           T+ H +THF +TL V         PQ +   +  W     L     P   ++ ++A    
Sbjct: 302 TVNHAYTHFKVTLMVHHCHHIQGEPQAIECDEIRWVTLAELDEYPFPKANQEIIAALRAS 361

Query: 352 -IKVPQ 356
               P+
Sbjct: 362 KQPAPK 367


>gi|49474013|ref|YP_032055.1| A/G-specific adenine glycosylase [Bartonella quintana str.
           Toulouse]
 gi|49239516|emb|CAF25873.1| A/G-specific adenine glycosylase [Bartonella quintana str.
           Toulouse]
          Length = 368

 Score =  265 bits (676), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 169/351 (48%), Positives = 221/351 (62%), Gaps = 5/351 (1%)

Query: 6   HIIQSKILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTVEPYFKKF 64
           H I S++L WYD  HR LPWR +P+ ++  +   PY+VW+SEIMLQQTTV+ V+PYFKKF
Sbjct: 18  HEISSRLLSWYDQKHRHLPWRITPEEQRQGIRPDPYRVWLSEIMLQQTTVEAVKPYFKKF 77

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           ++ WP +  L+ A  ++I+ AWAGLGYY+RARNLK CA  +V+ Y G FP  V+ L+ LP
Sbjct: 78  LKLWPDLSSLAKASQDDIMKAWAGLGYYSRARNLKNCAQQLVETYAGQFPQSVKALRTLP 137

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRP 184
           GIGDYTA+A+ AIAFNH   V+D+N+ER+++R F I    P     IK   +KITS +RP
Sbjct: 138 GIGDYTAAALAAIAFNHPVAVIDSNVERVVTRLFAITSVLPKAKAEIKEKTQKITSFNRP 197

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
           GDF QAMMDLGA ICT  KP C LCP+Q  C      K     +   KK+RP  TG  F+
Sbjct: 198 GDFAQAMMDLGATICTPRKPSCLLCPLQSFCKAEKMQKVESFPVKAPKKERPSNTGIAFV 257

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFT 304
            +    +I L KR   +LL+GM ++P +   +         +APFTANW     ITH FT
Sbjct: 258 VLNEKQQIYLEKRQGKKLLDGMTQIPNNIGIN---NENGLQNAPFTANWQFKGQITHVFT 314

Query: 305 HFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
           HF+L L V+     Q +   +  W D  +LA  ALPTVMKKA+ A  I  P
Sbjct: 315 HFSLKLDVYYISGVQEMKCENGWWCDIHHLAEQALPTVMKKAI-ALAIPNP 364


>gi|218510492|ref|ZP_03508370.1| A/G-specific adenine glycosylase protein [Rhizobium etli Brasil 5]
          Length = 359

 Score =  265 bits (676), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 165/347 (47%), Positives = 222/347 (63%), Gaps = 5/347 (1%)

Query: 9   QSKILDWYDTNHRVLPWRTSPK-TEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQK 67
              +LDWYD +HR LPWR SP    +   P PY+VW+SE+MLQQTTV+ V+PYF++F+ +
Sbjct: 3   AQPLLDWYDRHHRDLPWRVSPGMAARGVKPDPYRVWLSEVMLQQTTVQAVKPYFERFLAR 62

Query: 68  WPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIG 127
           WP +  L++A+++ +++AWAGLGYY RARNLKKCA+ + +++ G FP     LK LPGIG
Sbjct: 63  WPEVTDLAAAENDAVMAAWAGLGYYARARNLKKCAEAVAQEHGGVFPDSEAGLKALPGIG 122

Query: 128 DYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDF 187
           DYTA+A+ AIAFN  A V+D N+ER+ISR + I  P P     +KN   ++T   RPGDF
Sbjct: 123 DYTAAAVAAIAFNRQAAVMDGNVERVISRLYAIETPLPAAKPLMKNKVARLTPADRPGDF 182

Query: 188 VQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAIT 247
            QAMMDLGA ICT  +P C LCP +  C         L  +   KK++P+R GA F+A+T
Sbjct: 183 AQAMMDLGATICTPKRPACSLCPFRVACQALKLSDPELFPVKAAKKEKPVRQGAAFVAVT 242

Query: 248 NDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFT 307
            D  ILLR+R  + LL GM E+P +AW++  DG     +APF A W  C T+ H FTHF 
Sbjct: 243 EDGEILLRRRAESGLLGGMTEVPTTAWTARIDGETSVAAAPFDAAWQACGTVIHVFTHFE 302

Query: 308 LTLFVWKTIVPQIVIIPDS----TWHDAQNLANAALPTVMKKALSAG 350
           L L +W+T +       D      W    NL   ALPT+MKKA++A 
Sbjct: 303 LRLSIWRTAIAGRAKTKDGLNDEWWEPVTNLEAQALPTIMKKAIAAA 349


>gi|319784677|ref|YP_004144153.1| A/G-specific adenine glycosylase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170565|gb|ADV14103.1| A/G-specific adenine glycosylase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 401

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 155/344 (45%), Positives = 210/344 (61%), Gaps = 3/344 (0%)

Query: 8   IQSKILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
           I S++L WYD +HR LPWR +P+     +   PY++W+SE+MLQQTTV+ V+ YF+ F++
Sbjct: 42  IASRLLGWYDVHHRELPWRITPREHARGVRPDPYRIWLSEVMLQQTTVEAVKAYFRIFVE 101

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           KWP +  L++   E+++ AWAGLGYY+RARNLK CAD +V    G FP     L++LPGI
Sbjct: 102 KWPDVEALAATPAEDVMKAWAGLGYYSRARNLKACAD-LVAARGGRFPDTETGLRELPGI 160

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGD 186
           G YT++AI AIAF+  A VVD N+ER+ISR F I  P       I+ +  ++    RPGD
Sbjct: 161 GAYTSAAITAIAFDRPAAVVDGNVERVISRLFSITTPLSEAKPEIRAHVERMVPGIRPGD 220

Query: 187 FVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAI 246
           F QAMMDLGA ICT  +P C LCP++++C     G      +   K  +P R GA F+A+
Sbjct: 221 FAQAMMDLGATICTPRRPRCMLCPLREDCDAVVSGDPEHFPVRLPKADKPQRHGAAFVAV 280

Query: 247 TNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHF 306
             D  ILLRKR    LL GM E+P + W++  DG     +APF A+W     I H FTHF
Sbjct: 281 RADGAILLRKRAEKGLLGGMTEVPTTGWTARIDGATTQAAAPFPADWRHAGRIAHVFTHF 340

Query: 307 TLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            L L V+   + +        W  A  ++  ALPTVMKKA+ A 
Sbjct: 341 ALELEVFHAHI-KGDAPDGHFWSLAHEISGEALPTVMKKAIEAA 383


>gi|218441431|ref|YP_002379760.1| A/G-specific adenine glycosylase [Cyanothece sp. PCC 7424]
 gi|218174159|gb|ACK72892.1| A/G-specific adenine glycosylase [Cyanothece sp. PCC 7424]
          Length = 363

 Score =  264 bits (674), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 112/355 (31%), Positives = 174/355 (49%), Gaps = 18/355 (5%)

Query: 8   IQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQK 67
           I+  +L WY    R LPWR            PY +W+SEIMLQQT VKTV P++++++Q+
Sbjct: 13  IRQLLLLWYKEKGRDLPWRH--------QKDPYCIWVSEIMLQQTQVKTVIPFYQRWLQR 64

Query: 68  WPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIG 127
           +PTI  L+ A  +E+L AW GLGYY RARNL K A  +++ Y G FP ++E +  LPGIG
Sbjct: 65  FPTIKDLALADLQEVLKAWEGLGYYARARNLHKAAQYLIQNYNGIFPDRLEEVLSLPGIG 124

Query: 128 DYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDF 187
             TA  I++ AFN    ++D N++R++SR+  +  P       +   +  +     P DF
Sbjct: 125 RTTAGGILSAAFNQPISILDGNVKRVLSRFIALSVPPSKALPQLWELSDSLIDLENPRDF 184

Query: 188 VQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAIT 247
            Q +MDLGA +CT   P C  CP Q +C  +++G    L ++      P +   V +   
Sbjct: 185 NQGLMDLGATVCTRKNPKCDQCPWQGDCQAYNKGIQSQLPMSEKSTPIPHKKIGVAVIYN 244

Query: 248 NDNRILLRKRTNTRLLEGMDELPGSAWSSTK------DGNIDTHSAPFTANWILCNTITH 301
           +  +IL+ +R   ++L G+ E PG      +         I               T+ H
Sbjct: 245 DQGQILIDRRPTDKMLGGLWEFPGGKLEPDETVEECIKREILEELGIIIEVNEHIITVDH 304

Query: 302 TFTHFTLTLFVWKTI----VPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGI 352
            +THF ++L V         P+ +   +  W +   L     P    K + A  +
Sbjct: 305 AYTHFRVSLIVHACRYLGGEPKPIGCEEIRWVNLDQLEEFPFPKANIKIIEALKL 359


>gi|330446889|ref|ZP_08310540.1| A/G-specific adenine glycosylase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491080|dbj|GAA05037.1| A/G-specific adenine glycosylase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 354

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 110/356 (30%), Positives = 172/356 (48%), Gaps = 17/356 (4%)

Query: 7   IIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
                IL WYD   R  LPW+ +         +PYKVW+SEIMLQQT V TV PYF++FM
Sbjct: 4   SFSDAILAWYDKFGRKTLPWQQN--------KTPYKVWLSEIMLQQTQVATVIPYFERFM 55

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
           +++PT+  L++A+ +E+L  W GLGYY RARNL K A +IV  + G FP  ++ ++ LPG
Sbjct: 56  ERFPTVQDLAAAEQDEVLHLWTGLGYYARARNLHKAAKMIVSDHNGVFPTDIDQVQALPG 115

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTSR 183
           IG  TA A+++++      ++D N++R +SR + +           T+   A   T    
Sbjct: 116 IGRSTAGAVLSLSLGQHHPILDGNVKRTLSRCYAVEGWPGKKPVENTLWEIAETNTPADG 175

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVF 243
              + QAMMD+GA+ICT +KP C LCP+   CL  ++ +         KK         F
Sbjct: 176 VERYNQAMMDMGAMICTRSKPKCELCPVSNQCLALAQQRQMDFPGKKTKK-TMPEKQTWF 234

Query: 244 IAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAP--FTANWILCNTITH 301
             + + N++ L +R    +  G+   P                       N        H
Sbjct: 235 AILQHGNKVWLEQRPQVGIWGGLWCFPQHDSDDLAPLLEKQLGQQQGLIKNNQQLTAFRH 294

Query: 302 TFTHFTLTLFVWKTIV---PQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
           TF+H+ L +      +   P ++      W+D +N A   L   ++K L +   ++
Sbjct: 295 TFSHYHLDIVPMLYELSDEPNVINDSAGQWYDLENPAKIGLAAPVQKILESLAYQL 350


>gi|240850101|ref|YP_002971494.1| A/G-specific adenine glycosylase MutY [Bartonella grahamii as4aup]
 gi|240267224|gb|ACS50812.1| A/G-specific adenine glycosylase MutY [Bartonella grahamii as4aup]
          Length = 352

 Score =  264 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 166/343 (48%), Positives = 218/343 (63%), Gaps = 4/343 (1%)

Query: 7   IIQSKILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTVEPYFKKFM 65
            I S +L WYD NHR LPWR +P+ +K  +   PY+VW+SEIMLQQTTV+TV+PYFKKF+
Sbjct: 3   EISSHLLAWYDQNHRHLPWRITPEKQKQGIRPDPYQVWLSEIMLQQTTVETVKPYFKKFL 62

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
           + WP +  L+ A  ++I+ AWAGLGYY+RARNLKKCA  +V+ Y G FP  V+ L+ L G
Sbjct: 63  KLWPDLSSLAKASQDDIMKAWAGLGYYSRARNLKKCAQQLVENYAGQFPQSVKELRTLAG 122

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPG 185
           IGDYTA+AI +IAFNH   VVD N+ER+++R F I          IK   +KIT+ +RPG
Sbjct: 123 IGDYTAAAIASIAFNHPVAVVDGNVERVVARLFAITSILQKAKVEIKEKTQKITALNRPG 182

Query: 186 DFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIA 245
           DF QAMMDLGA +CT  KP C  CP+Q  C      +     +   KK+RP +TG  F+A
Sbjct: 183 DFAQAMMDLGATVCTPRKPSCYTCPLQCLCKAAKTQQQESFPVKAPKKERPSKTGIAFVA 242

Query: 246 ITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTH 305
           +    +I L KR   +LL GM ++P +   +         +APFTANW     ITH FTH
Sbjct: 243 LNKKRQIYLEKRQTQKLLGGMTQIPNNIGIN---NENGLQNAPFTANWQFKGQITHVFTH 299

Query: 306 FTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALS 348
           F+L L V+ T     +   +  W + Q+LA  ALPTVMKKA+S
Sbjct: 300 FSLKLDVYYTEDIHEMNCENGWWCNIQHLAEEALPTVMKKAIS 342


>gi|190890708|ref|YP_001977250.1| A/G-specific adenine glycosylase [Rhizobium etli CIAT 652]
 gi|190695987|gb|ACE90072.1| A/G-specific adenine glycosylase protein [Rhizobium etli CIAT 652]
          Length = 367

 Score =  264 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 168/355 (47%), Positives = 229/355 (64%), Gaps = 5/355 (1%)

Query: 1   MPQPEHIIQSKILDWYDTNHRVLPWRTSPK-TEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           +  P+      +LDWYD +HR LPWR SP    +   P PY+VW+SE+MLQQTTV+ V+P
Sbjct: 3   ITTPDTPHAQPLLDWYDRHHRDLPWRVSPGMAARGVKPDPYRVWLSEVMLQQTTVQAVKP 62

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF++F+++WP +  L++A+++ +++AWAGLGYY RARNLKKCA+ + +++ G FP     
Sbjct: 63  YFERFLERWPEVTDLAAAENDAVMAAWAGLGYYARARNLKKCAEAVAQEHGGVFPDSEAG 122

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKIT 179
           LK LPGIGDYTA+A+ AIAFN  A V+D N+ER+ISR + I  P P     +KN    +T
Sbjct: 123 LKALPGIGDYTAAAVAAIAFNRQAAVMDGNVERVISRLYAIETPLPAAKPVMKNKVALLT 182

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              RPGDF QAMMDLGA ICT  +P C LCP +  C         L  +   KK++P+R 
Sbjct: 183 PAGRPGDFAQAMMDLGATICTPKRPACSLCPFRGACQALKLSDPELFPVKAAKKEKPVRQ 242

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           GA F+A+T D  ILLR+R  + LL GM E+P +AW++  DG     +APF A W  C T+
Sbjct: 243 GAAFVAVTADGEILLRRRAESGLLGGMTEVPTTAWTARIDGETSVAAAPFNAAWQACGTV 302

Query: 300 THTFTHFTLTLFVWKTIV---PQIVIIPDSTWHDA-QNLANAALPTVMKKALSAG 350
            H FTHF L L +W+T +   PQI    +  W +   NL   ALPT+MKKA++A 
Sbjct: 303 IHLFTHFELRLSIWRTAIAAKPQIGNATNDEWWEPVTNLEAQALPTIMKKAIAAA 357


>gi|110677701|ref|YP_680708.1| A/G-specific adenine glycosylase, putative [Roseobacter
           denitrificans OCh 114]
 gi|109453817|gb|ABG30022.1| A/G-specific adenine glycosylase, putative [Roseobacter
           denitrificans OCh 114]
          Length = 355

 Score =  264 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 147/351 (41%), Positives = 196/351 (55%), Gaps = 3/351 (0%)

Query: 2   PQPEHIIQSKILDWYDTNHRVLPWRTSPKTEK-SSLPSPYKVWISEIMLQQTTVKTVEPY 60
           P    ++   IL WYD + R +PWR  P+  +    P PY++W+SE+MLQQTTV TV+ Y
Sbjct: 5   PDDPQVLSDAILAWYDVHARDMPWRVPPQARRAGQTPDPYRIWLSEVMLQQTTVATVKSY 64

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           F++F  +WPT+  L++A+D ++++ WAGLGYY RARNL KCA  + + Y G FP     L
Sbjct: 65  FERFTARWPTVRDLAAAQDADVMAEWAGLGYYARARNLLKCARTVDQDYGGTFPADHAEL 124

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITS 180
            KLPGIG YTA+AI +IAF+    V+D N+ER+++R  DI  P P     +   A  +T 
Sbjct: 125 LKLPGIGPYTAAAIASIAFDLRHTVLDGNVERVMARLHDIHVPLPASKPILMEKADALTP 184

Query: 181 TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG 240
             RPGD+ QA+MDLGA ICT   P C +CP +  C   +EG +  L   T KK +P R G
Sbjct: 185 VDRPGDYAQAVMDLGATICTPKSPACGICPWRDPCAARAEGTAADLPKKTPKKAKPTRHG 244

Query: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILC-NTI 299
            VF+A   D   LL  R +  LL GM   PGS W       +     P  A W L    +
Sbjct: 245 TVFLAQRADGAWLLETRPDKGLLGGMLGWPGSDWI-DVSHPLPEAPPPCAAEWQLIDGEV 303

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            HTFTHF L L V++  V          + DA       LPTVM+KA    
Sbjct: 304 RHTFTHFHLILHVFRAQVAIGTEPETGGFRDAAEFKPTDLPTVMRKAFDLA 354


>gi|288961583|ref|YP_003451893.1| A/G-specific adenine glycosylase [Azospirillum sp. B510]
 gi|288913863|dbj|BAI75349.1| A/G-specific adenine glycosylase [Azospirillum sp. B510]
          Length = 352

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 147/357 (41%), Positives = 193/357 (54%), Gaps = 7/357 (1%)

Query: 1   MPQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
           M Q       ++L WYD + R LPWR  P         PY+VW+SEIMLQQTTV  V PY
Sbjct: 1   MIQDSDQAARRLLSWYDRHRRDLPWRAKPGETA----DPYRVWLSEIMLQQTTVPAVAPY 56

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           F+ F ++WPT+  L+ A  +E+L AWAGLGYY RARNL KCA  +   + GNFP     L
Sbjct: 57  FRNFTERWPTVRDLADAPLDEVLVAWAGLGYYARARNLHKCARAVADGHGGNFPGTEAAL 116

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITS 180
            +LPGIG YTA+AI AIAF   A VVD N+ER+++R F + +P P     ++  A  +T 
Sbjct: 117 LELPGIGAYTAAAITAIAFGRKATVVDGNVERVVARIFALEEPLPNAKPALRRLAATLTP 176

Query: 181 TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG 240
             RPGD+ QAMMDLGA +CT  KP C LCP  + C   + G +  L     K ++P R G
Sbjct: 177 DFRPGDYAQAMMDLGATVCTPRKPKCMLCPWAEFCEARAAGIAESLPRKAAKAEKPTRRG 236

Query: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNID-THSAPFTANWILC-NT 298
             +  +  D  +LLR+R    LL GM E+P ++W     G        P  A W      
Sbjct: 237 VAYWLLNPDGAVLLRRRAEEGLLGGMAEIPSTSWGPELPGEAAVAAQQPLPARWRRLPGL 296

Query: 299 ITHTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
           + HTFTHF L L V            + +W     L + ALP+VM K +    +  P
Sbjct: 297 VRHTFTHFHLELEVVTARAGDGWRTAEGSWVPVDRLGDHALPSVMVKVVRHA-LAHP 352


>gi|22298621|ref|NP_681868.1| adenine glycosylase [Thermosynechococcus elongatus BP-1]
 gi|22294801|dbj|BAC08630.1| adenine glycosylase [Thermosynechococcus elongatus BP-1]
          Length = 368

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 114/356 (32%), Positives = 170/356 (47%), Gaps = 18/356 (5%)

Query: 4   PEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKK 63
           P   ++  +L+WY    R LPWR S          PY +W+SEIMLQQT V TV PY+++
Sbjct: 12  PLPALRFALLNWYQQQGRDLPWRHS--------RDPYAIWVSEIMLQQTQVATVIPYYQR 63

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           ++  +PT+  L++A+ E +L  W GLGYY RAR+L + A  I+  + G FP   E +  L
Sbjct: 64  WLATFPTLPDLAAAELETVLKLWQGLGYYARARHLHRAAQQIMTHHAGEFPRSYEAVVAL 123

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSR 183
           PGIG  TA AI++ AFN    ++D N++R+++R + +  P       +  ++ ++     
Sbjct: 124 PGIGRSTAGAILSAAFNQPQPILDGNVKRVLARLYGLTVPPKQAEAQLWQWSAQLLCPQS 183

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVF 243
           P DF QA+MDLGA ICT   PLC  CP Q +CL      +H +     +   P +   V 
Sbjct: 184 PRDFNQALMDLGATICTPRHPLCHACPWQHHCLAHRHQLTHEIPRKMSRSPLPHKKIGVA 243

Query: 244 IAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTK------DGNIDTHSAPFTANWILCN 297
           +      +IL+ +R  T LL G+ E PG      +         I               
Sbjct: 244 VIWNATGQILIDRRPPTGLLGGLWEFPGGKIEPNETVQECIQREIREELGIEIRVGEHLI 303

Query: 298 TITHTFTHFTLTLFVWKTI----VPQIVIIPDSTWHDAQNLANAALPTVMKKALSA 349
            I H +THF +TL V+        PQ +      W   + L     P      + A
Sbjct: 304 DIDHAYTHFRVTLHVYYCQHLSGTPQPLECDAIRWVTPEELEQFPFPKANTAIIQA 359


>gi|222147827|ref|YP_002548784.1| A/G-specific adenine glycosylase [Agrobacterium vitis S4]
 gi|221734816|gb|ACM35779.1| A/G-specific adenine glycosylase [Agrobacterium vitis S4]
          Length = 388

 Score =  263 bits (671), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 165/355 (46%), Positives = 216/355 (60%), Gaps = 6/355 (1%)

Query: 2   PQPEHIIQSKILDWYDTNHRVLPWRTSPK-TEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
           P  E +   ++L WYD +HR LPWR SP    +   P PY +W+SE+MLQQTTV+ V+PY
Sbjct: 23  PHQEGLSADELLAWYDRHHRDLPWRISPPMAARGIRPDPYHIWLSEVMLQQTTVQAVKPY 82

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           F KF+ +WP +  L++A  E++++AWAGLGYY RARNLKKCA+ +   + G FP   + L
Sbjct: 83  FLKFLARWPKVTDLAAAPTEDVMAAWAGLGYYARARNLKKCAEAVADLHGGVFPDTQDGL 142

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITS 180
           + LPGIGDYT++AI AIAFN  A V+D N+ER+ISR + I  P P     IK     +T 
Sbjct: 143 QSLPGIGDYTSAAIAAIAFNRQAAVMDGNVERVISRLYAISDPLPGAKPAIKARVAALTP 202

Query: 181 TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG 240
             RPGDF QAMMDLGA ICT  +P C LCP   +CL           +   KK +P+R G
Sbjct: 203 IERPGDFAQAMMDLGATICTPKRPACSLCPFNAHCLALKAHDPEHFPVKAAKKTKPVRLG 262

Query: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTIT 300
           A FIA+ + NRILLRKR +  LL GM E+P + W++  DG+    SAP  ANW  C  +T
Sbjct: 263 AAFIALDDRNRILLRKRADKGLLGGMTEVPTTEWTARIDGDDSEASAPMDANWRACGVVT 322

Query: 301 HTFTHFTLTLFVWKTIVPQIVI-----IPDSTWHDAQNLANAALPTVMKKALSAG 350
           H FTHF L L +++    +             W    NL   ALPTVMKKA++  
Sbjct: 323 HVFTHFELRLTIFRADAVKGRPDDYHWADHGWWEPLINLEAQALPTVMKKAITQA 377


>gi|328544983|ref|YP_004305092.1| a/g-specific adenine glycosylase protein [polymorphum gilvum
           SL003B-26A1]
 gi|326414725|gb|ADZ71788.1| Probable a/g-specific adenine glycosylase protein [Polymorphum
           gilvum SL003B-26A1]
          Length = 362

 Score =  263 bits (671), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 156/354 (44%), Positives = 213/354 (60%), Gaps = 4/354 (1%)

Query: 1   MPQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSL-PSPYKVWISEIMLQQTTVKTVEP 59
           +P       + +LDWYD + R LPWR +P   ++ + P PY VW+SEIMLQQTTV  V  
Sbjct: 7   LPMIALPSAADLLDWYDRHARDLPWRIAPDDRRAGIVPDPYHVWLSEIMLQQTTVAAVRD 66

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           Y++ F+ +WP +  L++A  +++L AWAGLGYY+RARNLK CA+++ + + G FP   + 
Sbjct: 67  YYRAFLARWPNVEALAAADLDDVLRAWAGLGYYSRARNLKACAEMVARDHGGRFPDSEDA 126

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKIT 179
           L+ LPGIG YTA+AI AIAF+  A VVD N+ER+++R F I  P P     I+    ++T
Sbjct: 127 LRALPGIGAYTAAAIAAIAFDARAAVVDGNVERVMARLFRIETPLPDAKPEIRAAMDRLT 186

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              RPGDF QA+MDLGA +CT  +P C LCP  + C     G +  L +   KK +P R 
Sbjct: 187 PADRPGDFAQAVMDLGATLCTPRRPACALCPWSQACAGRHAGVAETLPLKAPKKAKPTRR 246

Query: 240 G-AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN- 297
           G A     + D  ILLRKR    LL GM E+PG+ WS T D +     APF A W +   
Sbjct: 247 GAAFVARRSADGAILLRKRPAKGLLGGMAEVPGTPWSETFDPSSAAGLAPFPAGWRVQPA 306

Query: 298 TITHTFTHFTLTLFVWKTIVPQIVIIPDSTWHD-AQNLANAALPTVMKKALSAG 350
            + H FTHF L L V    + + + +PD+ W      LA  ALPTVM+K ++AG
Sbjct: 307 PVRHIFTHFHLELSVLVADLAEPLPLPDAHWWSAPGELAGEALPTVMRKVVAAG 360


>gi|56750865|ref|YP_171566.1| mutator MutT protein [Synechococcus elongatus PCC 6301]
 gi|81299484|ref|YP_399692.1| A/G-specific DNA-adenine glycosylase [Synechococcus elongatus PCC
           7942]
 gi|56685824|dbj|BAD79046.1| mutator MutT protein [Synechococcus elongatus PCC 6301]
 gi|81168365|gb|ABB56705.1| A/G-specific DNA-adenine glycosylase [Synechococcus elongatus PCC
           7942]
          Length = 360

 Score =  262 bits (670), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 111/353 (31%), Positives = 178/353 (50%), Gaps = 18/353 (5%)

Query: 7   IIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
            ++  +L WY    R LPWR +          PY +WISE+MLQQT V+TV PY++++++
Sbjct: 9   ELRRSLLAWYGQQGRDLPWRQT--------RDPYAIWISEVMLQQTQVQTVIPYYQRWLE 60

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L+ A    +L AW GLGYY+RARNL + A  IV +++G FP     ++ LPGI
Sbjct: 61  RFPTVEVLAIADLNAVLKAWEGLGYYSRARNLHRAAQQIVTEHQGRFPESATAVEALPGI 120

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGD 186
           G  TA  I++ AFN    ++D N++R+++R   +  P       +  ++  +    +P D
Sbjct: 121 GRTTAGGILSAAFNQPQAILDGNVKRVLARLGALPLPPARAIAQLWQWSEALIDPDQPRD 180

Query: 187 FVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAI 246
           F QA+MDLGA ICT  KP+C  CP    C  ++   +  L +       P +   V +  
Sbjct: 181 FNQAIMDLGATICTPRKPVCDRCPWSFACAAYNTQMTEQLPLREASSPIPHKQIGVAVIW 240

Query: 247 TNDNRILLRKRTNTRLLEGMDELPGSAWSSTKD------GNIDTHSAPFTANWILCNTIT 300
            +  +IL+ +R    LL G+ E PG    + +         I        A      ++ 
Sbjct: 241 NDRGQILIDQRKPEGLLGGLWEFPGGKIEAGESIEDCIRREIQEELGIAIAVGDHLISVD 300

Query: 301 HTFTHFTLTLFVWKTI----VPQIVIIPDSTWHDAQNLANAALPTVMKKALSA 349
           HT+THF +TL V         PQ +   +  W +   L+  A P   ++ ++A
Sbjct: 301 HTYTHFRVTLHVHYCQHLEGEPQAIECAEVRWVEPTELSEFAFPKANQQIITA 353


>gi|51892865|ref|YP_075556.1| A/G-specific adenine glycosylase [Symbiobacterium thermophilum IAM
           14863]
 gi|51856554|dbj|BAD40712.1| A/G-specific adenine glycosylase [Symbiobacterium thermophilum IAM
           14863]
          Length = 365

 Score =  262 bits (669), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 119/353 (33%), Positives = 172/353 (48%), Gaps = 20/353 (5%)

Query: 8   IQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQK 67
           +  ++LDWY  + R LPWR +          PY +W+SEIMLQQT V+TV PY++++M +
Sbjct: 1   MADRLLDWYSASARDLPWRRT--------RDPYHIWVSEIMLQQTRVETVIPYYERWMAR 52

Query: 68  WPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIG 127
           +PT+  L+ A +E++L AW GLGYY+RARNL   A  +V +Y G  P   + +  L GIG
Sbjct: 53  FPTLEALADAPEEQVLKAWEGLGYYSRARNLHAAAREVVARYGGTVPDDPDAVASLKGIG 112

Query: 128 DYTASAIVAIAFNHFAVVVDTNIERIISRYFDI--IKPAPLYHKTIKNYARKITSTSRPG 185
            YTA AI++IAFN     VD N+ R+I+R + I          +TI+   R +    RPG
Sbjct: 113 PYTAGAILSIAFNRPVPAVDGNVLRVIARLYAIVDDIAQLATRRTIEELVRAMIPQDRPG 172

Query: 186 DFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIA 245
           DF QA+MDLGA ICT  +P C LCP++  C     G+   L +    K   +        
Sbjct: 173 DFNQALMDLGATICTPRRPRCLLCPVRDLCEGRRAGRETELPVKGRAKAPRLVE-RAAAV 231

Query: 246 ITNDNRILLRKRTNTRLLEGMDELPGSA------WSSTKDGNIDTHSAPFTANWILCNTI 299
           I  + R+L+ +R    LL G+ ELPG                +        A       +
Sbjct: 232 IEREGRLLIVRRPQEGLLAGLWELPGGDVPPGVGPEEALQTLLRNALGAEVAVGEHLADV 291

Query: 300 THTFTHFTLTLFVWKTIV---PQIVIIPDSTWHDAQNLANAALPTVMKKALSA 349
           TH F+H    L  ++  V    ++    D  W     L     P +  K    
Sbjct: 292 THVFSHLVWHLRCFRAEVVPGTEVAERADVRWVKVDALGAYPFPAIYHKVFER 344


>gi|118590780|ref|ZP_01548181.1| probable a/g-specific adenine glycosylase protein [Stappia
           aggregata IAM 12614]
 gi|118436756|gb|EAV43396.1| probable a/g-specific adenine glycosylase protein [Stappia
           aggregata IAM 12614]
          Length = 359

 Score =  262 bits (669), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 158/353 (44%), Positives = 215/353 (60%), Gaps = 6/353 (1%)

Query: 9   QSKILDWYDTNHRVLPWRTSPKTEK-SSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQK 67
              +LDWYD + R LPWR SP+      +P PY++W+SE+MLQQTTV  V+ YF+KF + 
Sbjct: 7   SRLLLDWYDRHARRLPWRVSPEDRNLGEVPDPYRIWLSEVMLQQTTVAAVKDYFEKFTRS 66

Query: 68  WPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIG 127
           WPT+  L+ A +E+++ AWAGLGYY+RARNLKKCA+ + + ++G FP   E L KLPGIG
Sbjct: 67  WPTVTDLAEAAEEDVMKAWAGLGYYSRARNLKKCAETVARDHDGRFPEDEEALLKLPGIG 126

Query: 128 DYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDF 187
            YTA+AI  IAF+  A VVD N+ER+++R F I  P P     IK    ++T   RPGDF
Sbjct: 127 PYTAAAIATIAFDRHAAVVDGNVERVLTRLFQIETPLPDAKPEIKAKMAELTPDERPGDF 186

Query: 188 VQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAIT 247
            QA+MDLGA ICT  +P C +CP +  C   S   +  L     KK++P R GA F+A+ 
Sbjct: 187 AQAVMDLGATICTPRRPACAICPWRSICRVQSSALAETLPRKAPKKEKPTRFGAAFVAVD 246

Query: 248 NDN-RILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN-TITHTFTH 305
                +LLR+R    LL GM E+PG+ W+   D       APF A+W      + HTFTH
Sbjct: 247 AATGAVLLRRRPPRGLLGGMSEVPGTKWAEDFDLQDAVSLAPFPADWQQRPVEVKHTFTH 306

Query: 306 FTLTLFVWKTI--VPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVPQ 356
           F L L V++    V    ++  + W     + + ALPTVMKKAL A  ++ P+
Sbjct: 307 FHLRLTVYRADLVVSATPLLDGAWWSAPDVIESEALPTVMKKAL-AAAVERPR 358


>gi|220909544|ref|YP_002484855.1| A/G-specific adenine glycosylase [Cyanothece sp. PCC 7425]
 gi|219866155|gb|ACL46494.1| A/G-specific adenine glycosylase [Cyanothece sp. PCC 7425]
          Length = 386

 Score =  262 bits (669), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 110/361 (30%), Positives = 178/361 (49%), Gaps = 18/361 (4%)

Query: 2   PQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
           P     +Q  +L WY  + R LPWR +          PY +W+SEIMLQQT V+TV PY+
Sbjct: 31  PAQILDLQRSLLHWYRQHGRSLPWRET--------SDPYAIWVSEIMLQQTQVQTVIPYY 82

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++++   PTI  +++A+ +++L  W GLGYY+RARNL + A +I +++ G FP ++E + 
Sbjct: 83  QRWLAALPTIATVAAAEQQQVLKLWQGLGYYSRARNLHQAAQLIQQEFAGQFPSQLEAVL 142

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITST 181
           KLPGIG  TA  I++ AF     ++D N++R+++R   +  P       +  ++ ++   
Sbjct: 143 KLPGIGRTTAGGILSSAFAQPVAILDGNVKRVLARLLALPVPPRKAKGFLWQWSDRLLDR 202

Query: 182 SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGA 241
           ++P +F QA+MDLGA +C   KP CPLCP   +C          L +       P ++  
Sbjct: 203 TQPREFNQALMDLGATVCVPKKPDCPLCPWSNHCQALQLNLQSELPVTETAAPLPHKSIG 262

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTK------DGNIDTHSAPFTANWIL 295
           V +   +   IL+ +R    LL G+ E PG      +         I    A        
Sbjct: 263 VAVIWNDRGEILIDRRPQKGLLGGLWEFPGGKIEPGETVMACIQREIREELAIEIEVGEP 322

Query: 296 CNTITHTFTHFTLTLFVWKTI----VPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
             TI H +THF +TL V         PQ +   +  W   + +     P   ++ ++A  
Sbjct: 323 LITIDHAYTHFKVTLNVHHCRYVSGEPQPLGCDEVRWVTLEEIDQYPFPKANEQIIAALR 382

Query: 352 I 352
            
Sbjct: 383 K 383


>gi|163760357|ref|ZP_02167439.1| A/G-specific adenine glycosylase [Hoeflea phototrophica DFL-43]
 gi|162282308|gb|EDQ32597.1| A/G-specific adenine glycosylase [Hoeflea phototrophica DFL-43]
          Length = 360

 Score =  262 bits (668), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 162/351 (46%), Positives = 210/351 (59%), Gaps = 3/351 (0%)

Query: 2   PQPEHI-IQSKILDWYDTNHRVLPWRTSPKTEK-SSLPSPYKVWISEIMLQQTTVKTVEP 59
           P P    I   +L WYD + R LPWR SP+  +   +  PY+VW+SEIMLQQTTV+ V+ 
Sbjct: 6   PSPISAGIAPPLLAWYDRHARTLPWRVSPEDREHGVVADPYRVWLSEIMLQQTTVQAVKS 65

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF  F+++WPT+  L++A   +++ AWAGLGYY+RARNLKKCAD +  ++ G FP   E 
Sbjct: 66  YFDVFVRRWPTVNDLAAADTGDVMKAWAGLGYYSRARNLKKCADQVATEFGGVFPQTEEG 125

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKIT 179
           L+ LPGIG YTA+AI AIAF+  A VVD NIER+ +R F+I  P P     I       T
Sbjct: 126 LRALPGIGPYTAAAIAAIAFDVPAAVVDGNIERVFTRLFEIDTPLPSAKPEITTLVGSAT 185

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              RPGDF QA+MDLGA ICT  +P C LCP+ + C     G+     +   KK +P+R 
Sbjct: 186 PDERPGDFAQALMDLGATICTPKRPACALCPLDEGCAARVSGRQEAFPVKAPKKTKPVRK 245

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           GA F+A   D  +LL KR +  LL GM  LP S W+   DG     +APF A W     I
Sbjct: 246 GAAFVAERGDGAVLLVKRPDKGLLGGMSGLPTSNWTVRADGKTGISAAPFEAQWRQTGMI 305

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H FTHF L L V+  +V          W  + +LA  ALPTVMKKAL++ 
Sbjct: 306 SHVFTHFELRLEVFHAVV-TGTDDYGGWWSASDSLAEEALPTVMKKALASA 355


>gi|209886098|ref|YP_002289955.1| A/G-specific adenine glycosylase [Oligotropha carboxidovorans OM5]
 gi|209874294|gb|ACI94090.1| A/G-specific adenine glycosylase [Oligotropha carboxidovorans OM5]
          Length = 349

 Score =  262 bits (668), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 151/355 (42%), Positives = 202/355 (56%), Gaps = 15/355 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
           MP+        +L WYD + RVLPWR  P         PY+VW+SEIMLQQTTVK V PY
Sbjct: 1   MPR-----AELLLAWYDRHRRVLPWRAKPGETA----DPYRVWLSEIMLQQTTVKAVGPY 51

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           F KF+ +WP +  L++A  +++L  WAGLGYY+RARNL  CA  +   + G FP   E L
Sbjct: 52  FMKFVARWPRVTDLAAASLDDVLRMWAGLGYYSRARNLHACAVAVASAHGGAFPDTEEGL 111

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITS 180
           + LPGIG YTA+AI AIAF+   + VD NIER++SR F + +  P     I+  A  +  
Sbjct: 112 RALPGIGPYTAAAIAAIAFDCRTMPVDGNIERVVSRLFAVEEALPKAKPEIQRLAATLLG 171

Query: 181 TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG 240
            SR GD  QA+MDLGA ICT  KP C LCP+ ++CL   +G+         KK   +R G
Sbjct: 172 PSRAGDSAQALMDLGATICTPKKPACVLCPLNEDCLARHQGEQETFPRKAPKKTGALRQG 231

Query: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANW----ILC 296
           A F+ +T  + +L+R R    LL GM E+P SAW +  D      +AP   +        
Sbjct: 232 AAFV-VTRGDELLVRTRPEKGLLGGMTEVPTSAWLAEHDEKAARAAAPVLKDLARWRRKT 290

Query: 297 NTITHTFTHFTLTLFVWKTIVPQIVIIPDS-TWHDAQNLANAALPTVMKKALSAG 350
            T+TH FTHF L L V+ + VP+    P    W     LA+ ALP +M+K ++ G
Sbjct: 291 GTVTHVFTHFPLELSVYASEVPKGTRAPKGMRWVKIATLADEALPNLMRKVIAHG 345


>gi|87120349|ref|ZP_01076244.1| A/G-specific adenine glycosylase [Marinomonas sp. MED121]
 gi|86164452|gb|EAQ65722.1| A/G-specific adenine glycosylase [Marinomonas sp. MED121]
          Length = 352

 Score =  261 bits (667), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 119/354 (33%), Positives = 179/354 (50%), Gaps = 15/354 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
           QP      +IL W+D + R  LPW+           +PY+VWISEIMLQQT V TV PY+
Sbjct: 2   QPIDNFADRILTWFDQHGRKDLPWQ--------MDKTPYRVWISEIMLQQTQVVTVIPYY 53

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           +KFM  +P ++ L+ A ++E+L+ W+GLGYY RARNL K A ++  + +G FP  +E + 
Sbjct: 54  QKFMTSFPDVYRLADAPEDEVLAHWSGLGYYARARNLHKAAKVLANELDGTFPASLEGVC 113

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
           +L GIG  TA+AI++I+ N    ++D N++R++ R+  I            +   A    
Sbjct: 114 ELSGIGRSTAAAILSISRNEQTAILDGNVKRVLGRFHAIDTWPGEKKTENVMWELAESYM 173

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              R GD+ QAMMDLGA +CT +KP C  CPIQ +C   + G      I   KK  P R 
Sbjct: 174 PAERCGDYTQAMMDLGATLCTRSKPQCLFCPIQDDCQALASGTPTDYPIKKPKKSIPTRQ 233

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +      ++LL KR +T +  G+  LP S   +              +   L    
Sbjct: 234 TDMLVLQNPTGKVLLEKRVSTGIWGGLWSLPESQDEAITLATEQRFKVTINSLGALAG-F 292

Query: 300 THTFTHFTLTLFVWKTIV---PQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            HTF+H+ L +  +   V    +I       W+  +      LPT ++K L + 
Sbjct: 293 RHTFSHYHLEISPYLANVQASNEIGEEGKYQWYTLEEAMALGLPTPVRKILVSL 346


>gi|262273750|ref|ZP_06051563.1| A/G-specific adenine glycosylase [Grimontia hollisae CIP 101886]
 gi|262222165|gb|EEY73477.1| A/G-specific adenine glycosylase [Grimontia hollisae CIP 101886]
          Length = 356

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 111/357 (31%), Positives = 166/357 (46%), Gaps = 21/357 (5%)

Query: 6   HIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
                 IL WYD   R  LPW+           +PYKVW+SEIMLQQT V TV PYF++F
Sbjct: 3   QSFSDAILTWYDKYGRKTLPWQQ--------EKTPYKVWLSEIMLQQTQVATVIPYFERF 54

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M ++PT+  L+ A+ +E+L  W GLGYY RARNL K A  I   Y G FP  +E +  LP
Sbjct: 55  MTRFPTVVDLAHAELDEVLHLWTGLGYYARARNLHKAAQKIAADYNGEFPTTIEDVMALP 114

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTS 182
           G+G  TA A+++++      ++D N++R +SR+F +            +   A + T   
Sbjct: 115 GVGRSTAGAVLSLSLGQHHPILDGNVKRTLSRHFAVEGWPGKKPVENRLWELAEENTPAE 174

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
               + QAMMD+GA+ICT +KP C LCP+  +C   +  +         KK  P +    
Sbjct: 175 GVQRYNQAMMDMGAMICTRSKPKCYLCPVNHSCEANAMSRQSDFPGKKPKKTLPEKETCF 234

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHT 302
            +    D  I L +R    L  G+  LP ++  +         +A             HT
Sbjct: 235 VLFQYRDQ-IWLEQRPPAGLWGGLWCLPETSEQTAASFVASKLAASSFETPEHLTAFRHT 293

Query: 303 FTHFTLTLFVWKTIVPQ---------IVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           F+HF L +   +  +           I+      W++    A   L   ++K L + 
Sbjct: 294 FSHFHLDIVPIRVKLHHKPDNIGDNGIMEGNRGLWYNLNQPAKVGLAAPVQKLLESL 350


>gi|254413445|ref|ZP_05027215.1| A/G-specific adenine glycosylase [Microcoleus chthonoplastes PCC
           7420]
 gi|196179552|gb|EDX74546.1| A/G-specific adenine glycosylase [Microcoleus chthonoplastes PCC
           7420]
          Length = 373

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 115/358 (32%), Positives = 172/358 (48%), Gaps = 18/358 (5%)

Query: 9   QSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKW 68
           +  +L WY    R LPWR            PY +WISEIMLQQT VKTV PY+ +++ ++
Sbjct: 23  RETLLTWYANACRDLPWR--------GSTDPYPIWISEIMLQQTQVKTVIPYYHRWLAEF 74

Query: 69  PTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGD 128
           PTI  L++A  +++L  W GLGYY+RARNL K A  I++ Y G FP ++  +  LPGIG 
Sbjct: 75  PTIETLATADLQQVLLVWQGLGYYSRARNLHKAAQQIIQDYGGIFPDQLSDVLALPGIGR 134

Query: 129 YTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFV 188
            TA  I++ AFN    ++D N++RI++R   +  P     K +   +  +     PG F 
Sbjct: 135 TTAGGILSAAFNQPVPILDGNVKRILARLVALSVPPAKATKKLWQLSESLLDPEHPGTFN 194

Query: 189 QAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITN 248
           QA+MDLGA ICT   P C  CP Q +C  ++ G +  L +       P +   V +   N
Sbjct: 195 QALMDLGATICTPKNPDCCHCPWQSHCQAYNLGIASKLPMREASTPLPHKIIGVAVIWNN 254

Query: 249 DNRILLRKRTNTRLLEGMDELPGSAWSSTK------DGNIDTHSAPFTANWILCNTITHT 302
             +IL+ +R    LL G+ E PG      +         I               T+ H 
Sbjct: 255 QEQILIDRRPAQGLLGGLWEFPGGKIEPDETVADCIKREIREELGIEIEVGDRVITVDHA 314

Query: 303 FTHFTLTLFVWKTI----VPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVPQ 356
           ++HF +TL V        VPQ +   +  W   + +     P    + + A   +  +
Sbjct: 315 YSHFRVTLIVHHCRHLSGVPQALECDEIRWVTLEEIDQFPFPKANTQIIGALRQETER 372


>gi|127512056|ref|YP_001093253.1| A/G-specific adenine glycosylase [Shewanella loihica PV-4]
 gi|126637351|gb|ABO22994.1| A/G-specific DNA-adenine glycosylase [Shewanella loihica PV-4]
          Length = 368

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 110/356 (30%), Positives = 172/356 (48%), Gaps = 17/356 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                   +I+ WYD + R  LPW+           +PYKVW+SEIMLQQT V TV PYF
Sbjct: 17  MKTEQFHQRIVTWYDKHGRKHLPWQQD--------KTPYKVWVSEIMLQQTQVATVIPYF 68

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           + FM ++PTI  L++A  +E+L  W GLGYY RARNL K A +I   Y+G FP + E + 
Sbjct: 69  EAFMARFPTILDLANADQDEVLHHWTGLGYYARARNLHKSAQLIASDYDGVFPTQFEQVL 128

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPGIG  TA A+++++      ++D N++R+++R+  I            +      +T
Sbjct: 129 ALPGIGRSTAGAVLSLSLGQHHPILDGNVKRVLARHGAIAGWPGKREVEQQLWQLTNSLT 188

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             +    + QAMMD+GA ICT +KP C LCP+  +C     G+          KK     
Sbjct: 189 PKTGVTQYNQAMMDIGASICTRSKPRCELCPVAIDCKAQLMGRQTEFPGKK-PKKTIPEK 247

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
               + I +D+R+L+ KR    +  G+   P        +    T+     +     ++ 
Sbjct: 248 LGYMLVIKDDDRVLMSKRPPAGIWGGLWCFPQFDSQEALEEFAKTNGLTLISE-EPIDSF 306

Query: 300 THTFTHFTLTLFVWKTI----VPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
            HTF+HF L +  +         +I+    S W++        L    ++ L++ G
Sbjct: 307 RHTFSHFHLDISAFVAHQTTSAHEIMEESGSLWYNIAKPPKVGLAAATERILASLG 362


>gi|90420096|ref|ZP_01228004.1| A/G-specific adenine glycosylase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335430|gb|EAS49180.1| A/G-specific adenine glycosylase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 368

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 149/349 (42%), Positives = 202/349 (57%), Gaps = 3/349 (0%)

Query: 1   MPQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPS-PYKVWISEIMLQQTTVKTVEP 59
           MP         +L WYD + RVLPWR SP+     +   PY+VW+SEIMLQQTTV  V+ 
Sbjct: 1   MPADLRPFADHLLAWYDRHARVLPWRVSPQDRARGIRPAPYRVWLSEIMLQQTTVAAVKA 60

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF KF  +WP +  L++A    +L  WAGLGYY RARNL  CA  + +++ G FP     
Sbjct: 61  YFAKFTARWPHVADLAAAPQPAVLGEWAGLGYYARARNLHACAIRVSEEFGGAFPQTAAA 120

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKIT 179
           L+ LPGIGDYT++AI AIAF+  A VVD N+ER+++R F I  P P   K I+    ++T
Sbjct: 121 LRTLPGIGDYTSAAIAAIAFDEPAAVVDGNVERVVTRLFSIETPLPQARKDIRLRTAELT 180

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              RPGDF QAMMDLGA ICT  +P C +CP++  C   +EG++    +   K   P R 
Sbjct: 181 PQERPGDFAQAMMDLGATICTPKRPSCMVCPVRPMCRASAEGRAEDFPVKKPKAAVPERK 240

Query: 240 G-AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
           G A       D  + LR+R    +L+GM E PG+ W +  DG    ++APF A+W  C T
Sbjct: 241 GAAFVATRPADGAVWLRRRDAPGMLQGMSEPPGTGWHAKADGATGANAAPFAADWRFCGT 300

Query: 299 ITHTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKAL 347
           + H+FTHF L L V++  +       +  W   +     ALPT+M+K L
Sbjct: 301 VAHSFTHFRLELEVYRAELA-GDPPAEGWWCPPEARGAEALPTLMQKVL 348


>gi|217977764|ref|YP_002361911.1| A/G-specific adenine glycosylase [Methylocella silvestris BL2]
 gi|217503140|gb|ACK50549.1| A/G-specific adenine glycosylase [Methylocella silvestris BL2]
          Length = 359

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 148/340 (43%), Positives = 191/340 (56%), Gaps = 5/340 (1%)

Query: 12  ILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPTI 71
           +L WYD + RVLPWR  P         PY VW+SEIMLQQTTV  V+ YF  F+ +WP +
Sbjct: 15  VLAWYDRHRRVLPWRAPPGAAA----DPYAVWLSEIMLQQTTVAAVKSYFSAFLARWPNV 70

Query: 72  FCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYTA 131
             L+ A  EE++  WAGLGYY+RARNL  CA  +  K+ G FP +   L+ LPG+G YTA
Sbjct: 71  DALARAPAEEVMRQWAGLGYYSRARNLHACAKTVSAKFGGQFPDEEAALRALPGLGPYTA 130

Query: 132 SAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQAM 191
           +A+ AIAF   A VVD N+ER++SR + I  P P   + I   A  +T   RPGD+ QAM
Sbjct: 131 AAVAAIAFCRKAAVVDGNVERVLSRLYAIEAPPPAGKRLIYARAEALTPAERPGDYAQAM 190

Query: 192 MDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDNR 251
           MDLGA ICT   P C +CP+   C  F  G      +   K +RP+R GA F     D  
Sbjct: 191 MDLGATICTPKSPACAICPLNGACAAFRIGDPARFPVKAAKPERPLRRGAAFYVARPDGA 250

Query: 252 ILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN-TITHTFTHFTLTL 310
           +L+R R    LL GM E+PGS W+   D       AP  A +      + H+FTHF L L
Sbjct: 251 VLVRTRPPKGLLGGMTEIPGSPWTEDFDEAGAPRHAPVEARYRRLARPVEHSFTHFALQL 310

Query: 311 FVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            V+       +  PD     A +L N ALPT+M+K +SA 
Sbjct: 311 SVYVGEAGANMPAPDGCRWAAADLENEALPTLMRKLVSAA 350


>gi|163867894|ref|YP_001609098.1| A/G-specific adenine glycosylase MutY [Bartonella tribocorum CIP
           105476]
 gi|161017545|emb|CAK01103.1| A/G-specific adenine glycosylase MutY [Bartonella tribocorum CIP
           105476]
          Length = 351

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 167/343 (48%), Positives = 219/343 (63%), Gaps = 4/343 (1%)

Query: 7   IIQSKILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTVEPYFKKFM 65
            I S +L WYD NHR LPWR +P+ +K  +   PY+VW+SEIMLQQTTV+TV+PYFKKF+
Sbjct: 3   EISSHLLSWYDQNHRHLPWRITPEEQKQGIRPDPYQVWLSEIMLQQTTVETVKPYFKKFL 62

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
           + WP +  L+ A  E+I+ AWAGLGYY+RARNLKKCA  +V+ Y G FP  V+ L+ L G
Sbjct: 63  KLWPDLSSLAKASQEDIMKAWAGLGYYSRARNLKKCAKQLVENYAGQFPQSVKALRTLAG 122

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPG 185
           IGDYTA+AI AIAFNH   VVD N+ER+++R F I          IK   +KIT+ +RPG
Sbjct: 123 IGDYTAAAIAAIAFNHPVAVVDGNVERVVARLFAITSILSKAKAEIKEQTQKITALNRPG 182

Query: 186 DFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIA 245
           DF QAMMDLGA ICT  KP C +CP+Q  C      ++    +   KK+RP +TG  F+ 
Sbjct: 183 DFAQAMMDLGATICTPRKPSCYICPLQSLCKAAKMQQAEFFPVKAPKKERPSKTGIAFVV 242

Query: 246 ITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTH 305
           +    +I L KR   +LL GM ++P +   +         +APFTANW     ITH FTH
Sbjct: 243 LNKKRQIYLEKRQTQKLLGGMTQIPNNIGIN---NENGLQNAPFTANWQFKGQITHVFTH 299

Query: 306 FTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALS 348
           F+L L V+ T     +   +  W + Q+LA  ALPTVMKKA++
Sbjct: 300 FSLKLDVYYTDDIHEMNCENGWWCNIQHLAEEALPTVMKKAIA 342


>gi|83594581|ref|YP_428333.1| A/G-specific DNA-adenine glycosylase [Rhodospirillum rubrum ATCC
           11170]
 gi|83577495|gb|ABC24046.1| A/G-specific DNA-adenine glycosylase [Rhodospirillum rubrum ATCC
           11170]
          Length = 359

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 146/346 (42%), Positives = 190/346 (54%), Gaps = 7/346 (2%)

Query: 4   PEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKK 63
           P  ++  ++LDWY  N R LPWR            PY+VW+SE+MLQQTTV  V PYF+ 
Sbjct: 11  PASVLGERLLDWYRRNARTLPWRAP----FGERTDPYRVWLSEVMLQQTTVPAVIPYFQA 66

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           F+ +WPT+  L++A  +E+L+AWAGLGYY RARNL KCA  I    +G FP   + L  L
Sbjct: 67  FLARWPTVTDLAAAPLDEVLTAWAGLGYYARARNLHKCAQTIATWRDGTFPATEDELHTL 126

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSR 183
           PGIG YTA+AI AIAF   AVV+D NIER+++R F   +P P   K +   A ++T T+ 
Sbjct: 127 PGIGTYTAAAIAAIAFGQPAVVMDGNIERVMARLFAETEPLPQGKKALYARAAQLTPTAH 186

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVF 243
           PG+  QA+MDLGA +CT  KP C LCP +  CL    G +  L     KK +P R G  F
Sbjct: 187 PGEHAQALMDLGATLCTPRKPACGLCPWRDPCLGRRLGLAETLPAKAPKKLKPTRCGIAF 246

Query: 244 IAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSA-PFTANWILC-NTITH 301
                D  +LLR+R  + LL GM E+P + W        +  +  P  A W+     + H
Sbjct: 247 WVTRPDGTVLLRRRPESGLLGGMIEVPSTPWREDPWTLAEARAEAPLPAEWVPLAGRVRH 306

Query: 302 TFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKAL 347
           TFTHF L L V    V          W         ALP VM K +
Sbjct: 307 TFTHFHLDLDVVAGRV-GARANARGLWVPFDQFDRHALPAVMLKVV 351


>gi|254471759|ref|ZP_05085160.1| A/G-specific adenine glycosylase [Pseudovibrio sp. JE062]
 gi|211958961|gb|EEA94160.1| A/G-specific adenine glycosylase [Pseudovibrio sp. JE062]
          Length = 350

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 154/343 (44%), Positives = 197/343 (57%), Gaps = 2/343 (0%)

Query: 12  ILDWYDTNHRVLPWRTSPKT-EKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPT 70
           +L WYD N R LPWRT+P        P PY VW+SEIMLQQTTV  V+ YF+ F++ WPT
Sbjct: 7   LLYWYDRNSRQLPWRTAPADILSGVKPDPYHVWLSEIMLQQTTVAAVKSYFELFIKTWPT 66

Query: 71  IFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYT 130
           +  +++A++E+IL AWAGLGYY+RARNL KCA  +   + G FP + E L KLPG+G YT
Sbjct: 67  LADMANAEEEDILKAWAGLGYYSRARNLYKCAKYVQLHHNGRFPEEEERLLKLPGVGPYT 126

Query: 131 ASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQA 190
           A+AI  IAF   A VVD N+ER++SR   ++   P     +K    ++T   RPGDF QA
Sbjct: 127 AAAISTIAFGRHAAVVDGNVERVLSRRHALLTELPALKAEVKPLMAEVTPHDRPGDFAQA 186

Query: 191 MMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDN 250
           MMDLGA ICT   P C +CP  + C    +G +  L     KK +P R G  F+   +  
Sbjct: 187 MMDLGATICTPKSPACGICPWMEVCEGRKQGIADTLPRKAPKKVKPTRRGMAFLLRDDKG 246

Query: 251 RILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLTL 310
           RILLRKR +  LL GM E   + WS        T +            + HTFTHF L +
Sbjct: 247 RILLRKREDKGLLAGMSEPITTHWSDDAALEDLTAAPIHAEWVRTAKDVKHTFTHFHLEM 306

Query: 311 FVWKTIVPQIVIIPDSTWHD-AQNLANAALPTVMKKALSAGGI 352
            VW+   P     P+  W      L   ALPTVMKKAL AGG+
Sbjct: 307 SVWQAEAPANYAEPEGYWWSAPDELEGEALPTVMKKALKAGGL 349


>gi|121602108|ref|YP_988733.1| A/G-specific adenine glycosylase [Bartonella bacilliformis KC583]
 gi|120614285|gb|ABM44886.1| A/G-specific adenine glycosylase [Bartonella bacilliformis KC583]
          Length = 350

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 167/344 (48%), Positives = 217/344 (63%), Gaps = 4/344 (1%)

Query: 6   HIIQSKILDWYDTNHRVLPWRTSPKTE-KSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
           H I S++L WYD NHR LPWR +PK + K   P PY+VW+SEIMLQQTTV+TV+PYFKKF
Sbjct: 3   HEISSRLLSWYDKNHRHLPWRITPKEQMKGIHPDPYQVWLSEIMLQQTTVETVKPYFKKF 62

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           ++ WP +  LS A  ++I+ AWAGLGYY+RARNLK CAD +++ Y G FP  ++IL+ LP
Sbjct: 63  LKLWPDLLSLSQASQDDIMKAWAGLGYYSRARNLKNCADQLMRDYGGKFPQSMKILRSLP 122

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRP 184
           GIGDYTA+AI AIAF+    VVD NIERII+R F I    P     IK   ++I + +RP
Sbjct: 123 GIGDYTAAAIAAIAFSQPVSVVDGNIERIITRLFAITAMLPKAKSEIKEKIQEIIAINRP 182

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
           GDF QAMMDLGA+IC    P C LCP+Q  C            +   KK+R ++TGA F+
Sbjct: 183 GDFAQAMMDLGAIICKPRNPSCLLCPLQNLCEATKMQTVENFPVKPPKKERLLKTGAAFV 242

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFT 304
            I  D +I L KR    LL GM ++P +     ++       APF A+W     ITH FT
Sbjct: 243 VINKDKQIYLEKRETQTLLNGMTQIPNTIGLKNEN---ALLHAPFAADWQFKGQITHVFT 299

Query: 305 HFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALS 348
           HF+L   V+       + + +  W + Q+L   ALPTVMKKA+S
Sbjct: 300 HFSLKFDVYYIDNICEINLKNGWWCNIQHLTKEALPTVMKKAIS 343


>gi|260432299|ref|ZP_05786270.1| A/G-specific adenine glycosylase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416127|gb|EEX09386.1| A/G-specific adenine glycosylase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 363

 Score =  259 bits (662), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 152/341 (44%), Positives = 195/341 (57%), Gaps = 7/341 (2%)

Query: 8   IQSKILDWYDTNHRVLPWRTSPKTEKSS-LPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
           +   +L WYD + R LPWR SP    +   P PY+VW+SE+MLQQTTV  V  YF +F  
Sbjct: 9   LSRSLLAWYDRHARDLPWRVSPADRAAGMKPDPYRVWLSEVMLQQTTVAAVRDYFLRFTS 68

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           +WP +  L++A D+E+++ WAGLGYY RARNL KCA  +V +++G FP   + L KLPGI
Sbjct: 69  RWPDVRALAAAADDEVMAEWAGLGYYARARNLLKCARAVVDQHDGRFPDSHDALLKLPGI 128

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGD 186
           G YTA+AI AIAF+    V+D N+ER+++R  DI  P P     +K  A  +T   RPGD
Sbjct: 129 GPYTAAAIAAIAFDRPETVLDGNVERVMARLHDIHDPLPKSKPLLKAKAAALTPEERPGD 188

Query: 187 FVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAI 246
           + QA+MDLGA ICT   P C +CP++  C   + G    L   T K  +P R G V+IA 
Sbjct: 189 YAQAVMDLGATICTPKSPACGICPLRDPCQARAAGTQADLPRKTPKAPKPTRLGHVYIAQ 248

Query: 247 TNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN-TITHTFTH 305
             D  ILL +R  T LL GM   PGS WS          + PF A+W L    + HTFTH
Sbjct: 249 RADGAILLERRPETGLLGGMLGFPGSDWSED-----AAEAPPFPADWTLLPAEVRHTFTH 303

Query: 306 FTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKA 346
           F L L VW   VP  V                 LPTVM+KA
Sbjct: 304 FHLILRVWTAAVPAEVSPEGLVVMPKHAFRPGDLPTVMRKA 344


>gi|49475251|ref|YP_033292.1| A/G-specific adenine glycosylase [Bartonella henselae str.
           Houston-1]
 gi|49238056|emb|CAF27263.1| A/G-specific adenine glycosylase [Bartonella henselae str.
           Houston-1]
          Length = 368

 Score =  259 bits (662), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 167/356 (46%), Positives = 222/356 (62%), Gaps = 5/356 (1%)

Query: 1   MPQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTVEP 59
           + +  H I  ++L WYD  HR LPWR +PK +   +   PY+VW+SEIMLQQTTV+ V+P
Sbjct: 13  LTKIMHEISLRLLSWYDQKHRHLPWRITPKEQMQGIRPDPYRVWLSEIMLQQTTVEAVKP 72

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YFKKF+Q WP +  L+ A  ++I+ AWAGLGYY+RARNLK CA  +V+ Y G FP  +++
Sbjct: 73  YFKKFLQLWPDLSSLAKASQDDIMKAWAGLGYYSRARNLKNCAQQLVEDYGGQFPQSIKV 132

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKIT 179
           L+ L GIGDYTA+AI AIAFNH   VVD+N+ER+++R F I    P     IK   +KIT
Sbjct: 133 LRSLSGIGDYTAAAIAAIAFNHPVAVVDSNVERVVTRLFAITSVLPKAKAEIKEKTQKIT 192

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
           + +RPGDF QAMMDLGA IC   KP C LCP+Q  C      K+    +   KK+R  +T
Sbjct: 193 ALNRPGDFAQAMMDLGATICIPRKPSCSLCPLQGLCRAEKMQKAEFFPVKAPKKERLSKT 252

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           GA F+ +    +I L KR   +LL GM ++P +  +   +G     +APF ANW     I
Sbjct: 253 GAAFVVLNEKRQIYLEKRQGKKLLGGMTQIPNNIGTKNPNG---LQNAPFIANWQFKGQI 309

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
           TH FTHF+L L V+     + +   +  W D  +LA  ALPTVMKKA+ A  I  P
Sbjct: 310 THVFTHFSLKLDVYYISGIREIKHQNGWWCDIHHLAEQALPTVMKKAI-AVAIPHP 364


>gi|254422681|ref|ZP_05036399.1| A/G-specific adenine glycosylase [Synechococcus sp. PCC 7335]
 gi|196190170|gb|EDX85134.1| A/G-specific adenine glycosylase [Synechococcus sp. PCC 7335]
          Length = 359

 Score =  259 bits (661), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 113/358 (31%), Positives = 172/358 (48%), Gaps = 18/358 (5%)

Query: 7   IIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
            ++  +L WY  + R LPWR +          PY +WISE+MLQQT VKTV PY+K++++
Sbjct: 8   QLRRSLLSWYRQHGRDLPWRRT--------RDPYAIWISEVMLQQTQVKTVIPYYKRWLE 59

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
            +PT+  L++A  + +L  W GLGYY RARNL + A  IV K+ G FP K+E    L GI
Sbjct: 60  AFPTVQALAAADQQAVLKLWEGLGYYARARNLHQAAQQIVTKFGGVFPRKIENAITLKGI 119

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGD 186
           G  TA  I++ AFN    ++D N++R++SR              +   + ++   + P D
Sbjct: 120 GRTTAGGILSAAFNSPVPILDGNVKRVLSRLIAYPAVPNKALAPLWELSEQLLDPNYPRD 179

Query: 187 FVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAI 246
           F QA+MDLGA +CT + P C LCP Q  C  ++        +   +K  P +   V    
Sbjct: 180 FNQAIMDLGATLCTRHNPACLLCPWQSKCAAYNLNAVIRFPMTESRKPLPHKNIGVAAIT 239

Query: 247 TNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDG------NIDTHSAPFTANWILCNTIT 300
            +  +IL+ +R    LL G+ E PG      +         I               TI 
Sbjct: 240 DDQGKILIDRRKQEGLLGGLWEFPGGKIEPGESEEDCVKREIKEELDIEIKVGSKLITIE 299

Query: 301 HTFTHFTLTLFVWKTI----VPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
           HT+THF +TL V+        P+ +   +  W     + +   P    + + A  I+ 
Sbjct: 300 HTYTHFKVTLNVFNCTYLGGDPKPLECDEIRWVTLDEIDDYPFPKANSQIIEALRIQA 357


>gi|114765137|ref|ZP_01444282.1| A/G-specific adenine glycosylase [Pelagibaca bermudensis HTCC2601]
 gi|114542541|gb|EAU45567.1| A/G-specific adenine glycosylase [Roseovarius sp. HTCC2601]
          Length = 348

 Score =  259 bits (661), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 143/340 (42%), Positives = 194/340 (57%), Gaps = 7/340 (2%)

Query: 9   QSKILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTVEPYFKKFMQK 67
            + +LDWYD + R LPWR  P+   + +   PY+VW+SEIMLQQTTV  V+PYF+ F  +
Sbjct: 7   AADLLDWYDRHARDLPWRVGPRARAAGIRPDPYRVWLSEIMLQQTTVPAVKPYFEAFTTR 66

Query: 68  WPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIG 127
           WPT+  L++A+D ++++AWAGLGYY RARNL KCA ++  ++ G FP  +E L  LPG+G
Sbjct: 67  WPTVSDLAAAEDADVMAAWAGLGYYARARNLLKCARVVAAEHGGVFPQGLEGLLSLPGVG 126

Query: 128 DYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDF 187
            YTA A+ AIAF+  A VVD N+ER+++R      P P     +   A  +T   RPG +
Sbjct: 127 PYTAGAVAAIAFDIPATVVDGNVERVMARLHAEHTPLPQAKPILTEMAAALTPQERPGCY 186

Query: 188 VQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAIT 247
            QA+MDLGA IC+   P C LCP +  C  +  G    L     KK++P R G  ++   
Sbjct: 187 AQAVMDLGATICSPRNPACGLCPWRSACAAWEAGTMAELPKKAPKKRKPTRLGIAYLVRR 246

Query: 248 NDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT-ITHTFTHF 306
            D   LL +R +  LL GM   PGS W     G     + P  A W   NT   HTFTHF
Sbjct: 247 VDGAWLLERRPDKGLLGGMLGWPGSEW-----GEAPEEAPPIAAEWKALNTEARHTFTHF 301

Query: 307 TLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKA 346
            L L V   +VP         + +A++     LPTVM+KA
Sbjct: 302 HLRLTVKTALVPMDRPPERGEFVEAEDFDPKDLPTVMRKA 341


>gi|319898540|ref|YP_004158633.1| A/G-specific adenine glycosylase MutY [Bartonella clarridgeiae 73]
 gi|319402504|emb|CBI76047.1| A/G-specific adenine glycosylase MutY [Bartonella clarridgeiae 73]
          Length = 352

 Score =  259 bits (660), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 174/350 (49%), Positives = 226/350 (64%), Gaps = 5/350 (1%)

Query: 7   IIQSKILDWYDTNHRVLPWRTSPKTE-KSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
            I S +L WYD N+R LPWR SP+ + K   P PY++W+SE+MLQQTTV+TV+PYFKKF+
Sbjct: 3   EISSLLLSWYDKNYRHLPWRMSPQKQIKGIYPDPYQIWLSEVMLQQTTVETVKPYFKKFL 62

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
           + WP +F LS A  E+I+ AWAGLGYY+RARNLK CA  +VK + G FP  V+IL+ LPG
Sbjct: 63  KLWPNLFSLSQASQEDIMKAWAGLGYYSRARNLKNCATQLVKNHGGKFPQSVKILRTLPG 122

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPG 185
           IGDYTA+AI AIAF +   VVD N+ER+I+R F I    P     IK   ++IT   RPG
Sbjct: 123 IGDYTAAAIAAIAFGYPVAVVDGNVERVITRLFAITSVLPKAKSEIKEKTQEITDVQRPG 182

Query: 186 DFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIA 245
           DF QAMMDLGA ICT  KP C LCP+Q  C            +   KK+RP + GA F+A
Sbjct: 183 DFAQAMMDLGATICTPRKPSCLLCPLQSVCKAIKMQTVEAFPVKAPKKERPFKIGAAFVA 242

Query: 246 ITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTH 305
           +  + +I L KR NT+LL GM ++P +   + ++G     +APF+ANW L   ITH FTH
Sbjct: 243 LNENKQIYLEKRQNTKLLNGMTQIPNNIGINEENG---LQNAPFSANWELKGQITHIFTH 299

Query: 306 FTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
           F+L L V+     + + + +  W D  +L   ALPTVMKKA+ A  I  P
Sbjct: 300 FSLKLNVYCADNIRGIKLENGWWCDIHHLTQEALPTVMKKAI-AIAISSP 348


>gi|154251157|ref|YP_001411981.1| A/G-specific adenine glycosylase [Parvibaculum lavamentivorans
           DS-1]
 gi|154155107|gb|ABS62324.1| A/G-specific adenine glycosylase [Parvibaculum lavamentivorans
           DS-1]
          Length = 615

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 159/373 (42%), Positives = 201/373 (53%), Gaps = 30/373 (8%)

Query: 3   QPEHIIQSK-----ILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTV 57
           +    I  K     +L WYD + RVLPWR      K     PY VW+SEIMLQQTTV TV
Sbjct: 237 KKAKEISGKAAAAPLLAWYDKHARVLPWR----ARKGERADPYAVWLSEIMLQQTTVATV 292

Query: 58  EPYFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKV 117
            PYF  F+++WP +  L++A  EE++ AWAGLGYY+RARNL  CA  +  +Y G FP  V
Sbjct: 293 GPYFTGFLKRWPNVEALAAAPQEEVMKAWAGLGYYSRARNLHACAKEVSSEYGGKFPDTV 352

Query: 118 EILKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARK 177
           E L+ LPGIG YTA+AI AIAF   A VVD N+ER+++R F+I  P P     I+  AR 
Sbjct: 353 EGLESLPGIGPYTAAAIAAIAFGRAATVVDGNVERVVARLFEIETPLPAAKPDIREKART 412

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T   R GDF QAMMDLGA ICT   P C  CPI   C   + G  +LL     KK RP 
Sbjct: 413 LTPEQRAGDFAQAMMDLGATICTPRSPACNRCPINDLCDARAAGTQNLLPARAPKKARPT 472

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHS----------- 286
           R GA F  +  +  + LR+R +  LL GM E+PG+ W  +                    
Sbjct: 473 RRGACF-WLVREGHVWLRRRPDKGLLGGMLEVPGTPWDESDRHRTVIELSHDENGGRRGV 531

Query: 287 -------APFTANWILC-NTITHTFTHFTLTLFVWKTIV-PQIVIIPDSTWHDAQNLANA 337
                  AP  A W L    + HTFTHF L L V+      +IV   +  W   + +A  
Sbjct: 532 AGEVLDHAPMEAEWRLVPGLVEHTFTHFHLELEVFTATTRKKIVPGREGMWVPLEEVAGE 591

Query: 338 ALPTVMKKALSAG 350
           ALPTVM+K  +  
Sbjct: 592 ALPTVMRKVAAHA 604


>gi|304393523|ref|ZP_07375451.1| A/G-specific adenine glycosylase [Ahrensia sp. R2A130]
 gi|303294530|gb|EFL88902.1| A/G-specific adenine glycosylase [Ahrensia sp. R2A130]
          Length = 365

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 150/342 (43%), Positives = 209/342 (61%), Gaps = 9/342 (2%)

Query: 7   IIQSKILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTVEPYFKKFM 65
              +++LDWYD + R LPWR  P+  K+ +   PY+VW+SE+MLQQTTV  V+ YF+ F 
Sbjct: 18  SFSTRLLDWYDRHARTLPWRIPPEQSKAGVRPDPYRVWLSEVMLQQTTVAAVKAYFETFT 77

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
             WPT+  L++A++++++S WAGLGYY RARNLK CA+I+ + Y G FP   + L+KLPG
Sbjct: 78  TIWPTVNDLAAAENDDVMSRWAGLGYYARARNLKACAEIVTRDYNGRFPETEDELRKLPG 137

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPG 185
           IGDYTA++I AIAF   A VVD NIER+++R+  I  P P     ++    ++T T RPG
Sbjct: 138 IGDYTAASIAAIAFGECAAVVDGNIERVLTRHRTISTPLPKAKGEVRAVMAEVTPTDRPG 197

Query: 186 DFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIA 245
           DF QAMMDLGA ICTS  P+C LCP+ ++C   + G      +   KK++P R GA F+A
Sbjct: 198 DFAQAMMDLGATICTSKNPVCGLCPVAQDCAARNLGTMLNYPVKKPKKQKPTRRGAAFVA 257

Query: 246 ITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTH 305
              D    +R+     +L GM   P + WSS  DG     +APF A+W    +ITHTFTH
Sbjct: 258 WQGDEFFTIRR-PEDGMLGGMQAPPSTDWSSKVDGATGIAAAPFVADWKQGESITHTFTH 316

Query: 306 FTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKAL 347
           F + L VW   V   +      W     + +  LPT+ +K +
Sbjct: 317 FHIELEVWSAQVDAPI---QGKWMS--EIND--LPTLFRKVI 351


>gi|269101807|ref|ZP_06154504.1| A/G-specific adenine glycosylase [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268161705|gb|EEZ40201.1| A/G-specific adenine glycosylase [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 356

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 111/363 (30%), Positives = 176/363 (48%), Gaps = 21/363 (5%)

Query: 6   HIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
           H   + IL WYD   R  LPW+ +         +PYKVW+SEIMLQQT V TV PYF++F
Sbjct: 3   HNFSTAILTWYDKFGRKTLPWQQN--------KTPYKVWLSEIMLQQTQVATVIPYFERF 54

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M ++PT+  L+ A  +E+L  W GLGYY RARNL K A +IV++Y G FP  ++ ++ LP
Sbjct: 55  MAQFPTVQDLAQAPQDEVLHLWTGLGYYARARNLHKAAQVIVEQYNGIFPTDIDQVQALP 114

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTS 182
           GIG  TA A+++++      ++D N++R +SR + I            +   A + T + 
Sbjct: 115 GIGRSTAGAVLSLSLKQHHPILDGNVKRTLSRCYGIEGWPGQKAVENKLWQIAEQNTPSD 174

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
               + QAMMD+GA+ICT +KP C LCP+   C+  ++G+         K  +P +    
Sbjct: 175 GVERYNQAMMDMGAMICTRSKPKCELCPVADMCVAKAQGRQTDFPGKKPKTTKPEKQA-W 233

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAW-------SSTKDGNIDTHSAPFTANWIL 295
           F  I   + + L +R  + +  G+   P            S     +    A        
Sbjct: 234 FAIIQCGDEVWLEQRPQSGIWGGLWCFPQQDHEDLTPLIESRLGMTLAQLDADGMVKKEQ 293

Query: 296 CNTITHTFTHFTLTLFVWKTIVPQIVII--PDSTWHDAQNLANAALPTVMKKALSAGGIK 353
                HTF+H+ L +      +     +   +  W+   + A   L   ++K L +    
Sbjct: 294 LTAFRHTFSHYHLDIIPVLFTIQHQPNLIRENGQWYSLTHPAKVGLAAPVQKILDSLSYD 353

Query: 354 VPQ 356
           +P+
Sbjct: 354 LPR 356


>gi|144900302|emb|CAM77166.1| A/G-specific adenine glycosylase MutY [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 354

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 140/349 (40%), Positives = 189/349 (54%), Gaps = 8/349 (2%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
              +   +L WYD   R LPWR          P PY VW+SE+MLQQTTV  V PYF +F
Sbjct: 6   PSALARSLLAWYDRAGRALPWRKKGNER----PDPYHVWLSEVMLQQTTVAAVTPYFLRF 61

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           +++WPTI  L++A  ++++ AWAGLGYY RARNL  CA ++ +   G FP   E L+KLP
Sbjct: 62  IERWPTIAQLAAAPTDDVMHAWAGLGYYARARNLHACAKMVAQWRGGQFPDDEEALRKLP 121

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRP 184
           G+GDYTA+AI AIAF   AVVVD N+ER+++R F + +  P     +K  A  +T   RP
Sbjct: 122 GVGDYTAAAITAIAFGKRAVVVDGNVERVMARLFAVTEHLPAAKGRLKALAAHLTPDMRP 181

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
           GD+ QA+MDLGA IC+   P C +CP    C    +G    L     K +RP R G  + 
Sbjct: 182 GDYAQAVMDLGATICSPRNPACGICPWMNECQGRRQGIEAQLPAKLAKPERPTRHGIAYW 241

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSA--PFTANWILC-NTITH 301
               D  +L+R+R    LL GM E+P + W      ++   +A  P  A W      + H
Sbjct: 242 TARKDGAVLIRRRPPQGLLGGMMEIPSTPWRDDTPWDMAELAAHQPVAAQWRPLPGLVRH 301

Query: 302 TFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           TFTHF L L +           P   W     L++ ALP+VM K +   
Sbjct: 302 TFTHFHLELRL-VAGKASANATPLGLWVALDKLSDHALPSVMVKVVKHA 349


>gi|158422080|ref|YP_001523372.1| A/G-specific adenine glycosylase [Azorhizobium caulinodans ORS 571]
 gi|158328969|dbj|BAF86454.1| A/G-specific adenine glycosylase [Azorhizobium caulinodans ORS 571]
          Length = 373

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 154/345 (44%), Positives = 195/345 (56%), Gaps = 8/345 (2%)

Query: 10  SKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWP 69
           S +L WYD + R LPWR     E      PY V++SEIMLQQTTVK V PYF  F+++WP
Sbjct: 32  SALLAWYDRHRRRLPWR----AEAGRTADPYHVFLSEIMLQQTTVKAVGPYFTDFLRRWP 87

Query: 70  TIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDY 129
           T+  L+ A  EE+LSAWAGLGYY RARNL  CA  +V ++ G+FP     L  LPGIG Y
Sbjct: 88  TVRHLAEAPLEEVLSAWAGLGYYARARNLHACAKAVVARHGGHFPADEAALLDLPGIGPY 147

Query: 130 TASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQ 189
           TA+AI AIAF+  A  VD NIER++SR + + +P P     IK  A  +T   RPGDF Q
Sbjct: 148 TAAAISAIAFDLKASPVDGNIERVVSRLYAVDEPLPKSKPRIKALAAALTPERRPGDFAQ 207

Query: 190 AMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITND 249
           AMMDLGA ICT   P CPLCP  + C   +EG      +   K ++P R G  F+ +  D
Sbjct: 208 AMMDLGATICTPRSPACPLCPWMEPCTARAEGDPARYPVKAPKGEKPKREGIAFLIVRAD 267

Query: 250 NRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILC-NTITHTFTHFTL 308
             +LLR R +  LL  M E+P + W +  +       AP  A W      + H FTHF L
Sbjct: 268 GAVLLRTRPDKGLLAKMTEVPSTPWGARPET--PATHAPLAARWRPLPGAVEHVFTHFAL 325

Query: 309 TLFVWKTIVP-QIVIIPDSTWHDAQNLANAALPTVMKKALSAGGI 352
           TL V +  VP +        W         ALP+VM+K L+ G I
Sbjct: 326 TLSVLRADVPARTPAPDGHRWVHPSGFDREALPSVMRKVLAHGRI 370


>gi|307941618|ref|ZP_07656973.1| A/G-specific adenine DNA glycosylase [Roseibium sp. TrichSKD4]
 gi|307775226|gb|EFO34432.1| A/G-specific adenine DNA glycosylase [Roseibium sp. TrichSKD4]
          Length = 370

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 151/346 (43%), Positives = 205/346 (59%), Gaps = 4/346 (1%)

Query: 9   QSKILDWYDTNHRVLPWRTSPKTEK-SSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQK 67
              +L WYD + R LPWR SP       +P PY+VW+SE+MLQQTTV  V+ YF KF++ 
Sbjct: 21  THSLLTWYDHHARDLPWRVSPSDRAVGVIPDPYQVWLSEVMLQQTTVAAVKEYFLKFVRL 80

Query: 68  WPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIG 127
           WPT+  L++A +E+++ AWAGLGYY+RARNLKKCA+++  ++EG FP     L KLPGIG
Sbjct: 81  WPTVSDLAAATEEDVMKAWAGLGYYSRARNLKKCAEVVASEHEGQFPSTEAELLKLPGIG 140

Query: 128 DYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDF 187
            YTA+AI AIAF+  A VVD N+ER++SRYF+I +  P     IK    ++T + RPGDF
Sbjct: 141 PYTAAAIAAIAFDQRAAVVDGNVERVLSRYFEITEQLPAAKVPIKAEMARLTPSDRPGDF 200

Query: 188 VQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAIT 247
            QA+MD+GA ICT  +P C LCP   NC     G +  L     KK +P R G  ++   
Sbjct: 201 AQAVMDIGATICTPKRPACALCPWMNNCKARQSGTAETLPRKAPKKTKPTRYGFAYVLRH 260

Query: 248 N-DNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWIL-CNTITHTFTH 305
             +  +LL++R    LL GM E+PG+ WS ++    +  +AP    W      + HTFTH
Sbjct: 261 PKNGAVLLQRRPPKGLLGGMSEVPGTEWSESRLEKQNFENAPAVRPWRKTPGIVRHTFTH 320

Query: 306 FTLTLFVWKTIVPQIVIIPDSTWHDA-QNLANAALPTVMKKALSAG 350
           F L + V         +     W  A   +   ALPTVMKK +S  
Sbjct: 321 FHLDVEVLVAEATDDFVPGPGQWWSAQNEIDEEALPTVMKKIISNA 366


>gi|319405303|emb|CBI78917.1| A/G-specific adenine glycosylase MutY [Bartonella sp. AR 15-3]
          Length = 352

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 170/349 (48%), Positives = 224/349 (64%), Gaps = 5/349 (1%)

Query: 8   IQSKILDWYDTNHRVLPWRTSPKTE-KSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
           I S +L WYD N+R LPWR  P  + K   P PY++W+SE+MLQQTTV+TV+PYFKKF++
Sbjct: 4   ISSLLLSWYDQNYRHLPWRIPPTKQIKGIYPDPYRIWLSEVMLQQTTVETVKPYFKKFLK 63

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
            WP +F LS A  ++I+ AWAGLGYY+RARNLK CA  +VK + G FP  V+IL+ LPGI
Sbjct: 64  LWPDLFSLSQASQDDIMKAWAGLGYYSRARNLKNCAIQLVKNHRGKFPQSVKILRTLPGI 123

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGD 186
           GDYTA+AI AIAF+H   VVD N+ER+I+R F I    P     IK    +IT   RPGD
Sbjct: 124 GDYTAAAIAAIAFDHPVAVVDGNVERVITRLFAITSTLPKAKSEIKEKTFEITDVKRPGD 183

Query: 187 FVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAI 246
           F QAMMDLGA ICT  KP C LCP+Q  C       +    +   KK+RP++TGA F+ +
Sbjct: 184 FAQAMMDLGATICTPRKPSCLLCPLQNLCTAMKMQATEAFPVKVPKKERPLKTGAAFVIL 243

Query: 247 TNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHF 306
             + +I L KR +T+LL GM ++P +   + ++G     +AP +ANW     ITH FTHF
Sbjct: 244 NENKQIYLEKRQHTKLLNGMTQIPNNIGINEENG---LQNAPCSANWKFMGQITHIFTHF 300

Query: 307 TLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
           +L L V+     +   + +  W D  +L+  ALPTVMKKA+ A  I  P
Sbjct: 301 SLKLNVYCADNIRGTKLKNGWWCDIHHLSKEALPTVMKKAI-AIAISSP 348


>gi|268317475|ref|YP_003291194.1| A/G-specific adenine glycosylase [Rhodothermus marinus DSM 4252]
 gi|262335009|gb|ACY48806.1| A/G-specific adenine glycosylase [Rhodothermus marinus DSM 4252]
          Length = 383

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 103/351 (29%), Positives = 174/351 (49%), Gaps = 20/351 (5%)

Query: 12  ILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPTI 71
           ++DWY  + R LPWR +          PY++W++E+MLQQT V    PY+++F++ +PT+
Sbjct: 25  LIDWYRRHARDLPWRRT--------RDPYRIWVAEVMLQQTRVDQAGPYYERFLRAFPTV 76

Query: 72  FCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYTA 131
             L++A  +++L  W GLGYY RARNL + A  +V ++ G  P   E L++LPG+G YTA
Sbjct: 77  EALAAASLDDVLRCWEGLGYYARARNLHRAARQLVAEHGGRLPTTYEALRRLPGVGPYTA 136

Query: 132 SAIVAIAFNHFAVVVDTNIERIISRYFDI--IKPAPLYHKTIKNYARKITSTSRPGDFVQ 189
           +A+ +IAF     V+D N+ R+++R   +     A    + ++  A  + S   PG F Q
Sbjct: 137 AAVASIAFGEPRAVLDGNVIRVLTRVLAVADDARASATRRALQEVADALISDEEPGTFNQ 196

Query: 190 AMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITND 249
           A+M+LGA +CT  +P C  CP+++ C   + G      + T +   P    A+ +    +
Sbjct: 197 ALMELGATVCTPVQPRCNDCPLREVCRARAMGDPTAFPVQTPRASVPHYEVALGLLFNEE 256

Query: 250 NRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWIL------CNTITHTF 303
             +L+++R    LL G+ E PG      +               +         T+ H +
Sbjct: 257 GAVLIQRRPEDGLLGGLWEFPGGKREPGESLEAACARELHEELGVRVAVGPCLATVRHAY 316

Query: 304 THFTLTLFVWKTI----VPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           THF +TL+ +       VP+        W     L + A P   ++ +   
Sbjct: 317 THFRVTLYAFPCTLLEGVPRSRAGLPLRWVPLNELDHYAFPRANRRLIELL 367


>gi|154245120|ref|YP_001416078.1| A/G-specific adenine glycosylase [Xanthobacter autotrophicus Py2]
 gi|154159205|gb|ABS66421.1| A/G-specific adenine glycosylase [Xanthobacter autotrophicus Py2]
          Length = 355

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 156/349 (44%), Positives = 197/349 (56%), Gaps = 9/349 (2%)

Query: 10  SKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWP 69
           + +L WYD + R LPWR  P         PY V++SEIMLQQTTVK V PYF  F+ +WP
Sbjct: 11  AALLAWYDRHRRRLPWRAEPGRRA----DPYHVFLSEIMLQQTTVKAVGPYFGAFLARWP 66

Query: 70  TIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDY 129
           ++  L+ A  EE+LSAWAGLGYY RARNL  CA  +V ++ G FP     L  LPGIG Y
Sbjct: 67  SVSHLADAPLEEVLSAWAGLGYYARARNLHACARAVVDRHGGAFPDAEAALLDLPGIGPY 126

Query: 130 TASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQ 189
           TA+AI AIAF+  A  VD NIER+ISR + I +P P     IK  A  +T   RPGDF Q
Sbjct: 127 TAAAIAAIAFDRPASPVDGNIERVISRLYAIGEPLPGAKPAIKARAAALTPPDRPGDFAQ 186

Query: 190 AMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITND 249
           AMMDLGA ICT   P C LCP  + C   +EG +    +   K  +P R G  F+A+  D
Sbjct: 187 AMMDLGATICTPKSPACSLCPWMEPCAARAEGDAARYPVKAPKGDKPRREGTAFLAVRAD 246

Query: 250 NRILLRKRTNTRLLEGMDELPGSAWSS---TKDGNIDTHSAPFTANWILC-NTITHTFTH 305
             +LLR R +  LL  M E+P + W S    K        APF   W      + H FTH
Sbjct: 247 GAVLLRTRPDKGLLAKMTEVPSTPWDSRAGAKAPARAEDHAPFPTRWRAVPGVVEHVFTH 306

Query: 306 FTLTLFVWKTIVPQIVIIPDS-TWHDAQNLANAALPTVMKKALSAGGIK 353
           F LTL V +  +P     P+   W   +     ALP++M+K L+ GGI+
Sbjct: 307 FALTLKVLRADLPAATPAPEGHRWVRPEGFGREALPSLMRKVLAHGGIE 355


>gi|114570745|ref|YP_757425.1| A/G-specific DNA-adenine glycosylase [Maricaulis maris MCS10]
 gi|114341207|gb|ABI66487.1| A/G-specific DNA-adenine glycosylase [Maricaulis maris MCS10]
          Length = 350

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 136/351 (38%), Positives = 189/351 (53%), Gaps = 6/351 (1%)

Query: 1   MPQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLP--SPYKVWISEIMLQQTTVKTVE 58
           M      ++ ++L WYD   R LPWR  P+   +  P   PY +W+SEIMLQQTTV    
Sbjct: 1   MTIDIARLRRQLLAWYDQEGRTLPWRIRPEDRIAGGPVADPYAIWLSEIMLQQTTVPHAT 60

Query: 59  PYFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVE 118
           PY+ +F+  WPT+  L+ A  +++L  WAGLGYY RARNL  CA  +   ++G FP  ++
Sbjct: 61  PYWHRFLSLWPTVQDLAVAPRDDVLREWAGLGYYARARNLHACAIEVATDHDGQFPDTLD 120

Query: 119 ILKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKI 178
            L+ LPGIGDYTA+AI+A AF+  A VVD N+ER+I+R   +    P     ++  A  I
Sbjct: 121 GLRSLPGIGDYTANAILAAAFDKPASVVDGNVERVITRLHRVETAMPKAKPEVRKLAAAI 180

Query: 179 TSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
               R GD+ QA+MDLGA +CT  KP C  C     C   + G      +   +K +P+R
Sbjct: 181 ADPDRSGDYAQAIMDLGATVCTPRKPDCSACCWSFACAASAVGDMERYPVKAPRKVKPVR 240

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
            G  ++       I LRKR +  LL GM E+P S W    +    + + P  A W     
Sbjct: 241 RGTAWLVRRAGR-IWLRKRGDAGLLGGMTEVPSSPW---LETGHASEAPPLEAEWADRGE 296

Query: 299 ITHTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSA 349
           + H FTHF L L V +             W D ++L N ALP+VM+K L+A
Sbjct: 297 VRHVFTHFELRLAVREGEASPGWEPDSGYWADERDLGNEALPSVMRKVLAA 347


>gi|146276122|ref|YP_001166281.1| A/G-specific adenine glycosylase [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554363|gb|ABP68976.1| A/G-specific DNA-adenine glycosylase [Rhodobacter sphaeroides ATCC
           17025]
          Length = 369

 Score =  257 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 143/353 (40%), Positives = 205/353 (58%), Gaps = 8/353 (2%)

Query: 8   IQSKILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
           I +++L WYD + R +PWR  P   ++ +   PY+VW+SEIMLQQTTV  V  YF++F +
Sbjct: 15  ISARLLGWYDRHAREMPWRVGPADRRAGVRPDPYRVWLSEIMLQQTTVAAVRSYFRRFTE 74

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           +WP +  L++A+D E+++ WAGLGYY RARNL + A  +V  + G FP   + L  LPG+
Sbjct: 75  RWPDVGALAAAEDAEVMAEWAGLGYYARARNLLRGARAVVADHGGRFPETRDGLLTLPGV 134

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGD 186
           G YTA+A+ AIAF+  A VVD N+ER+++R F +  P P     +   A  IT   RPGD
Sbjct: 135 GPYTAAAVAAIAFDEPATVVDGNVERVVARLFRVETPLPAAKPALTRLAAAITPQERPGD 194

Query: 187 FVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAI 246
             QAMMDLGA ICT  KP+C LCP+  +C    +G    L     K  +P+R G ++IA+
Sbjct: 195 HAQAMMDLGATICTPRKPVCSLCPLGPDCAARRDGLEVELPRKAPKAAKPVREGTLWIAV 254

Query: 247 TNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN-TITHTFTH 305
             D  +LL  R  T +L GM   PG+ W    D +      P  A+W      + HTF+H
Sbjct: 255 RADGALLLETRPETGMLGGMLGWPGTDW----DRSGGPTDPPIAADWRATGVEVRHTFSH 310

Query: 306 FTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKA--LSAGGIKVPQ 356
           F L L V    V Q  +    ++   +    ++LPTVM+KA  ++A  I+ P+
Sbjct: 311 FHLRLSVLLAEVAQEAVPARGSFVPHERFRPSSLPTVMQKAWNVAAAAIRHPR 363


>gi|170747152|ref|YP_001753412.1| A/G-specific adenine glycosylase [Methylobacterium radiotolerans
           JCM 2831]
 gi|170653674|gb|ACB22729.1| A/G-specific adenine glycosylase [Methylobacterium radiotolerans
           JCM 2831]
          Length = 464

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 146/351 (41%), Positives = 190/351 (54%), Gaps = 8/351 (2%)

Query: 9   QSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKW 68
              +L WYD + RVLPWR        + P PY++W+SE+MLQQTT+  V PYF++F+ ++
Sbjct: 34  ADDLLAWYDRHRRVLPWR----ALAGAAPDPYRIWLSEVMLQQTTIAAVRPYFERFLTRF 89

Query: 69  PTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGD 128
           P IF L+ A +E ++SAWAGLGYY+RARNL  CA   V    G FP   E L+KLPGIG 
Sbjct: 90  PDIFALAEAPEEAVMSAWAGLGYYSRARNLHACA-RTVAAAGGRFPDTAEGLRKLPGIGA 148

Query: 129 YTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFV 188
           YTA AI AIAF+     VD N+ER++SR + +  P P     I+   + +  T RPGDF 
Sbjct: 149 YTAGAIAAIAFDRQEAAVDGNVERVLSRAYAVEAPLPGSRPEIRRLTQALVPTDRPGDFA 208

Query: 189 QAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITN 248
           QA+MDLGA ICT  +P C LCP  + C   S G            K  +R GA F+AI +
Sbjct: 209 QALMDLGATICTPKRPACALCPWMRPCRARSLGTQESFPRKIKVAKGALRRGAAFVAIRS 268

Query: 249 -DNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILC-NTITHTFTHF 306
            D  +LLR R    LL  M E PGSAW    D       AP  A W      + H FTHF
Sbjct: 269 GDEAVLLRTRPPEGLLGNMAEPPGSAWEPDYDVAAALLDAPLDARWKRLPGLVRHGFTHF 328

Query: 307 TLTLFVWKTIVP-QIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVPQ 356
            L L V+   V         + +     L +  LP +M+K L+      P+
Sbjct: 329 PLELTVFVARVALATPAPAGTRFTPRSALDDEPLPGLMRKVLAHAFDPKPE 379


>gi|298294361|ref|YP_003696300.1| A/G-specific adenine glycosylase [Starkeya novella DSM 506]
 gi|296930872|gb|ADH91681.1| A/G-specific adenine glycosylase [Starkeya novella DSM 506]
          Length = 359

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 141/343 (41%), Positives = 192/343 (55%), Gaps = 7/343 (2%)

Query: 10  SKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWP 69
             +L WYD + R LPWR      ++    PY+V++SEIMLQQTTV TV PY+  F+++WP
Sbjct: 22  EALLGWYDRHRRRLPWRAEAGKREA----PYRVFLSEIMLQQTTVVTVRPYYAAFLKRWP 77

Query: 70  TIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDY 129
            +  L++A  EE+LSAWAGLGYY RARNL  CA  +V ++ G FP     L  LPGIG Y
Sbjct: 78  DVEALAAAPLEEVLSAWAGLGYYARARNLHACAKAVVARHGGRFPADEAALLDLPGIGPY 137

Query: 130 TASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQ 189
           TA+AI +IAF+  A  VD N ER+++R F + +P P     ++  A  +      GDF Q
Sbjct: 138 TAAAIASIAFDRRAAPVDGNWERVVARLFAVDEPLPKARAKLRALALTLLPDEGYGDFAQ 197

Query: 190 AMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITND 249
           AMMDLGA ICT  KP C LCP + +C  ++ G   +  +   K  RP R G  F+A+  D
Sbjct: 198 AMMDLGATICTPRKPACALCPWRPDCAGYATGAPEVYPLKAAKAARPTRRGVAFLAVRAD 257

Query: 250 NRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN-TITHTFTHFTL 308
             +L+R R  + LL GM E+P + W      +   H AP  A W   N  +TH F+HF L
Sbjct: 258 GAVLVRSRPASGLLGGMSEVPSTPWEVDGVASPAGH-APLNAQWCALNAPVTHVFSHFAL 316

Query: 309 TLFVWKTIVPQI-VIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            L VW+  +           W   +     A P+VM+K L+  
Sbjct: 317 ELDVWRADLSAATRAPAGHRWVRPEGFDAEAFPSVMRKVLAKL 359


>gi|319786794|ref|YP_004146269.1| A/G-specific adenine glycosylase [Pseudoxanthomonas suwonensis
           11-1]
 gi|317465306|gb|ADV27038.1| A/G-specific adenine glycosylase [Pseudoxanthomonas suwonensis
           11-1]
          Length = 353

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 108/356 (30%), Positives = 163/356 (45%), Gaps = 18/356 (5%)

Query: 5   EHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKK 63
                + +LDW+D + R  LPW+           +PY+VW+SEIMLQQT V TV PYF +
Sbjct: 6   ADRFVAPLLDWFDRHGRHDLPWQHP--------RTPYRVWLSEIMLQQTQVATVIPYFLR 57

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           F++ +PT+  L++A  +++++ WAGLGYY RARNL   A   V+++ G+ P  ++ L  L
Sbjct: 58  FVESFPTLPDLAAASTDQVMAHWAGLGYYARARNLHAAARRCVEQHGGDLPRDLDALLAL 117

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA-----PLYHKTIKNYARKI 178
           PGIG  TA AI++ A+     ++D N++R+ +R+  I               + N   + 
Sbjct: 118 PGIGRSTAGAILSQAWGDPFPILDGNVKRVFARWHGIHGWPGTPAVEKQMWGLANQHVRH 177

Query: 179 TSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
               R  D+ QA MD GA  CT   P C  CP+   C+   EG    L      K  P R
Sbjct: 178 VPAGRLADYTQAQMDFGATQCTRAAPACLTCPLADGCVALREGLVDALPTPRPGKTLPER 237

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
                +      R+LL++R  T +   +  LP     S      +              T
Sbjct: 238 EAIALLLEDAGGRLLLQRRPPTGIWASLWTLPQDETESGLRTWFEREVDGDLDAAEALPT 297

Query: 299 ITHTFTHFTLTLFVWKTIVPQIVI----IPDSTWHDAQNLANAALPTVMKKALSAG 350
           I HTF+H+ L L   +                 W     LA+  LP  ++K L + 
Sbjct: 298 IVHTFSHYRLHLQPLRLRKVAPRARVGDNEAQRWVSRAELASLGLPAPIRKLLDSL 353


>gi|77917937|ref|YP_355752.1| A/G-specific adenine glycosylase [Pelobacter carbinolicus DSM 2380]
 gi|77544020|gb|ABA87582.1| A/G-specific DNA-adenine glycosylase [Pelobacter carbinolicus DSM
           2380]
          Length = 352

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 121/355 (34%), Positives = 179/355 (50%), Gaps = 17/355 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
           +P P   +   +LDWY    R LPWR +          PY++W+SEIMLQQT V  V PY
Sbjct: 4   LPWPADTMNRCLLDWYGRCGRDLPWRRT--------RDPYRIWLSEIMLQQTGVTAVIPY 55

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           +++F+  +P++  L++A  E++L  WAGLGYY RAR L + A  +V ++ G FP   E +
Sbjct: 56  YERFLAAFPSVAALAAAPLEQVLELWAGLGYYRRARFLHEAACKVVSEHGGQFPETPEAI 115

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDI--IKPAPLYHKTIKNYARKI 178
           + LPGIG  TA AIV+IAF+  A ++D N+ R++ R   I     +    K +   A  +
Sbjct: 116 QALPGIGRSTAGAIVSIAFDRKAPILDGNVRRVLCRLLAISGDPRSSKVEKRLWQCADAL 175

Query: 179 TSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
           T   RP D+ QA+MDLGA +C   +P C  CP+   C  F +G    L     +K  P+ 
Sbjct: 176 TPEDRPHDYAQAIMDLGATVCKPRRPDCQACPLSGLCQAFWQGIQEQLPQRATRKTVPLV 235

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAP----FTANWI 294
              V + I  + R L+R+R    +L G+ E P  A    K       +       +A   
Sbjct: 236 Q-QVAVLIEREGRYLVRRRPLDGMLGGLWEFPSVAVPEGKTAETAARTLLAGEGLSAGLS 294

Query: 295 LCNTITHTFTHFTLTLFVWKTIVPQI--VIIPDSTWHDAQNLANAALPTVMKKAL 347
              T+ H ++HF + L V+     +   V   +  W   Q LA+  L    KKAL
Sbjct: 295 PVGTVRHAYSHFRVELHVFACRENRAGMVADEEHRWLSPQELADWPLHGSHKKAL 349


>gi|254497110|ref|ZP_05109930.1| A/G specific adenine glycosylase [Legionella drancourtii LLAP12]
 gi|254353648|gb|EET12363.1| A/G specific adenine glycosylase [Legionella drancourtii LLAP12]
          Length = 348

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 125/356 (35%), Positives = 181/356 (50%), Gaps = 14/356 (3%)

Query: 1   MPQPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M          +L+W+  + R  LPW+           SPY+VW+SEIMLQQT V+TV P
Sbjct: 1   MNNLFEQFSKPLLNWFSLHGRKNLPWQ--------LPRSPYRVWVSEIMLQQTQVQTVIP 52

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF++FMQ++P+I  L+ A ++E+LS W+GLGYY+RARNL K A II  +Y+G FP ++ +
Sbjct: 53  YFERFMQRFPSIQDLAQANEDEVLSLWSGLGYYSRARNLHKTAQIIATEYQGIFPDELAL 112

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPL--YHKTIKNYARK 177
           + +LPGIG  TA+AI++ AFN    ++D N++R+++R+F I          K +   A+ 
Sbjct: 113 VHELPGIGASTAAAILSQAFNQPTAILDGNVKRVLTRFFMIQGHPEQALVKKKLWELAQA 172

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
                   D+ QA+MDLGA  CT+    C  CP+Q NCL     + HL     IKK  P+
Sbjct: 173 CMPQEDCADYTQAIMDLGATCCTTKNFNCLNCPLQDNCLALKHQEQHLYPTKKIKKPVPV 232

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
           +   + +       I L KR  T L  G+  LP     +     I T       N     
Sbjct: 233 QQQQLLVLCNKQGHIYLEKRPPTGLWGGLWCLPSIDEGNCPLDFIRTEYDLVGENPQPLI 292

Query: 298 TITHTFTHFTLTLFVWKTI---VPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
              H F+HF L +   K I   +   +      W   +NL +  L T   K LS  
Sbjct: 293 AFKHRFSHFLLEINALKIITLALGTKLGEAKGQWFAKENLGSLGLATPTSKILSLL 348


>gi|190573786|ref|YP_001971631.1| putative A/G-specific adenine glycosylase [Stenotrophomonas
           maltophilia K279a]
 gi|190011708|emb|CAQ45327.1| putative A/G-specific adenine glycosylase [Stenotrophomonas
           maltophilia K279a]
          Length = 374

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 120/362 (33%), Positives = 177/362 (48%), Gaps = 15/362 (4%)

Query: 2   PQPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
                   + +L W+D + R  LPW+           SPY+VW+SEIMLQQT V TV PY
Sbjct: 11  TTQTDDFVAHLLHWFDDHGRHDLPWQHP--------RSPYRVWLSEIMLQQTQVSTVIPY 62

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           F++F+Q +PT+  L++A ++ +++ WAGLGYY RARNL   A   V+ ++G+ P   + L
Sbjct: 63  FQRFLQHFPTLPDLAAAGNDAVMAQWAGLGYYARARNLHAAAKRCVELHDGDLPRDFDAL 122

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA-----PLYHKTIKNYA 175
             LPGIG  TA AI++ A+N    ++D N++R++SRY  I               I    
Sbjct: 123 HALPGIGRSTAGAILSQAWNDPFAILDGNVKRVLSRYHGIDGFPGLPAIEKLLWAIAEAH 182

Query: 176 RKITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKR 235
                T R  D+ QA MDLGA +C+  +P C +CP+Q  C+   EG++  L      K  
Sbjct: 183 VAQVPTGRMADYTQAQMDLGATVCSRARPACVICPLQDACVARREGRTAELPTPKPSKTL 242

Query: 236 PMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWIL 295
           P R     +      R+LL+KR +T +   +  LP +   S      D H      +   
Sbjct: 243 PEREAVALLLRDPQQRVLLQKRPDTGIWAQLWTLPQAEAGSDLQDWFDAHVEGSLEDAEE 302

Query: 296 CNTITHTFTHFTLTLFVWKTIVPQIV-IIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
              + HTF+H+ L L V    V  +    P   W     L    LP  ++K L    IK 
Sbjct: 303 LPVLQHTFSHYRLHLQVLSRQVNGLRVEEPTLRWVAYDELRALGLPAPIRKLLDGATIKT 362

Query: 355 PQ 356
           P+
Sbjct: 363 PK 364


>gi|261342377|ref|ZP_05970235.1| A/G-specific adenine glycosylase [Enterobacter cancerogenus ATCC
           35316]
 gi|288315012|gb|EFC53950.1| A/G-specific adenine glycosylase [Enterobacter cancerogenus ATCC
           35316]
          Length = 352

 Score =  256 bits (654), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 107/358 (29%), Positives = 171/358 (47%), Gaps = 16/358 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M        +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV P
Sbjct: 1   MTMQASQFSAQVLDWYDKYGRKTLPWQI--------EKTPYKVWLSEVMLQQTQVATVIP 52

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +  ++ G FP   + 
Sbjct: 53  YFERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATRHNGTFPETFDE 112

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARK 177
           +  LPG+G  TA AI++++      ++D N++R+++R + +            + + +  
Sbjct: 113 VADLPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVDGWPGKKEVEKRLWDISEA 172

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T  +    F QAMMDLGA++CT +KP C LCP+   C+ ++            K+  P 
Sbjct: 173 VTPANGVERFNQAMMDLGAMVCTRSKPKCELCPVNNLCVAYANHAWAQYPGKKPKQTLPE 232

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
           RTG + +    D  + L +R  + L  G+   P           +  H            
Sbjct: 233 RTGYMLLMQHGDE-VFLAQRPPSGLWGGLYCFPQFENEDLLREWLKQH-GIADDTLTQQT 290

Query: 298 TITHTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGI 352
              HTF+HF L +      V  I    D     W++     +  L   +++ L    +
Sbjct: 291 AFRHTFSHFHLDIVPMWLPVSSIASCMDEGSGLWYNLAQPPSVGLAAPVERLLQQLRV 348


>gi|163733086|ref|ZP_02140530.1| A/G-specific adenine glycosylase, putative [Roseobacter litoralis
           Och 149]
 gi|161393621|gb|EDQ17946.1| A/G-specific adenine glycosylase, putative [Roseobacter litoralis
           Och 149]
          Length = 355

 Score =  256 bits (653), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 148/346 (42%), Positives = 197/346 (56%), Gaps = 3/346 (0%)

Query: 7   IIQSKILDWYDTNHRVLPWRTSPKTEK-SSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
           ++   IL WYD + R +PWR  P+  +   +P PY++W+SE+MLQQTTV TV+ YF+KF 
Sbjct: 10  VLSDAILAWYDVHARNMPWRVPPQNRRAGQMPDPYRIWLSEVMLQQTTVATVKSYFEKFT 69

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
            +WPT+  L++AKD ++++ WAGLGYY RARNL KCA  +V+ Y G FP     L KLPG
Sbjct: 70  TRWPTVRDLAAAKDADVMAEWAGLGYYARARNLLKCARTVVQDYGGAFPADHAELLKLPG 129

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPG 185
           IG YTA+AI +IAF+    V+D N+ER+++R  D+  P P     +   A  +T   RPG
Sbjct: 130 IGPYTAAAIASIAFDLRQTVLDGNVERVMARLHDVHVPLPASKPILMEKADALTPADRPG 189

Query: 186 DFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIA 245
           D+ QA+MDLGA ICT   P C +CP +  C   +EG +  L   T KK +P R G VF+A
Sbjct: 190 DYAQAVMDLGATICTPKSPACGICPWRDPCTARAEGTAAGLPKKTPKKAKPTRHGTVFLA 249

Query: 246 ITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILC-NTITHTFT 304
              D   LL  R +  LL GM   PGS W       +     P  A W L    + HTFT
Sbjct: 250 RRADGAWLLETRPDKGLLGGMLGWPGSDWI-DVGHPLPEAPPPCAAEWQLIDGEVRHTFT 308

Query: 305 HFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           HF L L V++  V          + DA       LPTVM+KA    
Sbjct: 309 HFHLILHVFRAQVAIGTKPETGEFRDAAEFKPTDLPTVMRKAFDLA 354


>gi|172038509|ref|YP_001805010.1| mutator protein MutT [Cyanothece sp. ATCC 51142]
 gi|171699963|gb|ACB52944.1| mutator protein MutT [Cyanothece sp. ATCC 51142]
          Length = 369

 Score =  255 bits (652), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 115/353 (32%), Positives = 175/353 (49%), Gaps = 18/353 (5%)

Query: 8   IQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQK 67
           ++  +L WY    R LPWR +          PY +W+SEIMLQQT VKTV PY+++++  
Sbjct: 22  LRQSLLTWYQQQGRQLPWRNT--------RDPYLIWVSEIMLQQTQVKTVLPYYQRWLDT 73

Query: 68  WPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIG 127
           +PT+  L+ A+ + +L AW GLGYY+RARNL K A I++ +Y G FP ++  +  LPGIG
Sbjct: 74  FPTLESLAKAELQGVLKAWEGLGYYSRARNLHKAAQIVLNEYNGVFPQQLSDVLTLPGIG 133

Query: 128 DYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDF 187
             TA  I++ AFN    ++D N++R++SR   +  P     K++   +  I     P DF
Sbjct: 134 RTTAGGILSAAFNQSVSILDGNVKRVLSRLMALPVPPKKGLKSLWQLSDLILDPENPRDF 193

Query: 188 VQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAIT 247
            QA+MDLGA IC   KP C LCP   +CL + +G+ + L +    K  P +   V +   
Sbjct: 194 NQALMDLGAEICVKTKPRCLLCPWTSHCLAYQQGQQNQLPMTETTKPLPHKKIGVAVIYN 253

Query: 248 NDNRILLRKRTNTRLLEGMDELPGSAWSSTK------DGNIDTHSAPFTANWILCNTITH 301
           +   IL+ +R N  LL G+ E PG      +         I                + H
Sbjct: 254 DAGLILIDRRPNKGLLGGLWEFPGGKIEPDETVEDCIKREIKEEIDIEIEVGENLVNLDH 313

Query: 302 TFTHFTLTLFVWKTI----VPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            +THF +TL+V         P+ +   +  W   + +     P    K +   
Sbjct: 314 AYTHFKVTLYVHICRYLTGEPKPIECEEIRWVSLEEIDQFPFPKANTKIIEML 366


>gi|115526426|ref|YP_783337.1| A/G-specific adenine glycosylase [Rhodopseudomonas palustris
           BisA53]
 gi|115520373|gb|ABJ08357.1| A/G-specific DNA-adenine glycosylase [Rhodopseudomonas palustris
           BisA53]
          Length = 366

 Score =  255 bits (652), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 143/354 (40%), Positives = 198/354 (55%), Gaps = 12/354 (3%)

Query: 2   PQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
           P P+    + +L WYD + RVLPWR  P         PY+VW+SEIMLQQTTVKTV PYF
Sbjct: 13  PAPDR--AALLLGWYDRHARVLPWRAGPGEAA----DPYRVWLSEIMLQQTTVKTVGPYF 66

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            KF+ +WP++  +++A  +E+L  WAGLGYY+RARNL  CA  + +++ G FP     L+
Sbjct: 67  AKFLARWPSVEAMAAASRDEVLQMWAGLGYYSRARNLHACAVAVAQEHGGAFPDSEAGLR 126

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITST 181
            LPGIG YTA+AI AIAF    + VD NIER+++R + I +  P     ++  A  +  +
Sbjct: 127 ALPGIGPYTAAAIAAIAFGRHCMPVDGNIERVVTRLYAIEEALPKAKPQVQALALTLAGS 186

Query: 182 SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGA 241
           +R GD  QA+MDLGA ICT  KP C  CP+  +C     G          KK   +R GA
Sbjct: 187 NRAGDSAQALMDLGATICTPKKPACARCPLNADCAALRRGDQESFPRKAPKKSGELRRGA 246

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPF---TANWILC-N 297
            F+ +   + IL+R R +  LL GM E+P S W + +D  +    AP     A W     
Sbjct: 247 AFV-VARGDDILVRTRADKGLLGGMTEVPTSDWLAAQDDRVARQQAPVLPGAARWQRKAG 305

Query: 298 TITHTFTHFTLTLFVWKTIV-PQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            ++H FTHF L L V+ T V P+        W     L + ALP +M+K ++  
Sbjct: 306 VVSHVFTHFPLELVVYTTRVAPRSRAPAGMRWVKIATLQHEALPNLMRKVIAHA 359


>gi|326793902|ref|YP_004311722.1| A/G-specific adenine glycosylase [Marinomonas mediterranea MMB-1]
 gi|326544666|gb|ADZ89886.1| A/G-specific adenine glycosylase [Marinomonas mediterranea MMB-1]
          Length = 358

 Score =  255 bits (652), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 114/353 (32%), Positives = 187/353 (52%), Gaps = 14/353 (3%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
           Q       ++L W+D + R  LPW+           +PY+VWISEIMLQQT V TV PY+
Sbjct: 5   QTVENFAPRVLAWFDVHGRKDLPWQKD--------KTPYRVWISEIMLQQTQVTTVIPYY 56

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           +KFM  +P ++ L+SAK +++L+ W+GLGYY RARN+ K A ++V +++G FP  VE + 
Sbjct: 57  EKFMSSFPDVYALASAKQDDVLAHWSGLGYYARARNMHKAATMLVDEFDGEFPKTVEGVC 116

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
           +LPGIG  TASAI++I+    + ++D N++R+++R+  I            +   A    
Sbjct: 117 ELPGIGRSTASAILSISRGVQSAILDGNVKRVLARFHAIPNWPGEKKTENRMWGVAESYM 176

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              R G++ QAMMDLGA +CT +KP C +CP+ ++C   + G+     I+  KK      
Sbjct: 177 PEIRCGEYTQAMMDLGATLCTRSKPKCHVCPLSEDCAGLASGEPTTFPISKPKKAAKPIK 236

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
            A F+ + +D ++LL KR  + +  G+  LP  A  ++     +        + +  ++ 
Sbjct: 237 TAQFVVLQSDGKVLLEKRPASGIWGGLWSLPEFAHDASIVLEAEQRFQCGIQSVMALSSF 296

Query: 300 THTFTHFTLTLFVWKTIVPQIV---IIPDSTWHDAQNLANAALPTVMKKALSA 349
            HTF+H+ L +      V + V         W    +     LP  ++  L +
Sbjct: 297 RHTFSHYHLDIIPSLVTVKEAVGVHETEKYQWFSVDDAFTLGLPAPVRSILES 349


>gi|193215896|ref|YP_001997095.1| A/G-specific adenine glycosylase [Chloroherpeton thalassium ATCC
           35110]
 gi|193089373|gb|ACF14648.1| A/G-specific adenine glycosylase [Chloroherpeton thalassium ATCC
           35110]
          Length = 360

 Score =  255 bits (651), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 115/359 (32%), Positives = 176/359 (49%), Gaps = 21/359 (5%)

Query: 7   IIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
            I+  +L W+  N R LPWR           +PYK+W+SEIMLQQT V TV PY+++F+ 
Sbjct: 2   SIEKDLLSWFLLNKRDLPWRKK--------RTPYKIWVSEIMLQQTQVATVIPYYERFLN 53

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
            +P +  L++A   +++  W GLGYYTR +N+++ A  I++K+ G FP K   L +L GI
Sbjct: 54  AFPNLESLANADINKLMKIWEGLGYYTRVKNMQEAAKTILQKHNGVFPSKKTELLQLKGI 113

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDI--IKPAPLYHKTIKNYARKITSTSRP 184
           GDYTA+ I +IAF      VD N+ R+ISR   I          +TI+  A+++ S   P
Sbjct: 114 GDYTAAIIASIAFKEHCAAVDGNVLRVISRLNAINAPIQLNTTKQTIRIVAQELLSLEHP 173

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
           G+F +AMM++GALIC    P C +CPI  +C  + +G  H L +   K+           
Sbjct: 174 GEFNEAMMEVGALICKPKNPTCDICPISLHCQAYKKGLEHKLPVKL-KRAEIPHYHIAAG 232

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTAN------WILCNT 298
            I  D+ +L+  R    LL  + E PG      +          F              +
Sbjct: 233 VIYKDDFVLIALRPANGLLGNLWEFPGGKQQQGESLEDCCKREIFEETGLHVNVLEKLIS 292

Query: 299 ITHTFTHFTLTLFVWKTI----VPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIK 353
           + H +THF +TL  ++       P+        W   ++L + A P   KK +    + 
Sbjct: 293 VKHAYTHFKITLHAYRCNYISGSPEPRASQALKWVRIEDLTSYAFPKANKKIIEKLQLA 351


>gi|319403862|emb|CBI77448.1| A/G-specific adenine glycosylase MutY [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 352

 Score =  255 bits (651), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 173/350 (49%), Positives = 225/350 (64%), Gaps = 5/350 (1%)

Query: 7   IIQSKILDWYDTNHRVLPWRTSPKTE-KSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
            I S +L WYD N+R LPWRT P  + K   P PY++W+SEIMLQQTTV+ V+PYFKKF+
Sbjct: 3   EISSLLLSWYDQNYRHLPWRTPPTKQIKGIYPDPYQIWLSEIMLQQTTVEAVKPYFKKFL 62

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
           + WP +F LS A  ++I+ AWAGLGYY+RARNLK CA  +VK + G FP  VEIL+ LPG
Sbjct: 63  KLWPDLFSLSQASQDDIMKAWAGLGYYSRARNLKNCATQLVKNHRGKFPQSVEILRTLPG 122

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPG 185
           IGDYTA+AI AIAF H   VVD+N+ERII+R F I    P     IK    +IT   RPG
Sbjct: 123 IGDYTAAAIAAIAFGHPVAVVDSNVERIITRLFAITSILPKAKSEIKEKTLEITDVKRPG 182

Query: 186 DFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIA 245
           DF QAMMDLG+ ICT  KP C LCP+Q  C       +    +   KK+RP++TGA F+ 
Sbjct: 183 DFAQAMMDLGSTICTPRKPSCLLCPLQNLCTAMKMQAAEAFPVKAPKKERPLKTGAAFVI 242

Query: 246 ITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTH 305
           +  + +I L KR +T+LL GM ++P +   + ++G     +AP +ANW L   ITH FTH
Sbjct: 243 LNENKQIYLEKRQHTKLLNGMTQIPNNIGINEENG---LQNAPCSANWKLKGEITHIFTH 299

Query: 306 FTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
           F+L L V+     + + + +  W D  +L   ALPTVMKKA+ A  I  P
Sbjct: 300 FSLKLNVYCADNIRGIKLKNGWWCDIHHLTEEALPTVMKKAI-AIAISSP 348


>gi|194365323|ref|YP_002027933.1| A/G-specific adenine glycosylase [Stenotrophomonas maltophilia
           R551-3]
 gi|194348127|gb|ACF51250.1| A/G-specific adenine glycosylase [Stenotrophomonas maltophilia
           R551-3]
          Length = 374

 Score =  255 bits (651), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 123/362 (33%), Positives = 177/362 (48%), Gaps = 15/362 (4%)

Query: 2   PQPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
              E    + +L W+D + R  LPW+           SPY+VW+SEIMLQQT V TV PY
Sbjct: 11  TAQEDGFVAHLLHWFDDHGRHDLPWQHP--------RSPYRVWLSEIMLQQTQVSTVIPY 62

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           F++F+Q +PT+  L++A ++ +++ WAGLGYY RARNL   A   V+ ++G  P   + L
Sbjct: 63  FQRFLQHFPTLPDLAAASNDAVMAQWAGLGYYARARNLHAAAKRCVELHDGELPRDFDAL 122

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA-----PLYHKTIKNYA 175
             LPGIG  TA AI++ A+N    ++D N++R++SRY  I               I    
Sbjct: 123 HALPGIGRSTAGAILSQAWNDPFAILDGNVKRVLSRYHGIEGFPGLPAIEKQLWAIAETH 182

Query: 176 RKITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKR 235
                  R  D+ QA MDLGA +C+  KP C +CP+Q +C+   EG+S  L      K  
Sbjct: 183 VAQVPAGRMADYTQAQMDLGATVCSRAKPACVICPLQDDCVARREGRSAELPTPKPSKTL 242

Query: 236 PMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWIL 295
           P R     +      R+LL+KR +T +   +  LP +   S      D H          
Sbjct: 243 PEREAVALLLRDAQQRVLLQKRPDTGIWAQLWTLPQAEAGSVLQDWFDLHVDGSLEEAEE 302

Query: 296 CNTITHTFTHFTLTLFVWKTIVPQIV-IIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
              + HTF+H+ L L V    V  +    P   W  A  L    LP  ++K L    IK 
Sbjct: 303 LPVLQHTFSHYKLHLQVLSRQVHGLRVEEPTLRWVAADELPALGLPAPIRKLLDGATIKT 362

Query: 355 PQ 356
           P+
Sbjct: 363 PK 364


>gi|163794970|ref|ZP_02188939.1| A/G-specific DNA glycosylase [alpha proteobacterium BAL199]
 gi|159179789|gb|EDP64316.1| A/G-specific DNA glycosylase [alpha proteobacterium BAL199]
          Length = 360

 Score =  255 bits (651), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 144/339 (42%), Positives = 193/339 (56%), Gaps = 7/339 (2%)

Query: 12  ILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPTI 71
           +L WYD + R +PWR  P         PY+VW+SEIMLQQTTV TV PYF  F+ +WPT+
Sbjct: 18  LLAWYDRHRRRMPWRAKP----GQPVDPYRVWLSEIMLQQTTVATVGPYFNGFVARWPTV 73

Query: 72  FCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYTA 131
             L+ A  +E+LSAWAGLGYY RARNL  CA  +V +++G FP    +L  LPG+G YTA
Sbjct: 74  GDLAFAPLDEVLSAWAGLGYYARARNLHACARAVVDRHDGVFPDTEAVLLTLPGVGAYTA 133

Query: 132 SAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQAM 191
           +AI AIAF+  A VVD N+ER+++R F I +P P     ++  A  +T   RPGD+ QA+
Sbjct: 134 AAIAAIAFDRKATVVDGNVERVMARMFAIEEPMPAAKPRLRERAATLTPEHRPGDYAQAV 193

Query: 192 MDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDNR 251
           MDLGA +CT   P C  CP   +C     G +  L   T K  +P R G  F+ ++    
Sbjct: 194 MDLGATVCTPRSPTCLSCPWSTSCRGRIAGIAETLPRKTPKADKPTRRGTAFVVLSGPGN 253

Query: 252 ILLRKRTNTRLLEGMDELPGSAWSSTK--DGNIDTHSAPFTANWILC-NTITHTFTHFTL 308
           +LLR+R    +L GM E+P + W      + + D H+    A WI     + HTF+HF L
Sbjct: 254 LLLRQRPAKGMLGGMHEVPATPWDRKSGWEVDADDHAPVDDAAWIAIPGIVRHTFSHFHL 313

Query: 309 TLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKAL 347
            L V    +     I    W     L +AALPTVM K +
Sbjct: 314 ELEVAAVRLRHEPAIDGGQWWPINALDSAALPTVMAKVV 352


>gi|254562353|ref|YP_003069448.1| A/G-specific adenine glycosylase [Methylobacterium extorquens DM4]
 gi|254269631|emb|CAX25602.1| A/G-specific adenine glycosylase [Methylobacterium extorquens DM4]
          Length = 404

 Score =  255 bits (650), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 143/345 (41%), Positives = 185/345 (53%), Gaps = 9/345 (2%)

Query: 9   QSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKW 68
            + +L WYD + R LPWR  P       P PY+VW+SE+MLQQTTV  V+PYF+KF+  +
Sbjct: 6   AADLLTWYDRHRRALPWRALP----GETPDPYRVWLSEVMLQQTTVTAVKPYFEKFLTLF 61

Query: 69  PTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGD 128
           P +  L++A +E ++SAWAGLGYY+RARNL  CA  +       FP   + L+KLPGIG 
Sbjct: 62  PNVATLAAAPEEAVMSAWAGLGYYSRARNLHACAKSVASAGG--FPDTEDGLRKLPGIGA 119

Query: 129 YTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFV 188
           YTA AI AIAF+  A  VD N+ER++SR   I  P P     I+ + + +    RPGDF 
Sbjct: 120 YTAGAIAAIAFDRPAAAVDGNVERVMSRLHAIETPLPAARAQIRLFTQALVPDRRPGDFA 179

Query: 189 QAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAIT- 247
           QA+MDLGA +CT  +P C LCP    C   +EG          K+K  +R GA F+A+  
Sbjct: 180 QALMDLGATLCTPKRPACALCPWMLPCRARAEGLQETFPRKVKKEKGILRKGAAFVALRA 239

Query: 248 NDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILC-NTITHTFTHF 306
            D  +LLR R    LL  M E P S W    D       AP  A W      + H FTHF
Sbjct: 240 GDEAVLLRTRPPEGLLGAMAEPPTSEWLPDYDPAKGLLDAPLDARWKRLPGVVKHGFTHF 299

Query: 307 TLTLFVWKTIVPQIVIIPDS-TWHDAQNLANAALPTVMKKALSAG 350
            L L V+   V      P+   +     L    LP  MKK L+  
Sbjct: 300 PLELTVFLARVAADTKPPEGMRFTPRDALETEPLPGAMKKVLAHA 344


>gi|27377610|ref|NP_769139.1| A/G-specific adenine glycosylase [Bradyrhizobium japonicum USDA
           110]
 gi|27350755|dbj|BAC47764.1| A/G-specific adenine glycosylase [Bradyrhizobium japonicum USDA
           110]
          Length = 431

 Score =  255 bits (650), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 141/350 (40%), Positives = 196/350 (56%), Gaps = 11/350 (3%)

Query: 11  KILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPT 70
            +L WYD + R LPWR            PY+VW+SEIMLQQTTVK V PYF+KF+ +WP 
Sbjct: 83  ALLAWYDRHRRHLPWR----AASGEASDPYRVWLSEIMLQQTTVKAVGPYFEKFVARWPD 138

Query: 71  IFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYT 130
           +  L  A  +++L  WAGLGYY+RARNL  CA  + +++ G FP   E L+ LPGIG YT
Sbjct: 139 VTALGQASQDDVLRMWAGLGYYSRARNLHACAVAVTREHGGVFPDTEERLRALPGIGPYT 198

Query: 131 ASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQA 190
           A+AI AIAF+   + VD NIER++SR F + +  P     I+  A  + + +R GD  QA
Sbjct: 199 AAAIAAIAFDRRTMPVDGNIERVVSRLFAVEEELPQSKPLIQQLAATLLADARAGDSAQA 258

Query: 191 MMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDN 250
           +MDLG+ ICT  KP C LCP+  +C+  ++G        T KK   +R GA F+ +T  +
Sbjct: 259 LMDLGSSICTPKKPACSLCPLNDDCIARAQGTQESFPRKTPKKSGTLRRGAAFV-VTRGD 317

Query: 251 RILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAP----FTANWILCNTITHTFTHF 306
            +L+R R    LL GM E+PGS W + ++       AP     +        +TH FTHF
Sbjct: 318 ELLVRSRPEKGLLGGMTEVPGSDWLAGQEDATAKQQAPALKGLSRWQRRVGVVTHVFTHF 377

Query: 307 TLTLFVWKTI-VPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            L L V+      +        W     L   ALP VM+K ++  G+++P
Sbjct: 378 PLELVVYTAKAEARTRAPAGMRWVPIATLPGEALPNVMRKVIAH-GLRLP 426


>gi|260427440|ref|ZP_05781419.1| A/G-specific adenine glycosylase [Citreicella sp. SE45]
 gi|260421932|gb|EEX15183.1| A/G-specific adenine glycosylase [Citreicella sp. SE45]
          Length = 348

 Score =  255 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 141/344 (40%), Positives = 198/344 (57%), Gaps = 7/344 (2%)

Query: 9   QSKILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTVEPYFKKFMQK 67
              +L+WYD + R LPWR  P+   + +   PY+VW+SEIMLQQTTV  V+PYF+ F  +
Sbjct: 7   AEDLLEWYDRHARDLPWRIGPRARAAGVRPDPYRVWLSEIMLQQTTVPAVKPYFEAFTAR 66

Query: 68  WPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIG 127
           WPT+  L++A+D ++++AWAGLGYY RARNL KCA ++  ++ G FP   E L +LPG+G
Sbjct: 67  WPTVSDLAAAEDADVMAAWAGLGYYARARNLLKCARVVASEHGGVFPDSQEALLQLPGVG 126

Query: 128 DYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDF 187
            YTA A+ AIA++  A VVD N+ER+++R  D   P P     +  YA  +T   RPG +
Sbjct: 127 PYTAGAVAAIAYDLPATVVDGNVERVMARLHDEHTPLPDAKPVLTGYAAALTPDERPGCY 186

Query: 188 VQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAIT 247
            QA+MDLGA ICT   P C LCP + +C  +  G +  L     KK++P+R G  ++A  
Sbjct: 187 AQAVMDLGATICTPRNPACGLCPWRPSCAAWDAGTAAELPKKVPKKRKPVRLGIAYLARR 246

Query: 248 NDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN-TITHTFTHF 306
            D   LL +R +  LL GM   PGS W+   +      + P  A W        HTFTHF
Sbjct: 247 VDGAWLLERRPDKGLLGGMLGWPGSEWNEAPE-----EAPPIRAEWKTLPEEARHTFTHF 301

Query: 307 TLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            L L V   +VP   +     + +    + + LPTVM+KA    
Sbjct: 302 HLRLTVKTALVPMERVPSRGEFVELPAFSPSDLPTVMRKAFDLA 345


>gi|218782294|ref|YP_002433612.1| A/G-specific adenine glycosylase [Desulfatibacillum alkenivorans
           AK-01]
 gi|218763678|gb|ACL06144.1| A/G-specific adenine glycosylase [Desulfatibacillum alkenivorans
           AK-01]
          Length = 369

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 113/363 (31%), Positives = 174/363 (47%), Gaps = 23/363 (6%)

Query: 2   PQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
            +P       +L WY+ N R LPWR +          PY +W+SEIMLQQT VKTV PYF
Sbjct: 9   ERPSKDFSRSLLRWYEENARDLPWRRT--------SDPYAIWVSEIMLQQTQVKTVIPYF 60

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            ++M  +P I  L+ A  +++L  W GLGYY+RARN+ K A  I+ + +G  P   + L 
Sbjct: 61  LRWMDAFPNISSLAEAPLDDVLKMWEGLGYYSRARNMHKAAKEIMDRLDGRMPRTYKGLL 120

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKIT 179
           +LPGIG YTA A+ +IA+N    +VD N++R+ +R  D+ KP       + I+  A  + 
Sbjct: 121 ELPGIGAYTAGAVCSIAYNQDVPLVDANVKRVFARILDMEKPVEQTAATREIRGLAESLI 180

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
            + + G F QA+M+LGAL+CT   P C  CP+  +CL   E       +   KKK     
Sbjct: 181 PSGKAGLFNQALMELGALVCTPKNPDCKGCPVSVHCLALKEQTVDSRPVLPPKKKTQALE 240

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKD------GNIDTHSAPFTANW 293
            +  + +  D +IL++KR    L+ G+ E PG   +  +                     
Sbjct: 241 VSAGVCV-RDRKILIQKRLPKGLMAGLWEFPGGKLNPGESPEQALVREFAEELEIDIECG 299

Query: 294 ILCNTITHTFTHFTLTLFVWKTIVPQIV------IIPDSTWHDAQNLANAALPTVMKKAL 347
                I H +T F + L V+   + +           +  W   + L   A P+  ++ +
Sbjct: 300 EKITVIQHAYTRFRVRLHVFWCSMKKPAQTPALHAAEEIRWVSPKELDGLAFPSADRRLI 359

Query: 348 SAG 350
              
Sbjct: 360 QML 362


>gi|330722276|gb|EGH00150.1| A/G-specific adenine glycosylase [gamma proteobacterium IMCC2047]
          Length = 347

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 114/355 (32%), Positives = 180/355 (50%), Gaps = 15/355 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
             +    + +LDW+D   R  LPW+            PY+ W+SEIMLQQT V TV PYF
Sbjct: 1   MKDFNFSAAVLDWFDQPGRKNLPWQQKD--------DPYRTWVSEIMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FMQ++P +  L+ A+++E+L  W GLGYY RARNL K A ++ +++   FP   + L+
Sbjct: 53  ERFMQRFPDVGSLAQAEEDEVLHLWTGLGYYARARNLHKTAQLVHQQFNNQFPTTQDALE 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKIT 179
           +LPGIG  TA AI++++    A ++D N++R++SR+  +          KT+   A   T
Sbjct: 113 QLPGIGRSTAGAILSLSMQQRAPILDGNVKRVLSRFKTVEGWSGQSTTLKTLWQLAEDFT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              R  D+ QAMMDLGA +CT N+P C +CP+Q++C  + +           KK+ P R 
Sbjct: 173 PQQRVADYTQAMMDLGATLCTRNQPKCSVCPLQQHCQAYQQDCVKSYPQPKPKKQLPTRH 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
               I       +LL KR    +  G+  LP     +    + +             + +
Sbjct: 233 VFFLILRNQQGEVLLEKRPAQGIWGGLWSLPQHEDQNELITSSEQQLQGRIEVTDQLSKV 292

Query: 300 THTFTHFTLTLFVWKTIV----PQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            HTF+H+ LT+      +    PQI+      W+  + L+   L T +K  L + 
Sbjct: 293 RHTFSHYHLTMQPLLAKLDDAPPQILSGQQRDWYHPKQLSGIGLATPIKNLLDSL 347


>gi|83816513|ref|YP_446225.1| A/G-specific adenine glycosylase [Salinibacter ruber DSM 13855]
 gi|294508156|ref|YP_003572214.1| A/G-specific adenine DNA glycosylase [Salinibacter ruber M8]
 gi|83757907|gb|ABC46020.1| A/G-specific adenine glycosylase [Salinibacter ruber DSM 13855]
 gi|294344484|emb|CBH25262.1| A/G-specific adenine DNA glycosylase [Salinibacter ruber M8]
          Length = 354

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 108/351 (30%), Positives = 179/351 (50%), Gaps = 20/351 (5%)

Query: 12  ILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPTI 71
           +LDWYDT+ R +PWR +          PY++W+SEIMLQQT V TV  Y+ +F++ +PT+
Sbjct: 1   MLDWYDTHKRSMPWRETD--------DPYRIWVSEIMLQQTRVDTVRDYYHRFLEAFPTV 52

Query: 72  FCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYTA 131
             L+ A  + +L  W GLG+Y RAR+L   A  +V +++G  P  ++ +K L G+G YTA
Sbjct: 53  EALADADRDTVLKHWEGLGFYARARHLHTAAQHVVDEHDGTVPSTMDAIKDLKGVGPYTA 112

Query: 132 SAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLY--HKTIKNYARKITSTSRPGDFVQ 189
           +A+++IA+     V+D N+ R++SR F + + A        +++ A ++    RPGDF Q
Sbjct: 113 AAVLSIAYRKPHAVLDGNVTRVLSRVFAVDEDATTSAAEGHLRDLANELLDPDRPGDFNQ 172

Query: 190 AMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITND 249
           AMM+LGAL+CT   P C  CP+   C     G      I    +  P    AV +   ++
Sbjct: 173 AMMELGALVCTPRTPHCDRCPLNAVCRAHDAGTEEDYPITPESEPVPHEDIAVGLVFDDN 232

Query: 250 NRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTA------NWILCNTITHTF 303
           +R+L+++R +  LL G+ E PG      +                   +     T++H +
Sbjct: 233 DRLLIQRRPDEGLLGGLWEFPGGKQEGDESMEAACRREVREELGVGMTDVEPFYTLSHAY 292

Query: 304 THFTLTLFVWKTIV----PQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +HF +TL  ++  +    P+        W     L + A P   ++ +   
Sbjct: 293 SHFKITLHAFRGRLADGPPEAREDQPFRWVTVDELDDYAFPRANRRLIEEL 343


>gi|170725680|ref|YP_001759706.1| A/G-specific adenine glycosylase [Shewanella woodyi ATCC 51908]
 gi|169811027|gb|ACA85611.1| A/G-specific adenine glycosylase [Shewanella woodyi ATCC 51908]
          Length = 382

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 114/365 (31%), Positives = 172/365 (47%), Gaps = 24/365 (6%)

Query: 1   MPQPE------HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTT 53
           MP  E          S+I+ WYD   R  LPW+           +PYKVW+SEIMLQQT 
Sbjct: 22  MPVTEPIEANPDTFSSRIITWYDKFGRKHLPWQ--------LEKTPYKVWVSEIMLQQTQ 73

Query: 54  VKTVEPYFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNF 113
           V TV PY+ KFM+++P+I  L+ A  +E+L  W GLGYY RARNL K A II  +++G F
Sbjct: 74  VSTVIPYYLKFMERFPSIGALADAPQDEVLHYWTGLGYYARARNLHKSAQIIRDEFQGEF 133

Query: 114 PHKVEILKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTI 171
           P   + +  LPGIG  TA A+++++      ++D N++R+++R+  I            +
Sbjct: 134 PTNFDNVLALPGIGRSTAGAVLSLSLGQHHAILDGNVKRVLARHDAIQGWPGQKAVENQL 193

Query: 172 KNYARKITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTI 231
            +    +T       + QAMMD+GA ICT +KP C  CP+  +C     G+         
Sbjct: 194 WSLTDSLTPKQDVQKYNQAMMDMGATICTRSKPSCDKCPVAIDCEAQLIGRQTEFPGKKP 253

Query: 232 KKKRPMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTA 291
           KK  P    A  + I     ++L KR    +  G+   P  +     D  +       + 
Sbjct: 254 KKVTPE-KSAWMLVIAKGEEVILEKRPPAGIWGGLWCFPQFSSREELDQYLQIKGIKVSQ 312

Query: 292 NWILCNTITHTFTHFTLTLFVWKTIV-----PQIVIIPDSTWHDAQNLANAALPTVMKKA 346
             +L     HTF+HF L +      +      QI+    S W++  N     L    ++ 
Sbjct: 313 EELLLG-FRHTFSHFHLDITPVVVNLDNQSDNQIMEDKPSVWYNLPNPPKVGLAAATERI 371

Query: 347 LSAGG 351
           L+  G
Sbjct: 372 LAGLG 376


>gi|148253815|ref|YP_001238400.1| A/G-specific DNA-adenine glycosylase [Bradyrhizobium sp. BTAi1]
 gi|146405988|gb|ABQ34494.1| A/G-specific DNA-adenine glycosylase [Bradyrhizobium sp. BTAi1]
          Length = 367

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 148/346 (42%), Positives = 197/346 (56%), Gaps = 10/346 (2%)

Query: 10  SKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWP 69
           +++L WYD + R LPWR            PY+VW+SEIMLQQTTVK V PYF+KF+ +WP
Sbjct: 24  AQLLAWYDRHRRRLPWRAPAGQRS----DPYRVWLSEIMLQQTTVKAVGPYFEKFLARWP 79

Query: 70  TIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDY 129
            +  L SA+ +++L  WAGLGYY+RARNL  CA  +++++ G FP   E L+KLPGIG Y
Sbjct: 80  DVSALGSAELDDVLRMWAGLGYYSRARNLHACAVTVLREHGGVFPDTEEGLRKLPGIGPY 139

Query: 130 TASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQ 189
           TA+AI AIAF+   + VD NIER++SR F + +  P     I+  A  +   +R GD  Q
Sbjct: 140 TAAAIAAIAFDRLTMPVDGNIERVVSRLFAVEEALPQAKPQIQALAATLLGPARAGDSAQ 199

Query: 190 AMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITND 249
           A+MDLGA ICT  KP C LCP+ ++C     G          KK   +R GA F+ +T  
Sbjct: 200 ALMDLGATICTPKKPACSLCPLNEDCAARDRGDQDTFPRKAAKKTGTLRRGAAFV-VTRG 258

Query: 250 NRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPF---TANW-ILCNTITHTFTH 305
           + +L+R R    LL GM E+PGS W + +D       AP       W      +TH FTH
Sbjct: 259 DELLVRSRPAKGLLGGMTEVPGSDWLAGQDDADALAQAPELTSVKRWHRKLGVVTHVFTH 318

Query: 306 FTLTLFVWKTIVPQIVIIPDS-TWHDAQNLANAALPTVMKKALSAG 350
           F L L V+   VP     PD   W     L   ALP VM+K ++ G
Sbjct: 319 FPLELVVYTAKVPPRTGAPDGMRWVPIATLDGEALPNVMRKVVAHG 364


>gi|94499836|ref|ZP_01306372.1| A/G-specific adenine DNA glycosylase [Oceanobacter sp. RED65]
 gi|94428037|gb|EAT13011.1| A/G-specific adenine DNA glycosylase [Oceanobacter sp. RED65]
          Length = 350

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 114/352 (32%), Positives = 184/352 (52%), Gaps = 16/352 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
           +        +L W+D + R  LPW+ +         +PY+VW+SEIMLQQT V TV PY+
Sbjct: 6   KTSKQFSDAVLAWFDEHGRHDLPWQHN--------KTPYRVWVSEIMLQQTQVTTVIPYY 57

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FMQ++P +  L++A+ +E+L  W GLGYY RARNL KCA  +V+KY G FP  V  L+
Sbjct: 58  QRFMQRFPDVKSLAAAEQDEVLHLWTGLGYYARARNLHKCAQTVVEKYAGVFPSTVAELE 117

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYH--KTIKNYARKIT 179
            L GIG  TA AI +I+   +A ++D N++R+++R+  +            + + A + T
Sbjct: 118 SLSGIGRSTAGAIASISMGQYAAILDGNVKRVLTRFHAVEGWPGNKKVADQLWDIAERYT 177

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              R  D+ QAMMDLGA +CT +KP C +CP+   C  +++ +      +  KK +    
Sbjct: 178 PQQRTADYTQAMMDLGATLCTRSKPGCEICPLHAQCEAYAQNRVKEFPNSKPKKDK-PVK 236

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
               + + +D+ ILL+++ +T +  G+   P  + +               A + L    
Sbjct: 237 TTQMVLVRHDDEILLQQQPSTGIWGGLWIFPQLSINDDALSLPFLQGCDIKAVYELEG-F 295

Query: 300 THTFTHFTLTLFVWKTIV---PQIVIIPDSTWHDAQNLANAALPTVMKKALS 348
            HTF+H+ L +   +  +   P  +   D  W+  Q  AN  L   +KK L 
Sbjct: 296 RHTFSHYHLDIKPIRIDIERKPNTINESDQLWYSLQQGANVGLAAPVKKLLE 347


>gi|186475089|ref|YP_001856559.1| A/G-specific adenine glycosylase [Burkholderia phymatum STM815]
 gi|184191548|gb|ACC69513.1| A/G-specific adenine glycosylase [Burkholderia phymatum STM815]
          Length = 369

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 106/361 (29%), Positives = 170/361 (47%), Gaps = 23/361 (6%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
                +++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+ +F
Sbjct: 19  SDFSVRLIAWQREHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVIPYYARF 70

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           + ++P +  L+SA  +++++ WAGLGYYTRARNL +CA ++V+++ G FP  V+ L +LP
Sbjct: 71  LARFPDVAALASAPADDVMTLWAGLGYYTRARNLHRCAQVVVEQHGGRFPESVDALAELP 130

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKITS-- 180
           GIG  TA+AI + AF   A ++D N++R+++R F +            +   A  +    
Sbjct: 131 GIGRSTAAAIASFAFGARATILDGNVKRVLARVFGVEGYPGEKKVENGMWLLAESLLPVN 190

Query: 181 --TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
                   + Q +MD GA +C   KP C  CP   +C+    G+   L     KK  P R
Sbjct: 191 ATDDDISAYTQGLMDFGATLCARGKPDCVRCPFAVDCVAHVTGRQRELPAARPKKTVPTR 250

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
                + + + + ++L KR  + +  G+  LP +A             A   A       
Sbjct: 251 RT-WMLLLRDGDSVMLEKRPPSGIWGGLWSLPEAAGEDALSQLARDLGA--RAAVSPLAP 307

Query: 299 ITHTFTHFTLTLFVWKTIVPQIVI-----IPDSTWHDAQNLANAALPTVMKKALSAGGIK 353
           +TH FTHF L +                   D+ W     L    +P  ++K L A    
Sbjct: 308 LTHVFTHFRLEIEPRIAEFDHASKTVSARDADTAWMSLNELDAYGVPAPVRKLLEALQGS 367

Query: 354 V 354
           +
Sbjct: 368 L 368


>gi|285018842|ref|YP_003376553.1| a/g-specific adenine glycosylase [Xanthomonas albilineans GPE PC73]
 gi|283474060|emb|CBA16561.1| probable a/g-specific adenine glycosylase protein [Xanthomonas
           albilineans]
          Length = 362

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 113/361 (31%), Positives = 169/361 (46%), Gaps = 19/361 (5%)

Query: 1   MPQPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M QP     + +L W+D + R  LPW+           SPY+VW+SEIMLQQT V  V P
Sbjct: 10  MHQPADHFAAHLLAWFDRHGRHDLPWQHP--------RSPYRVWLSEIMLQQTQVAVVIP 61

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF +F+  +PT+  L++A ++ +++ WAGLGYY RARNL   A   V  ++G  P   E 
Sbjct: 62  YFLRFLTHFPTLSALAAADNDAVMAQWAGLGYYARARNLHAAAKHCVALHDGELPRDFEA 121

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA-----PLYHKTIKNY 174
           L  LPGIG  TA AI++ A+N    ++D N++R+++RY  I               + + 
Sbjct: 122 LNALPGIGRSTAGAILSQAWNDRFPILDGNVKRVLTRYHGIAGYPGLPAVEKPLWAMAHA 181

Query: 175 ARKITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKK 234
                   R  D+ QA MD GA +CT   P C LCP+Q +C+   +G    L      K 
Sbjct: 182 HVGAVPDGRMADYTQAQMDFGATLCTRANPACVLCPLQDDCVARRDGLVDALPTPKPGKT 241

Query: 235 RPMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTAN-W 293
            P R     +       +LL++R  T +  G+  LP +   S        H++    +  
Sbjct: 242 LPEREAVALLLENAAGDLLLQRRPPTGIWAGLWTLPQAETESALRDWFARHASGRAFDAA 301

Query: 294 ILCNTITHTFTHFTLTLFVWKTIV----PQIVIIPDSTWHDAQNLANAALPTVMKKALSA 349
              + I HTF+H+ L L   +         +    D  W     L+   LP  ++K L  
Sbjct: 302 EPLSPIVHTFSHYRLHLQPLRLRKVALRDALRDNDDLRWVARTALSALGLPAPIRKLLDG 361

Query: 350 G 350
            
Sbjct: 362 L 362


>gi|299134659|ref|ZP_07027851.1| A/G-specific adenine glycosylase [Afipia sp. 1NLS2]
 gi|298590469|gb|EFI50672.1| A/G-specific adenine glycosylase [Afipia sp. 1NLS2]
          Length = 349

 Score =  254 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 152/355 (42%), Positives = 197/355 (55%), Gaps = 15/355 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
           MP+        +L WYD + R+LPWR  P       P PY+VW+SEIMLQQTTVK V PY
Sbjct: 1   MPR-----AELLLRWYDRHRRLLPWRALP----GETPDPYRVWLSEIMLQQTTVKAVGPY 51

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           F KF+ +WP +  +++A  +++L  WAGLGYY+RARNL  CA  + +++ G FP   E L
Sbjct: 52  FLKFIDRWPNVTHMAAASLDDVLRMWAGLGYYSRARNLYACAVAVAREHGGAFPDSEEGL 111

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITS 180
           ++LPGIG YTA+AI AIAF    + VD NIER++SR + +    P     I+  A  +  
Sbjct: 112 RELPGIGPYTAAAIAAIAFGRQTMPVDGNIERVVSRLYAVEDELPKAKPEIQRLATTLLG 171

Query: 181 TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG 240
           TSR GD  QA+MDLGA ICT  KP C LCP+  NCL    G+         KK   +R G
Sbjct: 172 TSRAGDSAQALMDLGATICTPKKPACALCPLNDNCLARIRGEQETFPRKAPKKTGALRRG 231

Query: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFT---ANW-ILC 296
           A F  +   + +L+R R    LL GM E+PGS W    D  I    AP     A W    
Sbjct: 232 AAF-IVMRGDEVLVRTRPEKGLLGGMTEVPGSDWLVAHDETIARAQAPAVKGLARWHRKT 290

Query: 297 NTITHTFTHFTLTLFVWKTIVPQIVIIPDS-TWHDAQNLANAALPTVMKKALSAG 350
            T+TH FTHF L L V+   V      P    W     L + ALP VM+K ++ G
Sbjct: 291 GTVTHVFTHFPLELSVYVGKVASRTKAPHGMRWVKIATLKDEALPNVMRKVIAHG 345


>gi|78067596|ref|YP_370365.1| A/G-specific DNA-adenine glycosylase [Burkholderia sp. 383]
 gi|77968341|gb|ABB09721.1| A/G-specific DNA-adenine glycosylase [Burkholderia sp. 383]
          Length = 368

 Score =  254 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 104/362 (28%), Positives = 178/362 (49%), Gaps = 25/362 (6%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               ++++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+ +F
Sbjct: 18  RTFATRLVAWQREHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVIPYYTRF 69

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           ++++P +  L++A  +++++ WAGLGYY+RARNL +CA ++V ++ G FP   + L +LP
Sbjct: 70  LERYPDVAALAAAPTDDVMALWAGLGYYSRARNLHRCAQVVVAEHGGAFPATPDALAELP 129

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITST- 181
           GIG  TA+AI + A+   A ++D N++R+++R F +            +   A  +    
Sbjct: 130 GIGRSTAAAIASFAYGARATILDGNVKRVLARVFGVEGFPGEKRVENDMWALAESLLPDA 189

Query: 182 ---SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
              +    + Q +MDLGA +C   KP C  CP   +C+  S G+   L     KK  P R
Sbjct: 190 ANAADVSAYTQGLMDLGATLCVRGKPDCARCPFAGDCVAQSTGRQRELPAARPKKAVPTR 249

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
                + + + + +LL +R  T +  G+  LP +   +      +          +    
Sbjct: 250 KT-WMLVLRDGDAVLLERRPPTGIWGGLWSLPQADGDAAL---AELARGFGGGGTVPLAP 305

Query: 299 ITHTFTHFTLTLFVWKTI------VPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGI 352
           +THTFTHF L +    +       +P+     D+ W     L    +P  ++K L A   
Sbjct: 306 LTHTFTHFRLEIEPRLSDMADGGGLPEGARDADTAWVPLSRLDAYGVPAPVRKLLDALSG 365

Query: 353 KV 354
            +
Sbjct: 366 PL 367


>gi|146313005|ref|YP_001178079.1| adenine DNA glycosylase [Enterobacter sp. 638]
 gi|145319881|gb|ABP62028.1| A/G-specific DNA-adenine glycosylase [Enterobacter sp. 638]
          Length = 352

 Score =  254 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 106/356 (29%), Positives = 168/356 (47%), Gaps = 16/356 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M        +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV P
Sbjct: 1   MTMHASQFSAQVLDWYDKYGRKTLPWQI--------EKTPYKVWLSEVMLQQTQVATVIP 52

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF++FM ++PTI  L++A  +E+L  W GLGYY RARNL K A ++   ++G FP   E 
Sbjct: 53  YFERFMTRFPTITDLANAPLDEVLHLWTGLGYYARARNLHKAAQLVATTHQGKFPETFEE 112

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARK 177
           +  LPG+G  TA A+++++      ++D N++R+++R + +            +   +  
Sbjct: 113 VAALPGVGRSTAGAVLSLSLGKHFPILDGNVKRVLARCYAVDGWPGKKEVEKRLWEISEA 172

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T       F QAMMDLGA++CT +KP C LCP+   C+ ++            K+  P 
Sbjct: 173 VTPAKGVERFNQAMMDLGAIVCTRSKPKCELCPVNNLCMAYANHSWAQYPGKKPKQTIPE 232

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
           RTG + +   +D   L ++   + L  G+   P           +         N     
Sbjct: 233 RTGYMLLMQHDDEAYLAQRPP-SGLWGGLFCFPQFESEEGLRQWLAD-RGINADNLTQLT 290

Query: 298 TITHTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAG 350
              HTF+HF L +      V       D     W++     +  L   +++ L   
Sbjct: 291 AFRHTFSHFHLDIVPMWLPVSSFASCMDEGTGLWYNLAQPPSVGLAAPVERLLQQL 346


>gi|24374879|ref|NP_718922.1| A/G-specific adenine glycosylase [Shewanella oneidensis MR-1]
 gi|24349580|gb|AAN56366.1|AE015774_1 A/G-specific adenine glycosylase [Shewanella oneidensis MR-1]
          Length = 365

 Score =  254 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 107/364 (29%), Positives = 175/364 (48%), Gaps = 24/364 (6%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M        ++I++WYD + R  LPW+           +PY+VW+SEIMLQQT V TV P
Sbjct: 1   MKSTAS-FATRIVNWYDNHGRKTLPWQQD--------KTPYRVWVSEIMLQQTQVATVIP 51

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           Y+++FMQ++P +  L++A D+E+L  W GLGYY RARNL K A +I  +Y+G FP   E 
Sbjct: 52  YYQRFMQRFPNVLALANAPDDEVLHHWTGLGYYARARNLHKAAKMIRDEYQGQFPTDFEQ 111

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARK 177
           +  LPGIG  TA A+++++      ++D N++R+++R+  I          + +     +
Sbjct: 112 VLALPGIGRSTAGAVLSLSLGQHHPILDGNVKRVLARHGAIEGWPGQKPVEERLWQLTEQ 171

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T       + QAMMD+GA ICT +KP C  CP+  +C     G+          KK   
Sbjct: 172 LTPQQDIQKYNQAMMDIGASICTRSKPNCAACPVAVDCKAQLMGRQTDFPGKK-PKKTIP 230

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
              A  + +  DN++ L KR    +  G+   P  +  +  +  ++              
Sbjct: 231 EKSAWMLVLFKDNQVFLAKRPPAGIWGGLWCFPEFSSEAALNTELEAQ-GYQPTQLEPLI 289

Query: 298 TITHTFTHFTLTLFVWKTIVPQ----------IVIIPDSTWHDAQNLANAALPTVMKKAL 347
              HTF+HF L +      + +          I+    S W++    +   L    ++ L
Sbjct: 290 GFRHTFSHFHLDIQPMLLDLDKWASGKPSVGAIMEQNQSLWYNINQPSKVGLAAATERVL 349

Query: 348 SAGG 351
           +  G
Sbjct: 350 ANLG 353


>gi|149203472|ref|ZP_01880442.1| A/G-specific adenine glycosylase [Roseovarius sp. TM1035]
 gi|149143305|gb|EDM31344.1| A/G-specific adenine glycosylase [Roseovarius sp. TM1035]
          Length = 353

 Score =  254 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 143/348 (41%), Positives = 197/348 (56%), Gaps = 7/348 (2%)

Query: 9   QSKILDWYDTNHRVLPWRTSPKTEK-SSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQK 67
              +L WYDT+ R LPWR SP      + P PY++W+SE+MLQQTTV  V+ YF +F   
Sbjct: 7   AESLLAWYDTHARDLPWRISPAARAAGAHPDPYRIWLSEVMLQQTTVAAVKSYFLRFTTL 66

Query: 68  WPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIG 127
           WPT+  L++A+D +++  WAGLGYY RARNL KCA ++V+ + G FP  ++ L+ LPGIG
Sbjct: 67  WPTVADLAAAEDAQVMGEWAGLGYYARARNLLKCARVVVRDHGGRFPDTLDGLRALPGIG 126

Query: 128 DYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDF 187
            YTA+AI AIA++   VVVD N+ER+++R +DI  P P   + +   A ++T   RPGD+
Sbjct: 127 PYTAAAIAAIAYDQPHVVVDGNVERVMARLYDIHTPLPTAKRALTEAAARLTPRLRPGDY 186

Query: 188 VQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAIT 247
            QA+MDLGA ICT   P C LCP +  C   + G +  L     K  +P+R G  ++A  
Sbjct: 187 AQAVMDLGATICTPKSPACGLCPWRAPCAARAAGTAQHLPRKQPKTPKPVRHGHAYVARR 246

Query: 248 NDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN-TITHTFTHF 306
            D   LL +R ++ LL GM   PGS W  +       H+ P  A+W        HTFTHF
Sbjct: 247 ADGAWLLERRPDSGLLGGMLGWPGSDWGESP-----LHTPPIAADWQQLEAEARHTFTHF 301

Query: 307 TLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
            L L V   IVP  V      +          LPT+M+K        +
Sbjct: 302 HLRLTVHVAIVPDGVPPERGMFLSDAAFRPTELPTLMRKVFDLARAAL 349


>gi|90580275|ref|ZP_01236082.1| A/G-specific adenine DNA glycosylase [Vibrio angustum S14]
 gi|90438577|gb|EAS63761.1| A/G-specific adenine DNA glycosylase [Vibrio angustum S14]
          Length = 354

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 109/357 (30%), Positives = 173/357 (48%), Gaps = 19/357 (5%)

Query: 7   IIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
                IL WYD   R  LPW+ +         +PYKVW+SEIMLQQT V TV PYF++FM
Sbjct: 4   TFSDAILAWYDKFGRKTLPWQQN--------KTPYKVWLSEIMLQQTQVATVIPYFERFM 55

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
           +++PT+  L++A+ +E+L  W GLGYY RARNL K A +IV ++ G FP  ++ ++ LPG
Sbjct: 56  ERFPTVQDLAAAEQDEVLHLWTGLGYYARARNLHKAAQLIVSEHNGIFPTNIDQVQALPG 115

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTSR 183
           IG  TA A+++++      ++D N++R ++R + I            +   A   T    
Sbjct: 116 IGRSTAGAVLSLSLAQHHPILDGNVKRTLARCYAIEGWPGKKTVENKLWQIAETNTPEMG 175

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVF 243
              + QAMMD+GA+ICT +KP C LCP+   C+   E +         KK  P +    F
Sbjct: 176 VERYNQAMMDMGAMICTRSKPKCELCPVSTQCIALKELRQTDFPGKKPKKTLPEKQT-WF 234

Query: 244 IAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAP---FTANWILCNTIT 300
             +  D+++ L +R    +  G+   P   +++     +D                    
Sbjct: 235 AILQCDDKVWLEQRPQVGIWGGLWCFPQH-YNADLTSLLDKQLGQQLSLIEQQSQLTAFR 293

Query: 301 HTFTHFTLTLFVWKTIV---PQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
           HTF+H+ L +      +   P  +      W+D  N     L   ++K L +    +
Sbjct: 294 HTFSHYHLDIVPILYELKSQPTEINEASGQWYDLNNPPKIGLAAPVQKILDSLAYSL 350


>gi|325498521|gb|EGC96380.1| adenine DNA glycosylase [Escherichia fergusonii ECD227]
          Length = 352

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 111/361 (30%), Positives = 174/361 (48%), Gaps = 16/361 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M        +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV P
Sbjct: 1   MTMQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIP 52

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E 
Sbjct: 53  YFERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVAALHGGKFPETFEE 112

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARK 177
           +  LPG+G  TA AI++++ +    ++D N++R+++R + +            + + + +
Sbjct: 113 VAALPGVGRSTAGAILSLSLSKHFPILDGNVKRVLARCYAVNGWPGKKEVENKLWSLSEQ 172

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T       F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P 
Sbjct: 173 VTPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIATANNSWSLYPGKKPKQTLPE 232

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
           RTG   +    D  + L +R  + L  G+   P  A   +    +         N     
Sbjct: 233 RTGYFLLLQHEDE-VFLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-IAADNLTQLT 290

Query: 298 TITHTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
              HTF+HF L +      V      +   ++ W++     +  L   +++ L       
Sbjct: 291 AFRHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGA 350

Query: 355 P 355
           P
Sbjct: 351 P 351


>gi|257060855|ref|YP_003138743.1| A/G-specific adenine glycosylase [Cyanothece sp. PCC 8802]
 gi|256591021|gb|ACV01908.1| A/G-specific adenine glycosylase [Cyanothece sp. PCC 8802]
          Length = 352

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 119/359 (33%), Positives = 179/359 (49%), Gaps = 18/359 (5%)

Query: 7   IIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
            ++  +L WY    R LPWR         +  PY +W+SEIMLQQT VKTV PY+++++ 
Sbjct: 2   ALRRSLLLWYQHQGRELPWRN--------IDDPYAIWVSEIMLQQTQVKTVIPYYQRWLA 53

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++P I  L+++  + +L AW GLGYYTRARNL K A II+K Y G FP ++E + KLPGI
Sbjct: 54  QFPNIQTLATSDLQTVLKAWEGLGYYTRARNLYKTAQIILKDYRGIFPRELEKVVKLPGI 113

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGD 186
           G  TA  I++ AFN    ++D N++R+++R   +  P     + + + +  +     P D
Sbjct: 114 GRTTAGGILSSAFNQPISILDGNVKRVLARLVALSDPPAKAIQFLWDVSDSLLDPDNPRD 173

Query: 187 FVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAI 246
           F Q +MDLGA ICT ++P C LCP   +C  + +GK + L +       P +   V +  
Sbjct: 174 FNQGLMDLGATICTRSQPKCLLCPWLSHCQAYQQGKQNQLPMREDSSPLPHKKIGVAVIY 233

Query: 247 TNDNRILLRKRTNTRLLEGMDELPGSAWSSTK------DGNIDTHSAPFTANWILCNTIT 300
            N   IL+ +R +  LL G+ E PG      +         I    A          T+ 
Sbjct: 234 NNAGEILIDRRPDKGLLGGLWEFPGGKIEENETVEECIKREILEEIAIDIEVGEHLITLD 293

Query: 301 HTFTHFTLTLFVWKTI----VPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
           H +THF +TL V         PQ +   +  W     + +   P    K + A     P
Sbjct: 294 HAYTHFKVTLIVHLCRHIAGEPQAIECQEIRWTTLDEIDSFPFPKANSKIIEALRNNQP 352


>gi|296104623|ref|YP_003614769.1| adenine DNA glycosylase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295059082|gb|ADF63820.1| adenine DNA glycosylase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 352

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 108/356 (30%), Positives = 171/356 (48%), Gaps = 16/356 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M        +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV P
Sbjct: 1   MTMQASQFSAQVLDWYDKYGRKTLPWQI--------EKTPYKVWLSEVMLQQTQVATVIP 52

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +  ++ G FP   + 
Sbjct: 53  YFERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATRHNGKFPETFDE 112

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARK 177
           +  LPG+G  TA AI++++      ++D N++R+++R + +            +   +  
Sbjct: 113 VADLPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVDGWPGKKEVEKRLWEISEA 172

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T       F QAMMDLGA++CT +KP C LCP+   C+ ++            K+  P 
Sbjct: 173 VTPAKGVERFNQAMMDLGAMVCTRSKPKCELCPLNNLCVAYANHSWAQYPGKKPKQTLPE 232

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
           RTG + +    D  + L +R  + L  G+   P     +T    +       T N     
Sbjct: 233 RTGYMLLMQHGDE-VFLAQRPPSGLWGGLYCFPQFEDEATLRAWLKQ-RGIATDNLTQQT 290

Query: 298 TITHTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAG 350
              HTF+HF L +      V       D   + W++     +  L   +++ L   
Sbjct: 291 AFRHTFSHFHLDIVPMWLPVSSFASCMDEGTALWYNLAQPPSVGLAAPVERLLQQL 346


>gi|319406874|emb|CBI80509.1| A/G-specific adenine glycosylase MutY [Bartonella sp. 1-1C]
          Length = 352

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 170/350 (48%), Positives = 223/350 (63%), Gaps = 5/350 (1%)

Query: 7   IIQSKILDWYDTNHRVLPWRTSPKTE-KSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
            I S +L WYD N+R LPWR  P  + K   P PY++W+SEIMLQQTTV+ V+PYFKKF+
Sbjct: 3   EISSLLLSWYDQNYRHLPWRMPPTKQIKGIYPDPYQIWLSEIMLQQTTVEAVKPYFKKFL 62

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
           + WP +F LS A  ++I+ AW GLGYY+RARNLK CA  +VK + G FP  +EIL+ LPG
Sbjct: 63  KLWPDLFSLSQASQDDIMKAWTGLGYYSRARNLKNCATQLVKNHRGKFPQSLEILRTLPG 122

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPG 185
           IGDYTA+AI AIAF H   VVD N+ERII+R F I    P     IK    +IT   RPG
Sbjct: 123 IGDYTAAAIAAIAFGHPVAVVDGNVERIITRLFAITSILPKAKSEIKEKTLEITDVKRPG 182

Query: 186 DFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIA 245
           DF QAMMDLG+ IC   KP C LCP+Q  C       +    +   KK+RP++TGA F+ 
Sbjct: 183 DFAQAMMDLGSTICKPRKPSCLLCPLQNLCTATKTQTAEAFPVKAPKKERPLKTGAAFVI 242

Query: 246 ITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTH 305
           +  + +I L KR +T+LL GM ++P +   + ++G     +AP +A+W L   ITHTFTH
Sbjct: 243 LNENKQIYLEKRQHTKLLNGMTQIPNNIGINEENG---LQNAPCSAHWKLKGQITHTFTH 299

Query: 306 FTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
           F+L L V+ T   + + + +  W D  +L   ALPTVMKKA+ A  I  P
Sbjct: 300 FSLKLNVYYTDNIRGIKLKNGWWCDIHHLTEEALPTVMKKAI-AIAISSP 348


>gi|114564037|ref|YP_751551.1| A/G-specific adenine glycosylase [Shewanella frigidimarina NCIMB
           400]
 gi|114335330|gb|ABI72712.1| A/G-specific DNA-adenine glycosylase [Shewanella frigidimarina
           NCIMB 400]
          Length = 357

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 102/356 (28%), Positives = 171/356 (48%), Gaps = 21/356 (5%)

Query: 8   IQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
              +I+ WYD + R  LPW+ +         +PY+VW+SEIMLQQT V TV PY++KFM 
Sbjct: 7   FSERIIAWYDLHGRKSLPWQIN--------KTPYRVWVSEIMLQQTQVATVIPYYEKFMA 58

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++P++  L++A  +E+L  W GLGYY RARNL K A  I     G FP + + +  L GI
Sbjct: 59  RFPSVIDLANAHQDEVLHLWTGLGYYARARNLHKAAQHIRDALNGQFPTQFDDVVALSGI 118

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA A+++++      ++D N++R+++R+  I          + +      +T     
Sbjct: 119 GKSTAGAVLSLSLGQHHSILDGNVKRVLARHGAIEGWPGQKHVEQQLWQLTDALTPAKNV 178

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             F QAMMD+G+ +CT +KP C  CP+  +C+    G   L      KK  P ++  + +
Sbjct: 179 EKFNQAMMDIGSSVCTRSKPNCAACPVAIDCVAQQTGHQSLYPGKKPKKVTPEKSAFMVV 238

Query: 245 AITNDNR---ILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITH 301
            + N      + L +R    +  G+   P     +  D  +  H+   T +        H
Sbjct: 239 LVDNSEDSVKVQLIQRPPAGIWGGLWCFPQFEHQAELDNYLTLHN--LTESEQGLAGFRH 296

Query: 302 TFTHFTLTLFVWKTIVP-----QIVIIPDSTWHDAQNLANAALPTVMKKALSAGGI 352
           TF+HF L +      +       I+    + W++ +  A   L    ++ L+   +
Sbjct: 297 TFSHFHLDIQPVLVELSVDQATGIMEQTSALWYNIEQPAKVGLAAATERILANLAV 352


>gi|206559201|ref|YP_002229962.1| putative A/G-specific adenine glycosylase [Burkholderia cenocepacia
           J2315]
 gi|198035239|emb|CAR51113.1| putative A/G-specific adenine glycosylase [Burkholderia cenocepacia
           J2315]
          Length = 368

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 105/362 (29%), Positives = 175/362 (48%), Gaps = 25/362 (6%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               ++++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+ +F
Sbjct: 18  RTFATRLVAWQRAHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVIPYYTRF 69

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           + ++P +  L++A  +++++ WAGLGYY+RARNL +CA ++V ++ G FP   + L +LP
Sbjct: 70  LDRYPDVAALAAAPSDDVMALWAGLGYYSRARNLHRCAQVVVAEHGGAFPATPDALAELP 129

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITST- 181
           GIG  TA+AI + A+   A ++D N++R+++R F +            +   A  +    
Sbjct: 130 GIGRSTAAAIASFAYGARATILDGNVKRVLARVFGVEGFPGEKRVENDMWALAESLLPDA 189

Query: 182 ---SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
              +    + Q +MDLGA +C   KP C  CP   +C+  S G+   L     KK  P R
Sbjct: 190 ANAADVSAYTQGLMDLGATLCVRGKPDCARCPFAGDCVAQSTGRQRELPAARPKKAVPTR 249

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
                + + + + +LL +R  T +  G+  LP +   +      D          +    
Sbjct: 250 KT-WMLVLRDGDAVLLERRPPTGIWGGLWSLPQADGDAAL---ADLARGFGGGRTVPLAP 305

Query: 299 ITHTFTHFTLTLFVWK------TIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGI 352
           +THTFTHF L +            +P      D+ W     L    +P  ++K L A   
Sbjct: 306 LTHTFTHFRLEIEPRLSDLADGVGLPSQARDADTAWVPLSRLDAYGVPAPVRKLLDALSG 365

Query: 353 KV 354
            +
Sbjct: 366 PL 367


>gi|254524135|ref|ZP_05136190.1| A/G-specific adenine glycosylase [Stenotrophomonas sp. SKA14]
 gi|219721726|gb|EED40251.1| A/G-specific adenine glycosylase [Stenotrophomonas sp. SKA14]
          Length = 374

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 122/362 (33%), Positives = 179/362 (49%), Gaps = 15/362 (4%)

Query: 2   PQPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
              E    +++L W+D + R  LPW+           SPY+VW+SEIMLQQT V TV PY
Sbjct: 11  TAQEDGFVARLLHWFDGHGRHDLPWQHP--------RSPYRVWLSEIMLQQTQVATVIPY 62

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           F +F+Q +PT+  L++A ++ +++ WAGLGYY RARNL   A   V+ ++G+ P   + L
Sbjct: 63  FLRFLQHFPTLPDLAAASNDAVMAQWAGLGYYARARNLHAAAKRCVEVHDGDLPRDFDAL 122

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA-----PLYHKTIKNYA 175
             LPGIG  TA AI++ A+N    ++D N++R++SRY DI               I    
Sbjct: 123 HALPGIGRSTAGAILSQAWNDPFAILDGNVKRVLSRYHDIDGFPGLPAIERQLWVIAEAH 182

Query: 176 RKITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKR 235
                  R  D+ QA MDLGA +C+  KP C +CP+Q +C+   EG++  L      K  
Sbjct: 183 VAQVPAGRMADYTQAQMDLGATVCSRAKPACVICPLQDDCVARREGRTSELPTPKPSKTL 242

Query: 236 PMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWIL 295
           P R     +      R+LL+KR +T +   +  LP +   S      D H      +   
Sbjct: 243 PEREAVALLLRDAQQRVLLQKRPDTGIWAQLWTLPQAEAGSMLQDWFDAHVDGSLEDAEE 302

Query: 296 CNTITHTFTHFTLTLFVWKTIVPQIV-IIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
              + HTF+H+ L L V    V  +    P   W  A  L    LP  ++K L    IK 
Sbjct: 303 LPVLQHTFSHYKLHLQVLSRQVHGLRVEEPTLRWVAADELPALGLPAPIRKLLDGTAIKA 362

Query: 355 PQ 356
            +
Sbjct: 363 SK 364


>gi|296161533|ref|ZP_06844338.1| A/G-specific adenine glycosylase [Burkholderia sp. Ch1-1]
 gi|295888177|gb|EFG67990.1| A/G-specific adenine glycosylase [Burkholderia sp. Ch1-1]
          Length = 353

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 111/367 (30%), Positives = 183/367 (49%), Gaps = 28/367 (7%)

Query: 1   MPQPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           MP       S+++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV P
Sbjct: 1   MP----DFSSRLIAWQRQHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVIP 48

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           Y+ KF+ ++PT+  L++A  +++++ WAGLGYYTRARNL +CA ++V+++ G FP  VE 
Sbjct: 49  YYAKFLARFPTVAALAAAPSDDVMALWAGLGYYTRARNLHRCAQVVVEQHGGAFPASVEE 108

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARK 177
           L +LPGIG  TA+AI + AF   A ++D N++R+++R F +            +   A  
Sbjct: 109 LAELPGIGRSTAAAIASFAFGARATILDGNVKRVLARVFGVEGFPGEKKVENAMWTLAES 168

Query: 178 ITSTSRPG----DFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKK 233
           +  ++        + Q +MDLGA +C   KP C  CP   +C+    G+  LL     KK
Sbjct: 169 LLPSNASDAEVSAYTQGLMDLGATLCVRGKPDCLRCPFAVDCVANVTGRQRLLPTARPKK 228

Query: 234 KRPMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANW 293
             P R     + + + N ++L KR  + +  G+  LP +A  ++                
Sbjct: 229 TVPTRRT-WMLVLRDGNAVMLEKRPPSGIWGGLWSLPEAADETSLAERARAFGG--DGAV 285

Query: 294 ILCNTITHTFTHFTLTLFVWKTIVPQI------VIIPDSTWHDAQNLANAALPTVMKKAL 347
                +TH FTHF L +      + +       +   D+ W    +L +  +P  ++K L
Sbjct: 286 SPLAPLTHVFTHFKLDIEPRLAELDRGVGALGALGDADTAWVALSDLDSFGVPAPVRKLL 345

Query: 348 SAGGIKV 354
            +    +
Sbjct: 346 DSLQGSL 352


>gi|83313083|ref|YP_423347.1| A/G-specific DNA glycosylase [Magnetospirillum magneticum AMB-1]
 gi|82947924|dbj|BAE52788.1| A/G-specific DNA glycosylase [Magnetospirillum magneticum AMB-1]
          Length = 389

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 147/341 (43%), Positives = 190/341 (55%), Gaps = 8/341 (2%)

Query: 9   QSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKW 68
            S +L WYD + RVLPWR +P         PY VW+SE+MLQQTTV  V PYF+ F+++W
Sbjct: 45  ASLLLAWYDRDRRVLPWRYAPGEAA----DPYHVWLSEVMLQQTTVAAVIPYFQAFIRRW 100

Query: 69  PTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGD 128
           P +  L++A  EE+++AWAGLGYY RARNL  CA ++ +   G FP     L++LPGIGD
Sbjct: 101 PRVGDLAAAATEEVMAAWAGLGYYARARNLHACAKLVAEWRGGRFPEDEAGLRQLPGIGD 160

Query: 129 YTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFV 188
           YTA+AI AIAF H AVVVD N+ER+++R F +  P P     +K  A  +T   R GD+ 
Sbjct: 161 YTAAAIAAIAFGHRAVVVDGNVERVMARMFAVTDPLPAAKPRLKELAATLTPDDRAGDYA 220

Query: 189 QAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITN 248
           QA+MDLGA ICT   P C LCP +  C   + G +  L     K +RP R G VF     
Sbjct: 221 QAVMDLGATICTPRSPACGLCPWRPGCRAQALGLAESLPAKVEKAERPTRRGVVFWLTAP 280

Query: 249 DNRILLRKRTNTRLLEGMDELPGSAWSSTKD--GNIDTHSAPFTANWILC-NTITHTFTH 305
           D  +LLR+R    LL GM E P + W             +     +W L    +THTFTH
Sbjct: 281 DGSVLLRRRPPKGLLGGMMEFPSTDWRDAAWSLDEAAPSAPLAPKSWRLLPGLVTHTFTH 340

Query: 306 FTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKA 346
           F L L V     P    +    W     L   ALPT+M+K 
Sbjct: 341 FHLELTVAAGRTPAQPAV-RGVWCPLDRLEEQALPTLMRKV 380


>gi|89070020|ref|ZP_01157351.1| A/G-specific adenine glycosylase [Oceanicola granulosus HTCC2516]
 gi|89044357|gb|EAR50495.1| A/G-specific adenine glycosylase [Oceanicola granulosus HTCC2516]
          Length = 346

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 141/340 (41%), Positives = 199/340 (58%), Gaps = 6/340 (1%)

Query: 10  SKILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTVEPYFKKFMQKW 68
             +LDWYD + R LPWR  P   ++ +   PY+VW+SE+MLQQTTV  V+ YF++F + W
Sbjct: 3   RDLLDWYDVHARQLPWRVPPAARRAGVRPDPYRVWLSEVMLQQTTVPAVKGYFRRFTETW 62

Query: 69  PTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGD 128
           PT+  L++A+D  ++ AWAGLGYY RARNL KCA  +V ++ G FP   E L++LPGIG 
Sbjct: 63  PTVEALAAAEDGAVMEAWAGLGYYARARNLLKCARAVVAEHGGRFPETAEGLRELPGIGP 122

Query: 129 YTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFV 188
           YT++AI AIA++  A VVD N+ER+++R  D+  P P     +   A  +T  +RPGD+ 
Sbjct: 123 YTSAAIAAIAYDAPATVVDGNVERVMARLHDVHTPLPAAKGELTALAAALTPEARPGDYA 182

Query: 189 QAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITN 248
           QA+MDLGA ICT  +P C +CP +  C   + G +  L     K  +P+R G  ++A   
Sbjct: 183 QAVMDLGATICTPRRPACGICPWRTPCAARAAGTAPELPAKAPKAVKPVRLGHAYVARRA 242

Query: 249 DNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTL 308
           D   LL +R +  LL GM   PGS WS+         + P  A+W       HTFTHF L
Sbjct: 243 DGAWLLERRPDKGLLGGMLGWPGSDWSAA-----PAPAPPLAADWRTVGEARHTFTHFHL 297

Query: 309 TLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALS 348
            L V    +P+  +    ++    +   AALPTVM+K   
Sbjct: 298 RLAVEVAELPEGAVPARGSFVPVADFRPAALPTVMRKVFD 337


>gi|167579768|ref|ZP_02372642.1| A/G-specific adenine glycosylase [Burkholderia thailandensis TXDOH]
          Length = 368

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 102/361 (28%), Positives = 172/361 (47%), Gaps = 25/361 (6%)

Query: 7   IIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
                ++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+ +F+
Sbjct: 19  AFAPTLIAWQRKHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVVPYYVRFL 70

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
           +++P +  L++A  +++++ WAGLGYY+RARNL +CA  +V+++ G FP   E L +LPG
Sbjct: 71  ERYPDVAALAAAPIDDVMALWAGLGYYSRARNLHRCAQAVVERHGGAFPAAPEALAELPG 130

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITS--- 180
           IG  TA+AI + AF   A ++D N++R+++R F +            +   A  +     
Sbjct: 131 IGRSTAAAIASFAFGARATILDGNVKRVLARVFGVEGFPGEKRVENEMWALAEALLPDAA 190

Query: 181 -TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             +    + Q +MDLGA +C   KP C  CP   +C+    G+   L     KK  P R 
Sbjct: 191 GQADVTAYTQGLMDLGATLCVRGKPDCARCPFAGDCVAERSGRQRELPAARPKKAVPTRR 250

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
               + + + + +LL++R    +  G+  LP +                  A+ +   ++
Sbjct: 251 T-WMLVLRDGDAVLLQRRPPAGIWGGLWSLPEADGDMALARRAREFGG---ASLVPLASL 306

Query: 300 THTFTHFTLTLFVWKTIVP------QIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIK 353
           THTFTHF L +      +             ++ W     L    +P  ++K L      
Sbjct: 307 THTFTHFKLEIEPRLADLDGAAGGVSPAADDETAWVSLDKLDAYGVPAPVRKLLDGLSGA 366

Query: 354 V 354
           +
Sbjct: 367 L 367


>gi|126659338|ref|ZP_01730474.1| mutator mutT protein A/G-specific adenine glycosylase [Cyanothece
           sp. CCY0110]
 gi|126619420|gb|EAZ90153.1| mutator mutT protein A/G-specific adenine glycosylase [Cyanothece
           sp. CCY0110]
          Length = 398

 Score =  252 bits (644), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 115/355 (32%), Positives = 177/355 (49%), Gaps = 18/355 (5%)

Query: 6   HIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
             ++  +L WY    R LPWR +          PY +W+SEIMLQQT VKTV PY+++++
Sbjct: 45  SNLRQSLLIWYQQQGRHLPWRNT--------RDPYLIWVSEIMLQQTQVKTVLPYYQRWL 96

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
             +PT+  L++A+ +E+L AW GLGYYTRARNL K A I++ +Y+G FP ++  + KLPG
Sbjct: 97  DTFPTLESLATAELQEVLKAWEGLGYYTRARNLHKAAQILLNEYDGVFPQQLPDVLKLPG 156

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPG 185
           IG  TA  I++ AFN    ++D N++R++SR   +        +++   +  I     P 
Sbjct: 157 IGRTTAGGILSAAFNQRISILDGNVKRVLSRLMALPVSPKKGIQSLWQLSDLILDPENPR 216

Query: 186 DFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIA 245
           DF QA+MDLGA IC   KP C LCP   +CL + +G+ + L +    K  P +   V + 
Sbjct: 217 DFNQALMDLGAEICVKTKPRCLLCPWTSHCLAYQQGQQNQLPMTEKTKPLPHKKIGVAVI 276

Query: 246 ITNDNRILLRKRTNTRLLEGMDELPGSAWSSTK------DGNIDTHSAPFTANWILCNTI 299
             +   IL+ +R    LL G+ E PG      +         I                +
Sbjct: 277 YNDAGLILIDRRPEKGLLGGLWEFPGGKIEPDETVEDCIKREIKEEIDIEIEVGENLVNL 336

Query: 300 THTFTHFTLTLFVWKTI----VPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            H +THF +TL+V         P+ +   +  W   + +     P    K +   
Sbjct: 337 DHAYTHFKVTLYVHLCRYLTGEPKPIECEEIRWVSLEEIDQFPFPKANTKIIELL 391



 Score = 59.5 bits (142), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 37/93 (39%), Gaps = 2/93 (2%)

Query: 45  SEIMLQQTTVKTVEPYFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADI 104
           SEIMLQQT VKTV PY++++++    +   S+   ++I      L    ++  +      
Sbjct: 2   SEIMLQQTQVKTVLPYYQRWLETI--LKDKSNLVAKDITLPVFNLSNLRQSLLIWYQQQG 59

Query: 105 IVKKYEGNFPHKVEILKKLPGIGDYTASAIVAI 137
               +       +  + ++        + +   
Sbjct: 60  RHLPWRNTRDPYLIWVSEIMLQQTQVKTVLPYY 92


>gi|316935985|ref|YP_004110967.1| A/G-specific adenine glycosylase [Rhodopseudomonas palustris DX-1]
 gi|315603699|gb|ADU46234.1| A/G-specific adenine glycosylase [Rhodopseudomonas palustris DX-1]
          Length = 377

 Score =  252 bits (644), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 143/351 (40%), Positives = 185/351 (52%), Gaps = 10/351 (2%)

Query: 10  SKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWP 69
             +L WYD + R LPWR  P         PY VW+SEIMLQQTTV+ V PYF KFM +WP
Sbjct: 32  QALLAWYDRHRRSLPWRAPPGASA----DPYAVWLSEIMLQQTTVRAVGPYFDKFMARWP 87

Query: 70  TIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDY 129
           ++  L  A  +++L  WAGLGYY+RARNL  CA  + +++ G FP   E L+ LPG+G Y
Sbjct: 88  SVTALGEASLDDVLKMWAGLGYYSRARNLHACAVAVTRQHGGRFPDTEEGLRALPGVGPY 147

Query: 130 TASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQ 189
           TA+AI AIAF+   + VD NIER++SR   +    P     IK  A  +   SR GD  Q
Sbjct: 148 TAAAIAAIAFSRRTMPVDGNIERVVSRLCAVEDELPKAKPRIKALAETLLGPSRAGDSAQ 207

Query: 190 AMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITND 249
           A+MDLGA ICT  KP C LCP+   C     G +        KK   +R GA F+ I  D
Sbjct: 208 ALMDLGATICTPKKPACALCPLMDGCAARLRGDADSFPRKAPKKTGALRRGAAFVVIRGD 267

Query: 250 NRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANW----ILCNTITHTFTH 305
             +L+R R    LL GM E+P S W +  D       AP              ++H FTH
Sbjct: 268 Q-VLVRSRPAKGLLGGMTEVPNSDWLADHDEAAARAQAPVLKGLSRWHRKPGVVSHVFTH 326

Query: 306 FTLTLFVWKTIVPQI-VIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
           F L L V+    P       +  W     LA+ ALP +M+K ++ G    P
Sbjct: 327 FPLELTVYVAHAPGGTRAPAEMRWAAIATLADEALPNLMRKVIAHGLGGRP 377


>gi|167909467|ref|ZP_02496558.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei 112]
          Length = 368

 Score =  252 bits (644), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 103/362 (28%), Positives = 172/362 (47%), Gaps = 25/362 (6%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
                 ++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+ +F
Sbjct: 18  SAFAPTLIAWQRKHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVVPYYVRF 69

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           ++++P +  L++A  +++++ WAGLGYY+RARNL +CA  +V+++ G FP   E L +LP
Sbjct: 70  LERYPDVAALAAAPIDDVMALWAGLGYYSRARNLHRCAQAVVERHGGAFPASPEALAELP 129

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITS-- 180
           GIG  TA+AI + AF   A ++D N++R+++R F +            +   A  +    
Sbjct: 130 GIGRSTAAAIASFAFGARATILDGNVKRVLARVFGVEGFPGDKRIENEMWALAEALLPDA 189

Query: 181 --TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
              +    + Q +MDLGA +C   KP C  CP    C+    G+   L     KK  P R
Sbjct: 190 AEPTDVTAYTQGLMDLGATLCVRGKPECGRCPFAGECVAQRSGRQRELPAARPKKAVPTR 249

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
                + + + + +LL++R    +  G+  LP +   +  +           A  +    
Sbjct: 250 RT-WMLVLRDGDAVLLQRRPPAGIWGGLWSLPEADGDAALERRAREFGG---AALVPLAP 305

Query: 299 ITHTFTHFTLTLFVWKTIVPQIVII------PDSTWHDAQNLANAALPTVMKKALSAGGI 352
           +THTFTHF L +  W   +             ++ W     L    +P  ++K L     
Sbjct: 306 LTHTFTHFRLEIEPWLAELDGAAGGASPAADDETAWVLLDRLDAYGVPAPVRKLLDGLSG 365

Query: 353 KV 354
            +
Sbjct: 366 PL 367


>gi|209519648|ref|ZP_03268438.1| A/G-specific adenine glycosylase [Burkholderia sp. H160]
 gi|209499934|gb|EDZ99999.1| A/G-specific adenine glycosylase [Burkholderia sp. H160]
          Length = 353

 Score =  252 bits (643), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 106/369 (28%), Positives = 185/369 (50%), Gaps = 32/369 (8%)

Query: 1   MPQPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           MP       ++++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV P
Sbjct: 1   MP----DFSARLIAWQREHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVIP 48

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           Y+ KF+ ++P +  L++A  +++++ WAGLGYYTRARNL +CA ++V+++ G FP  VE 
Sbjct: 49  YYAKFLARFPDVAALAAAPSDDVMALWAGLGYYTRARNLHRCAQVVVEQHGGAFPASVEA 108

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARK 177
           L +LPGIG  TA+AI + AF   A ++D N++R+++R F +            +   A  
Sbjct: 109 LAELPGIGRSTAAAIASFAFGARATILDGNVKRVLARVFGVEGFPGEKKVENAMWTLAES 168

Query: 178 ITSTSRPG----DFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKK 233
           +   +        + Q +MDLGA +C   KP C  CP   +C+    G+  +L     KK
Sbjct: 169 LLPPNASNAEVSAYTQGLMDLGATLCVRGKPDCARCPFAPDCVANVTGRQRVLPAARPKK 228

Query: 234 KRPMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANW 293
             P R     + + + N ++L +R  + +  G+  LP     +  + ++   +  F ++ 
Sbjct: 229 AVPTRRT-WMLVLRDGNAVMLERRPPSGIWGGLWSLP----EAADEASLAERARSFGSDG 283

Query: 294 I--LCNTITHTFTHFTLTLFVWKTIVPQI------VIIPDSTWHDAQNLANAALPTVMKK 345
                 + +H FTHF L +        +       +   D+ W    +L +  +P  ++K
Sbjct: 284 QVSPLASFSHVFTHFKLDIEPRLAEFGRGVGALAALNDSDTAWVALSDLDSFGVPAPVRK 343

Query: 346 ALSAGGIKV 354
            L++    +
Sbjct: 344 LLASLQGSL 352


>gi|331664548|ref|ZP_08365454.1| A/G-specific adenine glycosylase [Escherichia coli TA143]
 gi|331058479|gb|EGI30460.1| A/G-specific adenine glycosylase [Escherichia coli TA143]
          Length = 350

 Score =  252 bits (643), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 112/359 (31%), Positives = 177/359 (49%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVDRFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G  F+ + +D+ +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 G-YFLLLQHDDEVLLAQRPPSGLWGGLYCFPQFADEESLRLWLAQRQ-IAADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|91212344|ref|YP_542330.1| adenine DNA glycosylase [Escherichia coli UTI89]
 gi|237706385|ref|ZP_04536866.1| adenine DNA glycosylase [Escherichia sp. 3_2_53FAA]
 gi|91073918|gb|ABE08799.1| A/G-specific adenine glycosylase [Escherichia coli UTI89]
 gi|226899425|gb|EEH85684.1| adenine DNA glycosylase [Escherichia sp. 3_2_53FAA]
          Length = 360

 Score =  252 bits (643), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 111/360 (30%), Positives = 174/360 (48%), Gaps = 16/360 (4%)

Query: 2   PQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
                   +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PY
Sbjct: 10  TMQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPY 61

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           F++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E +
Sbjct: 62  FERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEV 121

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKI 178
             LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++
Sbjct: 122 AALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQV 181

Query: 179 TSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
           T       F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P R
Sbjct: 182 TPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPER 241

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
           TG   +    D  +LL +R ++ L  G+   P  A   +    +         N      
Sbjct: 242 TGYFLLLQHEDE-VLLAQRPSSGLWGGLYCFPQFADEESLRQWLAQRQ-ISADNLTQLTA 299

Query: 299 ITHTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
             HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 300 FRHTFSHFHLDIVPMWLPVSSFTGCMDEDNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 359


>gi|189403763|ref|ZP_03007208.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           EC4501]
 gi|189369240|gb|EDU87656.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           EC4501]
          Length = 360

 Score =  252 bits (643), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 111/360 (30%), Positives = 173/360 (48%), Gaps = 16/360 (4%)

Query: 2   PQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
                   +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PY
Sbjct: 10  TMQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPY 61

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           F++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E +
Sbjct: 62  FERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEV 121

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKI 178
             LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++
Sbjct: 122 AALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQV 181

Query: 179 TSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
           T       F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P R
Sbjct: 182 TPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAATNNSWSLYPGKKPKQTLPER 241

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
           TG   +    D  +LL +R  + L  G+   P  A   +    +         N      
Sbjct: 242 TGYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-IAADNLTQLTA 299

Query: 299 ITHTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
             HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 300 FRHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 359


>gi|260599350|ref|YP_003211921.1| adenine DNA glycosylase [Cronobacter turicensis z3032]
 gi|260218527|emb|CBA33731.1| A/G-specific adenine glycosylase [Cronobacter turicensis z3032]
          Length = 361

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 101/351 (28%), Positives = 164/351 (46%), Gaps = 16/351 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                   ++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 2   MQAQQFSRQVLDWYDKYGRKTLPWQQ--------EKTPYKVWLSEVMLQQTQVTTVIPYF 53

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++P +  L++A  +++L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 54  ERFMARFPDVTALANAPLDDVLHLWTGLGYYARARNLHKAAQQVATLHGGAFPETFEEVA 113

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPG+G  TA A+++++      ++D N++R+++R + +            +   + ++T
Sbjct: 114 ALPGVGRSTAGAVLSLSLGKHFPILDGNVKRVLARCYAVEGWPGKKEVENRLWQISERVT 173

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT +KP C +CP+   C  F+            K+  P   
Sbjct: 174 PAEGVARFNQAMMDLGAMVCTRSKPKCEICPLNNGCEAFAHQSYAKYPGKKPKQMLPE-K 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
              F+ + ++  + L++R    L  G+   P     +     +D+               
Sbjct: 233 TGYFLLLQHEGSLFLQQRPPVGLWGGLYCFPQFESEAALREWLDS-RGIAADGLTQLTAF 291

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKAL 347
            HTF+HF L +      V Q     D     W++        L   +++ L
Sbjct: 292 RHTFSHFHLDIVPMWLGVQQTAACMDEASGLWYNLAQPPAVGLAAPVERLL 342


>gi|331654474|ref|ZP_08355474.1| A/G-specific adenine glycosylase [Escherichia coli M718]
 gi|331047856|gb|EGI19933.1| A/G-specific adenine glycosylase [Escherichia coli M718]
          Length = 355

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 111/360 (30%), Positives = 173/360 (48%), Gaps = 16/360 (4%)

Query: 2   PQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
                   +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PY
Sbjct: 5   TMQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPY 56

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           F++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E +
Sbjct: 57  FERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGIFPETFEEV 116

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKI 178
             LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++
Sbjct: 117 AALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQV 176

Query: 179 TSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
           T       F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P R
Sbjct: 177 TPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAATNNSWSLYPGKKPKQTLPER 236

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
           TG   +    D  +LL +R  + L  G+   P  A   +    +         N      
Sbjct: 237 TGYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-IAADNLTQLTA 294

Query: 299 ITHTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
             HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 295 FRHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 354


>gi|283788518|ref|YP_003368383.1| A/G-specific adenine glycosylase [Citrobacter rodentium ICC168]
 gi|282951972|emb|CBG91699.1| A/G-specific adenine glycosylase [Citrobacter rodentium ICC168]
          Length = 360

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 107/359 (29%), Positives = 172/359 (47%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM+ +PT+  L+ A  +E+L  W GLGYY RARNL K A  +  ++ G FP   + + 
Sbjct: 53  ERFMRHFPTVNDLAHAPLDEVLHLWTGLGYYARARNLHKAAQQVATRHNGIFPETFDEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA A+++++      ++D N++R+++R + +            +   +  +T
Sbjct: 113 ALPGVGRSTAGAVLSLSLGKPFPILDGNVKRVLARCYAVSGWPGKKEVEKRLWELSEAVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             +    F QAMMDLGA++CT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PVNGVERFNQAMMDLGAMVCTRSKPKCSLCPLQNGCIAAASDSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +   +D  +LL +R  + L  G+   P  A  +     +                 
Sbjct: 233 GYFLLMQHDDE-VLLTQRPPSGLWGGLYCFPQFASEAELRDWLAQRQ-ISADTLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVP---QIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLGVSLAGSCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|226310613|ref|YP_002770507.1| A/G-specific adenine glycosylase [Brevibacillus brevis NBRC 100599]
 gi|226093561|dbj|BAH42003.1| probable A/G-specific adenine glycosylase [Brevibacillus brevis
           NBRC 100599]
          Length = 368

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 114/357 (31%), Positives = 168/357 (47%), Gaps = 20/357 (5%)

Query: 8   IQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQK 67
               +L WYD+  R LPWR +          PY++W+SEIMLQQT V+TV+PY+  FM+K
Sbjct: 21  FAQDLLAWYDSQKRDLPWRIN--------KDPYRIWVSEIMLQQTRVETVKPYYANFMEK 72

Query: 68  WPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIG 127
           +PT+  L+ A +E++L AW GLGYY+RARNL+  A  +  +Y G  P   E +  L G+G
Sbjct: 73  FPTVSELAKAPEEDVLKAWEGLGYYSRARNLQAAAREVTVRYGGVVPDTPEEIATLKGVG 132

Query: 128 DYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTSRPG 185
            YTA AI++IA+      VD N+ R+ SR   +      P     I++  R++    R G
Sbjct: 133 PYTAGAILSIAYEKAEPAVDGNVMRVFSRLLYLTDDIAKPATRIKIEHLVRQVIPEGRAG 192

Query: 186 DFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIA 245
           DF QA+M+LGA++C    P C  CP+   C+   EG +  L +    K            
Sbjct: 193 DFNQALMELGAMVCVPRTPQCLTCPVFDYCMARQEGVAEELPVKGKAKPPRPVDL-QVGI 251

Query: 246 ITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGN--------IDTHSAPFTANWILCN 297
           I  D ++L+ KR +  LL GM E P        D          +               
Sbjct: 252 IIRDGKVLMNKRPDQGLLAGMWEFPTVETEQESDAAKQEALAAGLRERFGIDVEVMQPLG 311

Query: 298 TITHTFTHFTLTLFVWKTIVPQIVIIPDS-TWHDAQNLANAALPTVMKKALSAGGIK 353
           T+ H F+H    + VW     +   +P    +   + L    +P   +K     G K
Sbjct: 312 TVQHVFSHLQWNMQVWSCDWIEGEELPAHARYAAWEELDAYTIPMAHQKIRELLGQK 368


>gi|254038012|ref|ZP_04872070.1| adenine DNA glycosylase [Escherichia sp. 1_1_43]
 gi|332280341|ref|ZP_08392754.1| adenine DNA glycosylase [Shigella sp. D9]
 gi|226839636|gb|EEH71657.1| adenine DNA glycosylase [Escherichia sp. 1_1_43]
 gi|332102693|gb|EGJ06039.1| adenine DNA glycosylase [Shigella sp. D9]
          Length = 360

 Score =  252 bits (642), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 111/360 (30%), Positives = 173/360 (48%), Gaps = 16/360 (4%)

Query: 2   PQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
                   +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PY
Sbjct: 10  TMQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPY 61

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           F++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E +
Sbjct: 62  FERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEV 121

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKI 178
             LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++
Sbjct: 122 AALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQV 181

Query: 179 TSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
           T       F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P R
Sbjct: 182 TPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPER 241

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
           TG   +    D  +LL +R  + L  G+   P  A   +    +         N      
Sbjct: 242 TGYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-IAADNLTQLTA 299

Query: 299 ITHTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
             HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 300 FRHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 359


>gi|324115024|gb|EGC08989.1| A/G-specific adenine glycosylase [Escherichia fergusonii B253]
          Length = 355

 Score =  252 bits (642), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 110/360 (30%), Positives = 173/360 (48%), Gaps = 16/360 (4%)

Query: 2   PQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
                   +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PY
Sbjct: 5   TMQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPY 56

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           F++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   + +
Sbjct: 57  FERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFDEV 116

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKI 178
             LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++
Sbjct: 117 AALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQV 176

Query: 179 TSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
           T       F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P R
Sbjct: 177 TPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPER 236

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
           TG   +    D  +LL +R  + L  G+   P  A   +    +         N      
Sbjct: 237 TGYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-IAADNLTQLTA 294

Query: 299 ITHTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
             HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 295 FRHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 354


>gi|300929956|ref|ZP_07145394.1| A/G-specific adenine glycosylase [Escherichia coli MS 187-1]
 gi|300462132|gb|EFK25625.1| A/G-specific adenine glycosylase [Escherichia coli MS 187-1]
          Length = 350

 Score =  252 bits (642), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 173/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIATANNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLREWLAQRQ-IAADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEDNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|323966478|gb|EGB61911.1| A/G-specific adenine glycosylase [Escherichia coli M863]
          Length = 355

 Score =  252 bits (642), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 110/360 (30%), Positives = 172/360 (47%), Gaps = 16/360 (4%)

Query: 2   PQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
                   +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PY
Sbjct: 5   TMQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPY 56

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           F++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   + +
Sbjct: 57  FERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFDEV 116

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKI 178
             LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++
Sbjct: 117 AALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQV 176

Query: 179 TSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
           T       F QAMMDLGA+ICT +KP C LCP+Q  C+        L      K+  P R
Sbjct: 177 TPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAVNNSWSLYPGKKPKQTLPER 236

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
           TG   +    D  +LL +R  + L  G+   P  A   +    +         N      
Sbjct: 237 TGYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-ISADNLTQLTA 294

Query: 299 ITHTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
             HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 295 FRHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 354


>gi|294139801|ref|YP_003555779.1| A/G-specific adenine glycosylase [Shewanella violacea DSS12]
 gi|293326270|dbj|BAJ01001.1| A/G-specific adenine glycosylase [Shewanella violacea DSS12]
          Length = 361

 Score =  252 bits (642), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 109/353 (30%), Positives = 172/353 (48%), Gaps = 18/353 (5%)

Query: 7   IIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
              S+I++WY+   R  LPW+           +PYKVW+SEIMLQQT V TV PY+ KFM
Sbjct: 13  SFSSRIINWYEQFGRKHLPWQQD--------KTPYKVWVSEIMLQQTQVSTVIPYYLKFM 64

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
            ++PTI  L+ A  +E+L  W GLGYY RARNL K A +I  +++  FP   E +  LPG
Sbjct: 65  DRFPTIDSLADAPQDEVLHYWTGLGYYARARNLHKSAQLIRDEHDSTFPRDFEDVLSLPG 124

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTSR 183
           IG  TA A++++A      ++D N++R+++R+  I            + +   K+T    
Sbjct: 125 IGRSTAGAVLSLALAQHHAILDGNVKRVLARHGAIDGWPGKKPVENKLWDLTEKLTPNLD 184

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVF 243
              + QAMMD+GA IC+ ++P+C  CP+  +C     G+         KK  P +   + 
Sbjct: 185 VQKYNQAMMDIGASICSRSRPICSDCPVAIDCQAQLSGRQSEYPGKKPKKVIPEKNAYML 244

Query: 244 IAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTF 303
           + +  D  ++L KR    +  G+   P  +     D  + T         IL     HTF
Sbjct: 245 VQVKGDE-VILEKRPPAGIWGGLWCFPQFSTREELDEYLITKGLAVFEEEILPG-FRHTF 302

Query: 304 THFTLTLFVWKTIV-----PQIVIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
           +HF L +      V       ++    S W++  +     L    ++ L++ G
Sbjct: 303 SHFHLDISPILVSVEGFSDNLVMEDKPSLWYNLPHPPKVGLAAATERILASLG 355


>gi|157162423|ref|YP_001459741.1| adenine DNA glycosylase [Escherichia coli HS]
 gi|188492096|ref|ZP_02999366.1| A/G-specific adenine glycosylase [Escherichia coli 53638]
 gi|157068103|gb|ABV07358.1| A/G-specific adenine glycosylase [Escherichia coli HS]
 gi|188487295|gb|EDU62398.1| A/G-specific adenine glycosylase [Escherichia coli 53638]
          Length = 360

 Score =  252 bits (642), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 111/360 (30%), Positives = 173/360 (48%), Gaps = 16/360 (4%)

Query: 2   PQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
                   +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PY
Sbjct: 10  TMQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPY 61

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           F++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E +
Sbjct: 62  FERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEV 121

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKI 178
             LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++
Sbjct: 122 AALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQV 181

Query: 179 TSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
           T       F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P R
Sbjct: 182 TPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWALYPGKKPKQTLPER 241

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
           TG   +    D  +LL +R  + L  G+   P  A   +    +         N      
Sbjct: 242 TGYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-IAADNLTQLTA 299

Query: 299 ITHTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
             HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 300 FRHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 359


>gi|119775623|ref|YP_928363.1| A/G-specific adenine glycosylase [Shewanella amazonensis SB2B]
 gi|119768123|gb|ABM00694.1| A/G-specific DNA-adenine glycosylase [Shewanella amazonensis SB2B]
          Length = 368

 Score =  252 bits (642), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 108/352 (30%), Positives = 172/352 (48%), Gaps = 19/352 (5%)

Query: 8   IQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
              +I+ WYD + R  LPW+ +         +PYKVW+SEIMLQQT V TV PYF++FM 
Sbjct: 10  FGKRIVLWYDKHGRKSLPWQQN--------KTPYKVWVSEIMLQQTQVATVIPYFERFMA 61

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
            +PT+  L++A ++E+L  W GLGYY RARNL K A +I  ++ G FP + + +  LPGI
Sbjct: 62  SFPTVNDLANAHEDEVLHHWTGLGYYARARNLHKAAQLIRDEHGGEFPTEFDAVLALPGI 121

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTSRP 184
           G  TA A+++++      ++D N++R+++R+  I            +      +T     
Sbjct: 122 GRSTAGAVLSLSLGQHHPILDGNVKRVLARHGAIEGWPGEKRVDTALWQLTEALTPKEDI 181

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA ICT ++P C  CP+  +C     G+         KK  P R G   +
Sbjct: 182 QKYNQAMMDMGANICTRSRPKCGECPVAIDCKAQLAGRQGEFPGKKPKKTIPAREG-WML 240

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFT 304
            +   N + L KR  + +  G+   P           ++ +      N  L +   HTF+
Sbjct: 241 ILQQANTVKLIKRPPSGIWGGLWCFPQFDSKQALHAFVEAN-GLDAENLTLLDGFRHTFS 299

Query: 305 HFTLTLFVWKTIVPQ------IVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           HF L +   K  +        I+    S W++     N  L    ++ L++ 
Sbjct: 300 HFHLDIQPVKLRLGSTQTEALIMEDNLSLWYNLLQGENLGLAAATERILASL 351


>gi|114046757|ref|YP_737307.1| A/G-specific DNA-adenine glycosylase [Shewanella sp. MR-7]
 gi|113888199|gb|ABI42250.1| A/G-specific DNA-adenine glycosylase [Shewanella sp. MR-7]
          Length = 372

 Score =  252 bits (642), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 105/371 (28%), Positives = 174/371 (46%), Gaps = 31/371 (8%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M        ++I++WYDT+ R  LPW+           +PY+VW+SEIMLQQT V TV P
Sbjct: 1   MKSTAS-FATRIVNWYDTHGRKTLPWQQD--------KTPYRVWVSEIMLQQTQVATVIP 51

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           Y+++FM ++P +  L++A D+E+L  W GLGYY RARNL K A ++   ++G FP   E 
Sbjct: 52  YYQRFMARFPDVLALANAPDDEVLHHWTGLGYYARARNLHKAAKLVRDLHQGQFPTDFEQ 111

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARK 177
           +  LPGIG  TA A+++++      ++D N++R+++R+  I          + +     +
Sbjct: 112 VLALPGIGRSTAGAVLSLSLGQHHPILDGNVKRVLARHGAIAGWPGQKPVEEQLWQLTEQ 171

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T       + QAMMD+GA ICT +KP C  CP+  +C     G+          KK   
Sbjct: 172 LTPEQDIQKYNQAMMDIGASICTRSKPNCAACPVAVDCKAQLMGRQTDFPGKK-PKKTIP 230

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
              A  + +  DN++ L KR    +  G+   P  +  +  +  ++       A      
Sbjct: 231 EKAAWMLVLLKDNQVFLAKRPPAGIWGGLWCFPEFSTQAALNAELEAQ-GYHAAQLEPLI 289

Query: 298 TITHTFTHFTLTLFVWKTIVPQ-----------------IVIIPDSTWHDAQNLANAALP 340
              HTF+HF L +      +                   ++    S W++    +   L 
Sbjct: 290 GFRHTFSHFHLDIQPMLLNLDSQANGYNKQTSGMQSVGAVMEQNQSLWYNINQPSKVGLA 349

Query: 341 TVMKKALSAGG 351
              ++ L+  G
Sbjct: 350 AATERVLANLG 360


>gi|331684592|ref|ZP_08385184.1| A/G-specific adenine glycosylase [Escherichia coli H299]
 gi|331078207|gb|EGI49413.1| A/G-specific adenine glycosylase [Escherichia coli H299]
          Length = 350

 Score =  252 bits (642), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 112/359 (31%), Positives = 177/359 (49%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PALGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIATANNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G  F+ + +D+ +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 G-YFLLLQHDDEVLLAQRPPSGLWGGLYCFPQFADEESLRLWLAQRQ-IAADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEDNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|170734142|ref|YP_001766089.1| A/G-specific adenine glycosylase [Burkholderia cenocepacia MC0-3]
 gi|169817384|gb|ACA91967.1| A/G-specific adenine glycosylase [Burkholderia cenocepacia MC0-3]
          Length = 368

 Score =  252 bits (642), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 105/362 (29%), Positives = 177/362 (48%), Gaps = 25/362 (6%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               ++++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+ +F
Sbjct: 18  RTFATRLVAWQRAHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVIPYYTRF 69

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           + ++P +  L++A  +++++ WAGLGYY+RARNL +CA ++V ++ G FP   + L +LP
Sbjct: 70  LDRFPDVAALAAAPSDDVMALWAGLGYYSRARNLHRCAQVVVAEHGGVFPATPDALAELP 129

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITS-- 180
           GIG  TA+AI + A+   A ++D N++R+++R F +            +   A  +    
Sbjct: 130 GIGRSTAAAIASFAYGARATILDGNVKRVLARVFGVEGFPGEKRVENDMWALAESLLPDA 189

Query: 181 --TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
              +    + Q +MDLGA +C   KP C  CP   +C+  S G+   L     KK  P R
Sbjct: 190 ANPADVSAYTQGLMDLGATLCVRGKPDCARCPFAGDCVAQSTGRQRELPAARPKKAVPTR 249

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
                + + + + +LL +R  T +  G+  LP +   +      +          +    
Sbjct: 250 KT-WMLVLRDGDAVLLERRPPTGIWGGLWSLPQADGDAAL---AELARGFGGGGTVPLAP 305

Query: 299 ITHTFTHFTLTLFVWKTI------VPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGI 352
           +THTFTHF L +    +       +P  V   D+ W     L    +P  ++K L A   
Sbjct: 306 LTHTFTHFRLEIEPRLSDLADGGGLPSQVRDADTAWVPLSRLDAYGVPAPVRKLLDALSG 365

Query: 353 KV 354
            +
Sbjct: 366 PL 367


>gi|291612898|ref|YP_003523055.1| A/G-specific adenine glycosylase [Sideroxydans lithotrophicus ES-1]
 gi|291583010|gb|ADE10668.1| A/G-specific adenine glycosylase [Sideroxydans lithotrophicus ES-1]
          Length = 353

 Score =  252 bits (642), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 114/356 (32%), Positives = 189/356 (53%), Gaps = 18/356 (5%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
           +   S+++ W + + R  LPW+             Y+VW+SEIMLQQT V TV PY+++F
Sbjct: 2   NTFASRLIAWQNKHGRHDLPWQ---------GQDAYRVWLSEIMLQQTQVATVIPYYQRF 52

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           +  +P++  L++A ++++L+ W+GLGYY R RNL K A IIV+K+ G+FPHK E + +LP
Sbjct: 53  VAAFPSVAALAAASEDDVLAHWSGLGYYARGRNLHKAARIIVEKFNGSFPHKFEDIVELP 112

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTS 182
           GIG  TA+A+ A+A++    ++D N++R+++RY  I          + +   A  +    
Sbjct: 113 GIGRSTAAAVCALAYHERRAILDGNVKRVLARYCGIAGWSGDKKVEEKLWQQAEALLPPQ 172

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
               + QA+MD+GA +CT +KP C LCP+Q +C+     +   L     +K  P R+   
Sbjct: 173 DVATYTQALMDMGATVCTRSKPKCVLCPVQGDCVALQSDRVAELPSPRPRKAVPERSAVF 232

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHT 302
            + + + N ILL KR  + +  G+   P              +     +     +T THT
Sbjct: 233 LL-LMHGNDILLEKRPGSGIWGGLWCPPQFEDEDAARDWFVRN-GMEASEGERLDTFTHT 290

Query: 303 FTHFTLTLFVWKTIVPQIVII---PDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
           FTHF L +   +  + +  ++   P + W D      AA+PT ++K LS     +P
Sbjct: 291 FTHFKLHITPLRVELARKPLLAAQPGAVWLDVGEALGAAIPTPVRKVLSVLS-PLP 345


>gi|331648717|ref|ZP_08349805.1| A/G-specific adenine glycosylase [Escherichia coli M605]
 gi|331042464|gb|EGI14606.1| A/G-specific adenine glycosylase [Escherichia coli M605]
          Length = 355

 Score =  252 bits (642), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 112/360 (31%), Positives = 174/360 (48%), Gaps = 16/360 (4%)

Query: 2   PQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
                   +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PY
Sbjct: 5   TMQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPY 56

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           F++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP  VE +
Sbjct: 57  FERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVAALHGGKFPETVEEV 116

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKI 178
             LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++
Sbjct: 117 AALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQV 176

Query: 179 TSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
           T       F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P R
Sbjct: 177 TPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPER 236

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
           TG   +    D  +LL +R  + L  G+   P  A   +    +         N      
Sbjct: 237 TGYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-ISADNLTQLTA 294

Query: 299 ITHTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
             HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 295 FRHTFSHFHLDIVPMWLPVSSFTGCMDEDNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 354


>gi|221211198|ref|ZP_03584177.1| A/G-specific adenine glycosylase [Burkholderia multivorans CGD1]
 gi|221168559|gb|EEE01027.1| A/G-specific adenine glycosylase [Burkholderia multivorans CGD1]
          Length = 370

 Score =  252 bits (642), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 104/364 (28%), Positives = 174/364 (47%), Gaps = 27/364 (7%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
                +++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+ +F
Sbjct: 18  RTFAPRLIAWQRQHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVVPYYTRF 69

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           ++++P +  L++A  +++++ WAGLGYY+RARNL +CA ++V ++ G FP   + L +LP
Sbjct: 70  LERYPDVAALAAAPIDDVMALWAGLGYYSRARNLHRCAQVVVAEHGGAFPATPDALAELP 129

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTS 182
           GIG  TA+AI + A+   A ++D N++R+++R F I            +   A  +   +
Sbjct: 130 GIGRSTAAAIASFAYGARATILDGNVKRVLARVFGIEGFPGEKRVENDMWALAESLLPDA 189

Query: 183 RPGD----FVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
              D    + Q +MDLGA +C   KP C  CP   +C+  + G+   L     KK  P R
Sbjct: 190 AHADDVSAYTQGLMDLGATLCVRGKPDCARCPFAGDCVAQATGRQRELPAARPKKAVPTR 249

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
                + + + + +LL +R    +  G+  LP +   +                 +    
Sbjct: 250 KT-WMLVLRDGDAVLLERRPPAGIWGGLWSLPQADGDAELADLARRFGGGGP---VPLAP 305

Query: 299 ITHTFTHFTLTLFVWKTIVPQIVI--------IPDSTWHDAQNLANAALPTVMKKALSAG 350
           +THTFTHF L +    + V               D+ W     L    +P  ++K L A 
Sbjct: 306 LTHTFTHFRLEIEPRLSDVASEAAAVPIAQAQDADTAWVPLSALDTYGVPAPVRKLLDAL 365

Query: 351 GIKV 354
              +
Sbjct: 366 SGPL 369


>gi|188582616|ref|YP_001926061.1| A/G-specific adenine glycosylase [Methylobacterium populi BJ001]
 gi|179346114|gb|ACB81526.1| A/G-specific adenine glycosylase [Methylobacterium populi BJ001]
          Length = 404

 Score =  252 bits (642), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 149/351 (42%), Positives = 189/351 (53%), Gaps = 10/351 (2%)

Query: 9   QSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKW 68
            + +L WYD + R LPWR  P       P PY+VW+SE+MLQQTTV  V+PYF+KF+  +
Sbjct: 6   AADLLAWYDRHRRALPWRALP----GEQPDPYRVWLSEVMLQQTTVTAVKPYFQKFLTLF 61

Query: 69  PTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGD 128
           P++  L++A +E ++SAWAGLGYY+RARNL  CA        G FP   + L+KLPGIG 
Sbjct: 62  PSVTALAAAPEEAVMSAWAGLGYYSRARNLHACAK--AVAAAGAFPDTEDGLRKLPGIGA 119

Query: 129 YTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFV 188
           YTA AI AIAF+  A  VD N+ER++SR   I  P P     I+ + + +    RPGDF 
Sbjct: 120 YTAGAIAAIAFDRPAAAVDGNVERVMSRLHAIETPLPAARAQIRLFTQALVPDRRPGDFA 179

Query: 189 QAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAIT- 247
           QA+MDLGA +CT  +P C LCP    C   +EG          K+K  +R GA F+A+  
Sbjct: 180 QALMDLGATLCTPKRPACALCPWMLPCRARAEGLQDTFPRKVKKEKGVLRKGAAFVALRA 239

Query: 248 NDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILC-NTITHTFTHF 306
            D  ILLR R    LL  M E P S W    D       AP  A W      + H FTHF
Sbjct: 240 GDEAILLRTRPAEGLLGAMAEPPTSEWLPDYDPAKGLLDAPLDARWKRLPGVVKHGFTHF 299

Query: 307 TLTLFVWKTIVPQIVIIPDS-TWHDAQNLANAALPTVMKKALS-AGGIKVP 355
            L L V+   V      PD   +     L    LP  MKK L+ A    VP
Sbjct: 300 PLELTVFLARVAADTKPPDGMRFTPRAALDTEPLPGAMKKVLAHALAGPVP 350


>gi|119505483|ref|ZP_01627555.1| A/G-specific adenine glycosylase MutY [marine gamma proteobacterium
           HTCC2080]
 gi|119458592|gb|EAW39695.1| A/G-specific adenine glycosylase MutY [marine gamma proteobacterium
           HTCC2080]
          Length = 349

 Score =  252 bits (642), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 109/353 (30%), Positives = 177/353 (50%), Gaps = 15/353 (4%)

Query: 7   IIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
              S++LDW+D + R  LPW+ S         + Y+VW+SEIMLQQT V+TV PYF +F+
Sbjct: 3   SFASRLLDWFDLHGRHDLPWQKS--------KTAYRVWLSEIMLQQTQVQTVIPYFDRFL 54

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
            ++P++  L++A ++++L  W GLGYY RARNL + A ++V  + G FP  ++ L +LPG
Sbjct: 55  TRFPSVEDLAAAPEDDVLHLWTGLGYYARARNLHRAAKLVVSDFGGQFPQDLDGLLQLPG 114

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTSR 183
           +G  TA AI+++A    A ++D N++R+++R+  +            +   A + T T+R
Sbjct: 115 VGRSTAGAILSLAMGIRAPILDGNVKRVLARHDVVSGWPGTTTTLNKLWALAEEYTPTAR 174

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVF 243
             D+ Q +MDLGA +CT + P C  CP+   C   S  +         +K  P R     
Sbjct: 175 VADYTQGIMDLGATLCTRSAPGCQHCPLTNTCQARSRCEQAHFPGKKPRKTLPERETYFV 234

Query: 244 IAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTF 303
           I    D  +L+ KR    +  G+   P S        ++ T  A      I  + I H+F
Sbjct: 235 IFQRPDGTVLMEKRPEQGIWGGLWCFPESQDGDASPAHLATMRASAQEPTIYLDPIKHSF 294

Query: 304 THFTLTLFVWKTIVPQIVII----PDSTWHDAQNLANAALPTVMKKALSAGGI 352
           +H+ LT+      + +          S W D Q   +  LP  + + L    +
Sbjct: 295 SHYRLTIRPILLKIIRASEGVAEVNSSQWIDPQTPGSIGLPVPVTQVLKTLAL 347


>gi|107023730|ref|YP_622057.1| A/G-specific adenine glycosylase [Burkholderia cenocepacia AU 1054]
 gi|116690817|ref|YP_836440.1| A/G-specific adenine glycosylase [Burkholderia cenocepacia HI2424]
 gi|105893919|gb|ABF77084.1| A/G-specific DNA-adenine glycosylase [Burkholderia cenocepacia AU
           1054]
 gi|116648906|gb|ABK09547.1| A/G-specific DNA-adenine glycosylase [Burkholderia cenocepacia
           HI2424]
          Length = 368

 Score =  251 bits (641), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 104/362 (28%), Positives = 176/362 (48%), Gaps = 25/362 (6%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               ++++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+ +F
Sbjct: 18  RTFATRLVAWQRAHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVIPYYTRF 69

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           + ++P +  L++A  +++++ WAGLGYY+RARNL +CA ++V ++ G FP   + L +LP
Sbjct: 70  LDRFPDVAALAAAPSDDVMALWAGLGYYSRARNLHRCAQVVVAEHGGVFPATPDALAELP 129

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITS-- 180
           GIG  TA+AI + A+   A ++D N++R+++R F +            +   A  +    
Sbjct: 130 GIGRSTAAAIASFAYGARATILDGNVKRVLARVFGVEGFPGEKRVENDMWALAESLLPDA 189

Query: 181 --TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
              +    + Q +MDLGA +C   KP C  CP   +C+  S G+   L     KK  P R
Sbjct: 190 ANPADVSAYTQGLMDLGATLCVRGKPDCARCPFAGDCVAQSTGRQRELPAARPKKAVPTR 249

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
                + + + + +LL +R  T +  G+  LP +   +      +          +    
Sbjct: 250 KT-WMLVLRDGDAVLLERRPPTGIWGGLWSLPQADGDAAL---AELARGFGGGGTVPLAP 305

Query: 299 ITHTFTHFTLTLFVWKTI------VPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGI 352
           +THTFTHF L +    +       +P      D+ W     L    +P  ++K L A   
Sbjct: 306 LTHTFTHFRLEIEPRLSDLADGGGLPSQARDADTAWVPLSRLDAYGVPAPVRKLLDALSG 365

Query: 353 KV 354
            +
Sbjct: 366 PL 367


>gi|331643655|ref|ZP_08344786.1| A/G-specific adenine glycosylase [Escherichia coli H736]
 gi|323941953|gb|EGB38132.1| A/G-specific adenine glycosylase [Escherichia coli E482]
 gi|331037126|gb|EGI09350.1| A/G-specific adenine glycosylase [Escherichia coli H736]
          Length = 355

 Score =  251 bits (641), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 111/360 (30%), Positives = 173/360 (48%), Gaps = 16/360 (4%)

Query: 2   PQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
                   +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PY
Sbjct: 5   TMQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPY 56

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           F++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E +
Sbjct: 57  FERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEV 116

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKI 178
             LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++
Sbjct: 117 AALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQV 176

Query: 179 TSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
           T       F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P R
Sbjct: 177 TPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWALYPGKKPKQTLPER 236

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
           TG   +    D  +LL +R  + L  G+   P  A   +    +         N      
Sbjct: 237 TGYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-IAADNLTQLTA 294

Query: 299 ITHTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
             HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 295 FRHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 354


>gi|300925038|ref|ZP_07140957.1| A/G-specific adenine glycosylase [Escherichia coli MS 182-1]
 gi|300937422|ref|ZP_07152250.1| A/G-specific adenine glycosylase [Escherichia coli MS 21-1]
 gi|300418812|gb|EFK02123.1| A/G-specific adenine glycosylase [Escherichia coli MS 182-1]
 gi|300457524|gb|EFK21017.1| A/G-specific adenine glycosylase [Escherichia coli MS 21-1]
          Length = 350

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 112/359 (31%), Positives = 177/359 (49%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PALGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G  F+ + +D+ +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 G-YFLLLQHDDEVLLAQRPPSGLWGGLYCFPQFADEESLRLWLAQRQ-IAADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|112702912|emb|CAL34131.1| A/G-specific adenine glycosylase [Cronobacter sakazakii]
          Length = 361

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 101/351 (28%), Positives = 162/351 (46%), Gaps = 16/351 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                   ++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 2   MQAQQFSRQVLDWYDKYGRKTLPWQQ--------EKTPYKVWLSEVMLQQTQVTTVIPYF 53

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++P +  L++A  +++L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 54  ERFMARFPDVTALANAPLDDVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVA 113

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPG+G  TA A+++++      ++D N++R+++R + +            +   +  +T
Sbjct: 114 ALPGVGRSTAGAVLSLSLGKHFPILDGNVKRVLARCYAVEGWPGKKEVENRLWQISETVT 173

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
            T     F QAMMDLGA++CT +KP C +CP+   C  F+            K+  P   
Sbjct: 174 PTEGVARFNQAMMDLGAMVCTRSKPKCEICPLNNGCEAFAHQSYAKYPGKKPKQTLPE-K 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
              F+ + ++  + L++R    L  G+   P     +     +                 
Sbjct: 233 TGYFLLLQHEGSLFLQQRPPVGLWGGLYCFPQFESETALREWLSARGINDDG-LTQLTAF 291

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKAL 347
            HTF+HF L +      V Q     D     W++        L   +++ L
Sbjct: 292 RHTFSHFHLDIVPMWLGVQQAAACMDEASGLWYNLAQPPAVGLAAPVERLL 342


>gi|83721272|ref|YP_441037.1| A/G-specific adenine glycosylase [Burkholderia thailandensis E264]
 gi|167617844|ref|ZP_02386475.1| A/G-specific adenine glycosylase [Burkholderia thailandensis Bt4]
 gi|257140310|ref|ZP_05588572.1| A/G-specific adenine glycosylase [Burkholderia thailandensis E264]
 gi|83655097|gb|ABC39160.1| A/G-specific adenine glycosylase [Burkholderia thailandensis E264]
          Length = 368

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 101/361 (27%), Positives = 171/361 (47%), Gaps = 25/361 (6%)

Query: 7   IIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
                ++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+ +F+
Sbjct: 19  AFAPTLIAWQRKHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVVPYYVRFL 70

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
           +++P +  L++A  +++++ WAGLGYY+RARNL +CA  +V+++ G FP   E L +LPG
Sbjct: 71  ERYPDVAALAAAPIDDVMALWAGLGYYSRARNLHRCAQAVVERHGGAFPAAPEALAELPG 130

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITS--- 180
           IG  TA+AI + AF   A ++D N++R+++R F +            +   A  +     
Sbjct: 131 IGRSTAAAIASFAFGARATILDGNVKRVLARVFGVEGFPGEKRVENEMWALAEALLPDAA 190

Query: 181 -TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             +    + Q +MDLGA +C   KP C  CP   +C+    G+   L     KK  P R 
Sbjct: 191 GQADVTAYTQGLMDLGATLCVRGKPDCARCPFAGDCVAERSGRQRELPAARPKKAVPTRR 250

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
               + + + + +LL++R    +  G+  LP +                   + +   ++
Sbjct: 251 T-WMLVLRDGDAVLLQRRPPAGIWGGLWSLPEADGDMALARRAREFGG---VSLVPLASL 306

Query: 300 THTFTHFTLTLFVWKTIVP------QIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIK 353
           THTFTHF L +      +             ++ W     L    +P  ++K L      
Sbjct: 307 THTFTHFKLEIEPRLADLDGAAGGVSPAADDETAWVSLDKLDAYGVPAPVRKLLDGLSGA 366

Query: 354 V 354
           +
Sbjct: 367 L 367


>gi|117919630|ref|YP_868822.1| A/G-specific DNA-adenine glycosylase [Shewanella sp. ANA-3]
 gi|117611962|gb|ABK47416.1| A/G-specific DNA-adenine glycosylase [Shewanella sp. ANA-3]
          Length = 372

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 106/371 (28%), Positives = 175/371 (47%), Gaps = 31/371 (8%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M        ++I++WYDT+ R  LPW+           +PY+VW+SEIMLQQT V TV P
Sbjct: 1   MKSTAS-FATRIVNWYDTHGRKTLPWQQD--------KTPYRVWVSEIMLQQTQVATVIP 51

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           Y+++FM ++P +  L++A D+E+L  W GLGYY RARNL K A ++   Y+G FP   E 
Sbjct: 52  YYQRFMARFPDVLALANAPDDEVLHHWTGLGYYARARNLHKAAKMVRDLYQGQFPTDFEQ 111

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARK 177
           +  LPGIG  TA A+++++      ++D N++R+++R+  I          + +     +
Sbjct: 112 VLALPGIGRSTAGAVLSLSLGQHHPILDGNVKRVLARHGAIAGWPGQKPVEEQLWQLTEQ 171

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T       + QAMMD+GA ICT +KP C  CP+  +C     G+          KK   
Sbjct: 172 LTPEQDIQKYNQAMMDIGASICTRSKPNCAACPVAIDCKAQLMGRQTEFPGKK-PKKTIP 230

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
              A  + +  DN++ L KR    +  G+   P  +  +  +  ++       A      
Sbjct: 231 EKAAWMLVLLKDNQVFLAKRPPAGIWGGLWCFPEFSTQAALNAELEAQ-GYHAAQLEPLI 289

Query: 298 TITHTFTHFTLTLFVWKTIVPQ-----------------IVIIPDSTWHDAQNLANAALP 340
              HTF+HF L +      +                   ++    S W++    +   L 
Sbjct: 290 GFRHTFSHFHLDIQPMLLNLDSQANGYDKQTLGMQSVGAVMEQNQSLWYNINQPSKVGLA 349

Query: 341 TVMKKALSAGG 351
           +  ++ L+  G
Sbjct: 350 SATERVLANLG 360


>gi|293416222|ref|ZP_06658862.1| A/G-specific adenine glycosylase [Escherichia coli B185]
 gi|291432411|gb|EFF05393.1| A/G-specific adenine glycosylase [Escherichia coli B185]
          Length = 350

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 173/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PDIGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAATNNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-IAADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|229543139|ref|ZP_04432199.1| A/G-specific adenine glycosylase [Bacillus coagulans 36D1]
 gi|229327559|gb|EEN93234.1| A/G-specific adenine glycosylase [Bacillus coagulans 36D1]
          Length = 372

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 119/352 (33%), Positives = 170/352 (48%), Gaps = 18/352 (5%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               Q  ++ W++   R LPWR            PYK+W+SEIMLQQT V TV PYF++F
Sbjct: 11  IKSFQDDLISWFEREQRKLPWRED--------RDPYKIWVSEIMLQQTRVDTVIPYFRRF 62

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M+K+PTI  L+ A ++E+L AW GLGYY+R RNL      + + Y G  P   E + KL 
Sbjct: 63  MEKFPTIEALADASEDEVLKAWEGLGYYSRVRNLHAAVKEVEEHYGGTVPDTPEEVSKLK 122

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTS 182
           G+G YTA AI++IA+      VD N+ R+++R   I +    P   K  +   RK+ S  
Sbjct: 123 GVGPYTAGAILSIAYGLPEPAVDGNVMRVLARILSIWEDIAKPSARKVFEEVVRKLISRE 182

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
            P  F QA+M+LGAL+CT   P C LCP++++C  F EG    L + +  KK+       
Sbjct: 183 NPSFFNQALMELGALVCTPKSPSCLLCPVREHCRAFREGTIDELPVKSKGKKQKQIRLQA 242

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSS-------TKDGNIDTHSAPFTANWIL 295
            +    D RIL+ KR +  LL  M E      S+        KD   D            
Sbjct: 243 AVLEDEDGRILIHKRPDKGLLANMWEFVQVEESTVLPARQVLKDYLGDVFKIEAALETEH 302

Query: 296 CNTITHTFTHFTLTLFVWKTI-VPQIVIIPDSTWHDAQNLANAALPTVMKKA 346
              I H FTH    + V++   + Q+    +        +   A P   +K 
Sbjct: 303 FTEIRHVFTHLIWDIRVYRGKIINQVQETNELKCVPPDEIETFAFPVPHQKI 354


>gi|320195081|gb|EFW69710.1| A/G-specific adenine glycosylase [Escherichia coli WV_060327]
          Length = 350

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 172/359 (47%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVAALHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A        +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEEGLRQWLAQRQ-ISADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEDNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|161523698|ref|YP_001578710.1| A/G-specific adenine glycosylase [Burkholderia multivorans ATCC
           17616]
 gi|189351538|ref|YP_001947166.1| A/G-specific adenine glycosylase [Burkholderia multivorans ATCC
           17616]
 gi|160341127|gb|ABX14213.1| A/G-specific adenine glycosylase [Burkholderia multivorans ATCC
           17616]
 gi|189335560|dbj|BAG44630.1| A/G-specific adenine glycosylase [Burkholderia multivorans ATCC
           17616]
          Length = 370

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 104/364 (28%), Positives = 173/364 (47%), Gaps = 27/364 (7%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
                +++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+ +F
Sbjct: 18  RTFAPRLIAWQRQHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVVPYYTRF 69

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           ++++P +  L++A  +++++ WAGLGYY+RARNL +CA ++V ++ G FP   + L  LP
Sbjct: 70  LERYPDVAALAAAPIDDVMALWAGLGYYSRARNLHRCAQVVVAEHGGAFPATPDALADLP 129

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTS 182
           GIG  TA+AI + A+   A ++D N++R+++R F I            +   A  +   +
Sbjct: 130 GIGRSTAAAIASFAYGARATILDGNVKRVLARVFGIEGFPGEKRVENDMWALAESLLPDA 189

Query: 183 RPGD----FVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
              D    + Q +MDLGA +C   KP C  CP   +C+  + G+   L     KK  P R
Sbjct: 190 AHPDDVSAYTQGLMDLGATLCVRGKPDCARCPFAGDCVAQATGRQRELPAARPKKAVPTR 249

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
                + + + + +LL +R    +  G+  LP +   +                 +    
Sbjct: 250 KT-WMLVLRDGDAVLLERRPPAGIWGGLWSLPQADGDAELADLARRFGGGGP---VPLAP 305

Query: 299 ITHTFTHFTLTLFVWKTIVPQIVI--------IPDSTWHDAQNLANAALPTVMKKALSAG 350
           +THTFTHF L +    + V               D+ W     L    +P  ++K L A 
Sbjct: 306 LTHTFTHFRLEIEPRLSDVASEAAAVPFAQAQDADTAWVPLSALDTYGVPAPVRKLLDAL 365

Query: 351 GIKV 354
              +
Sbjct: 366 SGPL 369


>gi|113969524|ref|YP_733317.1| A/G-specific DNA-adenine glycosylase [Shewanella sp. MR-4]
 gi|113884208|gb|ABI38260.1| A/G-specific DNA-adenine glycosylase [Shewanella sp. MR-4]
          Length = 372

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 105/365 (28%), Positives = 173/365 (47%), Gaps = 30/365 (8%)

Query: 7   IIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
              ++I++WYD + R  LPW+           +PY+VW+SEIMLQQT V TV PY+++FM
Sbjct: 6   TFATRIVNWYDNHGRKTLPWQQD--------KTPYRVWVSEIMLQQTQVATVIPYYQRFM 57

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
            ++P +  L++A D+E+L  W GLGYY RARNL K A ++   Y+G FP   E +  LPG
Sbjct: 58  ARFPDVLTLANAPDDEVLHHWTGLGYYARARNLHKAAKMVRDLYQGQFPTDFEQVLALPG 117

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSR 183
           IG  TA A+++++      ++D N++R+++R+  I          + +     ++T    
Sbjct: 118 IGRSTAGAVLSLSLGQHHPILDGNVKRVLARHGAIAGWPGQKPVEEQLWQLTEQLTPGQD 177

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVF 243
              + QAMMD+GA ICT +KP C  CP+  +C     G+          KK      A  
Sbjct: 178 IQKYNQAMMDIGASICTRSKPNCAACPVAIDCKAQLMGRQTEFPGKK-PKKTIPEKAAWM 236

Query: 244 IAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTF 303
           + +  DN++ L KR    +  G+   P  +  +  +  ++T      A         HTF
Sbjct: 237 LVLLKDNQVFLAKRPPAGIWGGLWCFPEFSTQAALNAELETQ-GYHAAQLEPLIGFRHTF 295

Query: 304 THFTLTLFVWKTIVPQ-----------------IVIIPDSTWHDAQNLANAALPTVMKKA 346
           +HF L +      +                   ++    S W++    +   L    ++ 
Sbjct: 296 SHFHLDIQPMLLNLDSQANGYDKQTSAMQSVGAVMEQNQSLWYNINQPSKVGLAAATERV 355

Query: 347 LSAGG 351
           L+  G
Sbjct: 356 LANLG 360


>gi|157372277|ref|YP_001480266.1| adenine DNA glycosylase [Serratia proteamaculans 568]
 gi|157324041|gb|ABV43138.1| A/G-specific adenine glycosylase [Serratia proteamaculans 568]
          Length = 381

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 105/362 (29%), Positives = 164/362 (45%), Gaps = 16/362 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           +          +LDWY    R  LPW+           + YKVW+SE+MLQQT V TV P
Sbjct: 15  LMMQAQQFAQVVLDWYQRYGRKTLPWQ--------LDKTAYKVWLSEVMLQQTQVATVIP 66

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF++FM ++P +  L+ A  +E+L  W GLGYY RARNL K A  IV ++ G FP   E 
Sbjct: 67  YFERFMARFPNVRALAEAPLDEVLHLWTGLGYYARARNLHKAAQTIVAQHGGEFPTTFEE 126

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARK 177
           +  LPGIG  TA A++++A      ++D N++R+++R + +            +   +  
Sbjct: 127 IHALPGIGRSTAGAVLSLALGQHYPILDGNVKRVLARCYAVEGWPGKKEVENRLWQISED 186

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T     G F QAMMDLGA++CT +KP C LCP+   C+ ++            K+  P 
Sbjct: 187 VTPAQGVGQFNQAMMDLGAMVCTRSKPKCELCPLNLGCIAYAHHSWAKYPGKKPKQTLPE 246

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
              A F+ + +  R+ L +R    L  G+   P        +  +               
Sbjct: 247 -KTAYFLLLQHGERVWLEQRPAVGLWGGLFCFPQFGEREEMELWLQQRGLN-NNRQQQLT 304

Query: 298 TITHTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIKV 354
              HTF+HF L +      +       D     W++     +  L   + + L     + 
Sbjct: 305 AFRHTFSHFHLDIVPIWLEMNDAAASMDEGAGLWYNLAQPPSVGLAAPVDRLLQQLAKQS 364

Query: 355 PQ 356
           P+
Sbjct: 365 PR 366


>gi|295675409|ref|YP_003603933.1| A/G-specific adenine glycosylase [Burkholderia sp. CCGE1002]
 gi|295435252|gb|ADG14422.1| A/G-specific adenine glycosylase [Burkholderia sp. CCGE1002]
          Length = 377

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 105/364 (28%), Positives = 187/364 (51%), Gaps = 30/364 (8%)

Query: 2   PQPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
           P P+    ++++ W   + R  LPW+++          PY++W+SEIMLQQT V TV PY
Sbjct: 24  PMPD--FSARLIAWQRQHGRHDLPWQST--------RDPYRIWLSEIMLQQTQVSTVIPY 73

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           + KF+ ++P +  L++A  +++++ WAGLGYYTRARNL +CA ++V+++ G FP  V+ L
Sbjct: 74  YAKFLGRFPDVAALAAAPSDDVMALWAGLGYYTRARNLHRCAQVVVERHGGAFPVSVDEL 133

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKI 178
            +LPGIG  TA+AI + AF   A ++D N++R+++R F +            +   A  +
Sbjct: 134 AELPGIGRSTAAAIASFAFGARATILDGNVKRVLARVFGVEGFPGEKKVENSMWTLAESL 193

Query: 179 TSTSRPG----DFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKK 234
             ++        + Q +MDLGA +C   KP C  CP   +C+    G+   L     KK 
Sbjct: 194 LPSNASNAEVSAYTQGLMDLGATLCVRGKPDCTRCPFAPDCVANVTGRQRELPTARPKKA 253

Query: 235 RPMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWI 294
            P R     + + + N ++L +R  + +  G+  LP     +  +  +   +  F ++  
Sbjct: 254 VPTRRT-WMLVLRDGNAVMLERRPPSGIWGGLWSLP----EAADEATLAERARAFGSDGE 308

Query: 295 L--CNTITHTFTHFTLTLFVWKTIVPQ------IVIIPDSTWHDAQNLANAALPTVMKKA 346
           +    + +H FTHF L +      + +       +   D+ W    +L +  +P  ++K 
Sbjct: 309 VSALASFSHVFTHFKLDIEPRLAELDRDVGALAALNDADTAWVALSDLDSFGVPAPVRKL 368

Query: 347 LSAG 350
           L++ 
Sbjct: 369 LASL 372


>gi|89092426|ref|ZP_01165380.1| adenine glycosylase [Oceanospirillum sp. MED92]
 gi|89083514|gb|EAR62732.1| adenine glycosylase [Oceanospirillum sp. MED92]
          Length = 349

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 117/357 (32%), Positives = 185/357 (51%), Gaps = 18/357 (5%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  S +L+W+D + R  LPW+ +         + Y  WISE+MLQQT V TV PY+
Sbjct: 1   MQSKQFASAVLEWFDQHGRHDLPWQAN--------KTAYNTWISEVMLQQTQVTTVIPYY 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++F++++P +  L+SA+ +E+L  W GLGYY RARNL K A I+ +++ G FP  VE L+
Sbjct: 53  ERFIERFPNVESLASAEQDEVLHLWTGLGYYARARNLHKTAQIVTREHAGAFPETVEELE 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPGIG  TA A+++I+   +A ++D N++R+++R++ +          K + +YA + T
Sbjct: 113 ALPGIGRSTAGAVLSISTGKWAPILDGNVKRVLARFYALEGWPGTTANQKKLWSYAEQNT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHL-LGINTIKKKRPMR 238
              R GD+ QAMMDLGA +CT +KP C LCP+Q+ C     GK+         K     +
Sbjct: 173 PQQRVGDYTQAMMDLGATLCTRSKPSCLLCPLQQGCDALRLGKTDQLPEPKPKKSIPVKQ 232

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
           T  + +   + N +LL +R  T L  G+   P  A    +D   +T       +      
Sbjct: 233 TYMLLLQQDDSNEVLLYQRPPTGLWGGLWSFPQVA--DLRDTLNETGFELREESMQPLEP 290

Query: 299 ITHTFTHFTLTLFVWKTIVPQI----VIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
           + HTF+HF L +   +  V       +      W++ +   N  L   +KK L    
Sbjct: 291 MRHTFSHFHLDITPVRARVNTPTDSVMEGKPLLWYNIEQPENVGLAAPVKKLLEMMA 347


>gi|327251730|gb|EGE63416.1| A/G-specific adenine glycosylase [Escherichia coli STEC_7v]
          Length = 350

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 110/359 (30%), Positives = 172/359 (47%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   + + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFDEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+        L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAVNNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-ISADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|117625188|ref|YP_854176.1| adenine DNA glycosylase [Escherichia coli APEC O1]
 gi|218559952|ref|YP_002392865.1| adenine DNA glycosylase [Escherichia coli S88]
 gi|115514312|gb|ABJ02387.1| A/G-specific adenine glycosylase [Escherichia coli APEC O1]
 gi|218366721|emb|CAR04478.1| adenine DNA glycosylase [Escherichia coli S88]
 gi|294489833|gb|ADE88589.1| A/G-specific adenine glycosylase [Escherichia coli IHE3034]
 gi|307625464|gb|ADN69768.1| adenine DNA glycosylase [Escherichia coli UM146]
 gi|315289509|gb|EFU48904.1| A/G-specific adenine glycosylase [Escherichia coli MS 110-3]
 gi|323951601|gb|EGB47476.1| A/G-specific adenine glycosylase [Escherichia coli H252]
 gi|323957314|gb|EGB53036.1| A/G-specific adenine glycosylase [Escherichia coli H263]
          Length = 350

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 174/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R ++ L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPSSGLWGGLYCFPQFADEESLRQWLAQRQ-ISADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEDNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|293603175|ref|ZP_06685608.1| A/G specific adenine glycosylase [Achromobacter piechaudii ATCC
           43553]
 gi|292818406|gb|EFF77454.1| A/G specific adenine glycosylase [Achromobacter piechaudii ATCC
           43553]
          Length = 359

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 108/352 (30%), Positives = 167/352 (47%), Gaps = 19/352 (5%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
              +I+ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+++F++
Sbjct: 3   FAPRIVAWQRQHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVATVIPYYERFLE 54

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++P +  L++A  E+++  WAGLGYY RARNL +CA  I + + G FP   E +  LPGI
Sbjct: 55  RFPDVAALAAASQEDVMPYWAGLGYYARARNLHRCAVQIAQDWNGRFPPTAEAIATLPGI 114

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYH-----KTIKNYARKITST 181
           G  TA+AI A A+   + ++D N++R+ +R+F I               + +        
Sbjct: 115 GRSTAAAIAAFAYGERSPILDGNVKRVFTRHFGIAGDPAKREVETRLWALADAQVDAAPG 174

Query: 182 SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGA 241
                + Q +MDLGA +CT  KP C  CP+   C+   EG+   L    +++  P R   
Sbjct: 175 LDMAAYTQGLMDLGATLCTRGKPACERCPMADTCVARREGRQAELPTPKVRRAIPERET- 233

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITH 301
             + + +    LL++R    +  G+  LP    +   D                     H
Sbjct: 234 CMLVLQHQGAFLLQQRPEPGIWGGLWSLPEFDVAGDPDAASRAL-GLEPEQRFELAAFAH 292

Query: 302 TFTHFTLTLFVWKTIVPQIVIIPDS---TWHDAQNLANAALPTVMKKALSAG 350
           TFTH+ L +  W   V    +   S    W  A  LA+ ALP  +KK L   
Sbjct: 293 TFTHYRLHIRPWLVPVRAASLRESSVPERWVPADKLASMALPAPVKKLLQGL 344


>gi|220936105|ref|YP_002515004.1| A/G-specific DNA-adenine glycosylase [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219997415|gb|ACL74017.1| A/G-specific DNA-adenine glycosylase [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 348

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 105/357 (29%), Positives = 176/357 (49%), Gaps = 16/357 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                   ++L W+D + R  LPW+           +PY+VW+SEIMLQQT V TV PY+
Sbjct: 1   MSASDFSQRLLAWFDRHGRHDLPWQQD--------INPYRVWVSEIMLQQTQVGTVIPYY 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++P +  L+ A  +++L  W+GLGYY RARNL K A ++  ++ G FP  +E L+
Sbjct: 53  QRFMARFPDVASLADAPLDQVLHHWSGLGYYARARNLHKAAQVVRDQHGGRFPEDIEALQ 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKIT 179
            LPGIG  TA AI+A+A      ++D N++R+++R+  +       +  + +   A   T
Sbjct: 113 SLPGIGRSTAGAILALACGQRQPILDGNVKRVLARHRAVEGWSGETVVLRDLWCLAEAHT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              R  ++ QA+MDLGA +CT ++P C  CP+ ++C    EG++  L     K+ +P+R 
Sbjct: 173 PAERVAEYTQAIMDLGATVCTRSRPACGRCPVAEDCRARLEGRTGELPAPRPKRVQPLRE 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
               + +T    +LL +R    L  G+   P     ++                   N  
Sbjct: 233 T-CMLMVTTPEGVLLEQRPARGLWGGLWGFPEVDDEASALAWCRASLGLEPQRLEAWNPF 291

Query: 300 THTFTHFTLTLFVWKTIVPQI----VIIPDSTWHDAQNLANAALPTVMKKALSAGGI 352
            HTFTHF L +   +  +       +  P   W++ +  +   L   + + L    +
Sbjct: 292 IHTFTHFRLRITPLRVSLQDPAGCVMEAPGRVWYNTRTSSGLGLAAPVAQLLEKLDL 348


>gi|15803500|ref|NP_289533.1| adenine DNA glycosylase [Escherichia coli O157:H7 EDL933]
 gi|15833091|ref|NP_311864.1| adenine DNA glycosylase [Escherichia coli O157:H7 str. Sakai]
 gi|168747546|ref|ZP_02772568.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           EC4113]
 gi|168753914|ref|ZP_02778921.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           EC4401]
 gi|168766969|ref|ZP_02791976.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           EC4486]
 gi|168773399|ref|ZP_02798406.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           EC4196]
 gi|168781821|ref|ZP_02806828.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           EC4076]
 gi|168785820|ref|ZP_02810827.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           EC869]
 gi|168797537|ref|ZP_02822544.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           EC508]
 gi|195937100|ref|ZP_03082482.1| adenine DNA glycosylase [Escherichia coli O157:H7 str. EC4024]
 gi|208806341|ref|ZP_03248678.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208812668|ref|ZP_03253997.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208820767|ref|ZP_03261087.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209395967|ref|YP_002272442.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           EC4115]
 gi|217327769|ref|ZP_03443852.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           TW14588]
 gi|254794914|ref|YP_003079751.1| adenine DNA glycosylase [Escherichia coli O157:H7 str. TW14359]
 gi|261226274|ref|ZP_05940555.1| adenine DNA glycosylase [Escherichia coli O157:H7 str. FRIK2000]
 gi|261256468|ref|ZP_05949001.1| adenine DNA glycosylase [Escherichia coli O157:H7 str. FRIK966]
 gi|291284282|ref|YP_003501100.1| A/G-specific adenine glycosylase [Escherichia coli O55:H7 str.
           CB9615]
 gi|12517510|gb|AAG58092.1|AE005526_5 adenine glycosylase; G.C --> T.A transversions [Escherichia coli
           O157:H7 str. EDL933]
 gi|13363309|dbj|BAB37260.1| adenine glycosylase [Escherichia coli O157:H7 str. Sakai]
 gi|187770880|gb|EDU34724.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           EC4196]
 gi|188017895|gb|EDU56017.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           EC4113]
 gi|189000578|gb|EDU69564.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           EC4076]
 gi|189358556|gb|EDU76975.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           EC4401]
 gi|189363704|gb|EDU82123.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           EC4486]
 gi|189374187|gb|EDU92603.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           EC869]
 gi|189379791|gb|EDU98207.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           EC508]
 gi|208726142|gb|EDZ75743.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208733945|gb|EDZ82632.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208740890|gb|EDZ88572.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209157367|gb|ACI34800.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           EC4115]
 gi|209759948|gb|ACI78286.1| adenine glycosylase [Escherichia coli]
 gi|209759950|gb|ACI78287.1| adenine glycosylase [Escherichia coli]
 gi|209759952|gb|ACI78288.1| adenine glycosylase [Escherichia coli]
 gi|209759954|gb|ACI78289.1| adenine glycosylase [Escherichia coli]
 gi|209759956|gb|ACI78290.1| adenine glycosylase [Escherichia coli]
 gi|217320136|gb|EEC28561.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           TW14588]
 gi|254594314|gb|ACT73675.1| adenine DNA glycosylase [Escherichia coli O157:H7 str. TW14359]
 gi|290764155|gb|ADD58116.1| A/G-specific adenine glycosylase [Escherichia coli O55:H7 str.
           CB9615]
 gi|320189311|gb|EFW63970.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           EC1212]
 gi|320640608|gb|EFX10147.1| adenine DNA glycosylase [Escherichia coli O157:H7 str. G5101]
 gi|320645855|gb|EFX14840.1| adenine DNA glycosylase [Escherichia coli O157:H- str. 493-89]
 gi|320651155|gb|EFX19595.1| adenine DNA glycosylase [Escherichia coli O157:H- str. H 2687]
 gi|320662170|gb|EFX29571.1| adenine DNA glycosylase [Escherichia coli O55:H7 str. USDA 5905]
 gi|320667245|gb|EFX34208.1| adenine DNA glycosylase [Escherichia coli O157:H7 str. LSU-61]
 gi|326338950|gb|EGD62765.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           1044]
 gi|326343168|gb|EGD66936.1| A/G-specific adenine glycosylase [Escherichia coli O157:H7 str.
           1125]
          Length = 350

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 173/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAATNNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-IAADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|197336322|ref|YP_002155177.1| A/G-specific adenine glycosylase [Vibrio fischeri MJ11]
 gi|197317812|gb|ACH67259.1| A/G-specific adenine glycosylase [Vibrio fischeri MJ11]
          Length = 350

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 110/351 (31%), Positives = 166/351 (47%), Gaps = 18/351 (5%)

Query: 7   IIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
                IL+WYD   R  LPW+           +PYKVW+SEIMLQQT V TV PYF++FM
Sbjct: 3   SFSQAILEWYDNYGRKTLPWQ--------LEKTPYKVWLSEIMLQQTQVTTVIPYFERFM 54

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
            ++PTI  L+ A+ +E+L  W GLGYY RARNL K A II ++Y G FP  ++ +  LPG
Sbjct: 55  ARFPTIVDLAHAEQDEVLHLWTGLGYYARARNLHKTAQIIAEQYNGVFPTNIDDVIALPG 114

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTSR 183
           IG  TA A+++++      ++D N++R +SR F I            +   A   T    
Sbjct: 115 IGRSTAGAVLSLSLQQHHPILDGNVKRTLSRCFAIEGWPGKKSVENEMWAVAETHTPKQG 174

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVF 243
              + QAMMD+GA++CT +KP C LCP+   C   ++ +          KK      A F
Sbjct: 175 VERYNQAMMDMGAMVCTRSKPKCELCPVNDLCQAKAQDRQLDFPT-KKPKKEKPVKEAWF 233

Query: 244 IAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTF 303
               +D  + L +R  + +  G+   P     +     +        A+        HTF
Sbjct: 234 AIYYHDGEVWLEQRPQSGIWGGLFCFP--EQPTNTLDELSEDYGFKIASKQQLIAFRHTF 291

Query: 304 THFTLTLFVWKTIVPQ----IVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ L +      + +    I+      W++        L   ++K L A 
Sbjct: 292 SHYHLDITPVLITLAKKPNMIMEGTRGVWYNLSQPMTVGLAAPVQKLLDAL 342


>gi|74313630|ref|YP_312049.1| adenine DNA glycosylase [Shigella sonnei Ss046]
 gi|73857107|gb|AAZ89814.1| adenine glycosylase [Shigella sonnei Ss046]
          Length = 350

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 173/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKTKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-IAADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|157156921|ref|YP_001464315.1| adenine DNA glycosylase [Escherichia coli E24377A]
 gi|157078951|gb|ABV18659.1| A/G-specific adenine glycosylase [Escherichia coli E24377A]
          Length = 360

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 111/360 (30%), Positives = 173/360 (48%), Gaps = 16/360 (4%)

Query: 2   PQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
                   +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PY
Sbjct: 10  TMQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPY 61

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           F++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E +
Sbjct: 62  FERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEV 121

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKI 178
             LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++
Sbjct: 122 AALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQV 181

Query: 179 TSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
           T       F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P R
Sbjct: 182 TPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPER 241

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
           TG   +    D  +LL +R  + L  G+   P  A   +    +         N      
Sbjct: 242 TGYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-IAADNLTQLTA 299

Query: 299 ITHTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
             HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 300 FRHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 359


>gi|110643110|ref|YP_670840.1| adenine DNA glycosylase [Escherichia coli 536]
 gi|191171863|ref|ZP_03033409.1| A/G-specific adenine glycosylase [Escherichia coli F11]
 gi|218691085|ref|YP_002399297.1| adenine DNA glycosylase [Escherichia coli ED1a]
 gi|300995457|ref|ZP_07181105.1| A/G-specific adenine glycosylase [Escherichia coli MS 200-1]
 gi|306812134|ref|ZP_07446332.1| adenine DNA glycosylase [Escherichia coli NC101]
 gi|110344702|gb|ABG70939.1| A/G-specific adenine glycosylase [Escherichia coli 536]
 gi|190907898|gb|EDV67491.1| A/G-specific adenine glycosylase [Escherichia coli F11]
 gi|218428649|emb|CAR09578.2| adenine DNA glycosylase [Escherichia coli ED1a]
 gi|300304819|gb|EFJ59339.1| A/G-specific adenine glycosylase [Escherichia coli MS 200-1]
 gi|305854172|gb|EFM54610.1| adenine DNA glycosylase [Escherichia coli NC101]
 gi|324011811|gb|EGB81030.1| A/G-specific adenine glycosylase [Escherichia coli MS 60-1]
          Length = 350

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 173/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVAALHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-IAADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEDNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|323978744|gb|EGB73825.1| A/G-specific adenine glycosylase [Escherichia coli TW10509]
          Length = 350

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 110/359 (30%), Positives = 172/359 (47%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKSLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVAALHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  + L +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHKDE-VFLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-IAADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|330908995|gb|EGH37509.1| A/G-specific adenine glycosylase [Escherichia coli AA86]
          Length = 350

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 112/359 (31%), Positives = 174/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP  VE + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVAALHGGKFPETVEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-ISADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEDNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|256024529|ref|ZP_05438394.1| adenine DNA glycosylase [Escherichia sp. 4_1_40B]
          Length = 350

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 173/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-IAADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFIGCMDEDNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|82545416|ref|YP_409363.1| adenine DNA glycosylase [Shigella boydii Sb227]
 gi|209920421|ref|YP_002294505.1| adenine DNA glycosylase [Escherichia coli SE11]
 gi|256019233|ref|ZP_05433098.1| adenine DNA glycosylase [Shigella sp. D9]
 gi|300906473|ref|ZP_07124169.1| A/G-specific adenine glycosylase [Escherichia coli MS 84-1]
 gi|301306572|ref|ZP_07212634.1| A/G-specific adenine glycosylase [Escherichia coli MS 124-1]
 gi|81246827|gb|ABB67535.1| adenine glycosylase [Shigella boydii Sb227]
 gi|209913680|dbj|BAG78754.1| adenine glycosylase [Escherichia coli SE11]
 gi|300401754|gb|EFJ85292.1| A/G-specific adenine glycosylase [Escherichia coli MS 84-1]
 gi|300838190|gb|EFK65950.1| A/G-specific adenine glycosylase [Escherichia coli MS 124-1]
 gi|315256855|gb|EFU36823.1| A/G-specific adenine glycosylase [Escherichia coli MS 85-1]
 gi|320174041|gb|EFW49211.1| A/G-specific adenine glycosylase [Shigella dysenteriae CDC 74-1112]
 gi|320184309|gb|EFW59121.1| A/G-specific adenine glycosylase [Shigella flexneri CDC 796-83]
 gi|323167973|gb|EFZ53662.1| A/G-specific adenine glycosylase [Shigella sonnei 53G]
 gi|324017195|gb|EGB86414.1| A/G-specific adenine glycosylase [Escherichia coli MS 117-3]
 gi|324119759|gb|EGC13639.1| A/G-specific adenine glycosylase [Escherichia coli E1167]
 gi|332091345|gb|EGI96433.1| A/G-specific adenine glycosylase [Shigella boydii 3594-74]
          Length = 350

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 173/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-IAADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|218701675|ref|YP_002409304.1| adenine DNA glycosylase [Escherichia coli IAI39]
 gi|218371661|emb|CAR19502.1| adenine DNA glycosylase [Escherichia coli IAI39]
          Length = 350

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 173/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-ISADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEDNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|215488259|ref|YP_002330690.1| adenine DNA glycosylase [Escherichia coli O127:H6 str. E2348/69]
 gi|312964775|ref|ZP_07779015.1| A/G-specific adenine glycosylase [Escherichia coli 2362-75]
 gi|215266331|emb|CAS10762.1| adenine DNA glycosylase [Escherichia coli O127:H6 str. E2348/69]
 gi|281179973|dbj|BAI56303.1| adenine glycosylase [Escherichia coli SE15]
 gi|312290331|gb|EFR18211.1| A/G-specific adenine glycosylase [Escherichia coli 2362-75]
 gi|323188644|gb|EFZ73929.1| A/G-specific adenine glycosylase [Escherichia coli RN587/1]
 gi|324005499|gb|EGB74718.1| A/G-specific adenine glycosylase [Escherichia coli MS 57-2]
          Length = 350

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 173/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVAALHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-ISADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEDNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|16130862|ref|NP_417436.1| adenine DNA glycosylase [Escherichia coli str. K-12 substr. MG1655]
 gi|89109738|ref|AP_003518.1| adenine DNA glycosylase [Escherichia coli str. K-12 substr. W3110]
 gi|170018798|ref|YP_001723752.1| adenine DNA glycosylase [Escherichia coli ATCC 8739]
 gi|170082513|ref|YP_001731833.1| adenine DNA glycosylase [Escherichia coli str. K-12 substr. DH10B]
 gi|238902083|ref|YP_002927879.1| adenine DNA glycosylase [Escherichia coli BW2952]
 gi|253772200|ref|YP_003035031.1| adenine DNA glycosylase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254162871|ref|YP_003045979.1| adenine DNA glycosylase [Escherichia coli B str. REL606]
 gi|260857097|ref|YP_003230988.1| adenine DNA glycosylase MutY [Escherichia coli O26:H11 str. 11368]
 gi|260869651|ref|YP_003236053.1| adenine DNA glycosylase MutY [Escherichia coli O111:H- str. 11128]
 gi|297521121|ref|ZP_06939507.1| adenine DNA glycosylase [Escherichia coli OP50]
 gi|300947694|ref|ZP_07161863.1| A/G-specific adenine glycosylase [Escherichia coli MS 116-1]
 gi|300954190|ref|ZP_07166655.1| A/G-specific adenine glycosylase [Escherichia coli MS 175-1]
 gi|301330471|ref|ZP_07223087.1| A/G-specific adenine glycosylase [Escherichia coli MS 78-1]
 gi|301643683|ref|ZP_07243722.1| A/G-specific adenine glycosylase [Escherichia coli MS 146-1]
 gi|307139647|ref|ZP_07499003.1| adenine DNA glycosylase [Escherichia coli H736]
 gi|312972794|ref|ZP_07786967.1| A/G-specific adenine glycosylase [Escherichia coli 1827-70]
 gi|127559|sp|P17802|MUTY_ECOLI RecName: Full=A/G-specific adenine glycosylase
 gi|42073|emb|CAA36624.1| unnamed protein product [Escherichia coli K-12]
 gi|146864|gb|AAA72957.1| A/G-specific adenine glycosylase [Escherichia coli]
 gi|882490|gb|AAA69128.1| CG Site No. 18130; alternate name micA [Escherichia coli str. K-12
           substr. MG1655]
 gi|1789331|gb|AAC75998.1| adenine DNA glycosylase [Escherichia coli str. K-12 substr. MG1655]
 gi|85675771|dbj|BAE77024.1| adenine DNA glycosylase [Escherichia coli str. K12 substr. W3110]
 gi|169753726|gb|ACA76425.1| A/G-specific adenine glycosylase [Escherichia coli ATCC 8739]
 gi|169890348|gb|ACB04055.1| adenine DNA glycosylase [Escherichia coli str. K-12 substr. DH10B]
 gi|238859929|gb|ACR61927.1| adenine DNA glycosylase [Escherichia coli BW2952]
 gi|242378487|emb|CAQ33271.1| adenine glycosylase; G.C--> T.A transversions [Escherichia coli
           BL21(DE3)]
 gi|253323244|gb|ACT27846.1| A/G-specific adenine glycosylase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253974772|gb|ACT40443.1| adenine DNA glycosylase [Escherichia coli B str. REL606]
 gi|253978938|gb|ACT44608.1| adenine DNA glycosylase [Escherichia coli BL21(DE3)]
 gi|257755746|dbj|BAI27248.1| adenine DNA glycosylase MutY [Escherichia coli O26:H11 str. 11368]
 gi|257766007|dbj|BAI37502.1| adenine DNA glycosylase MutY [Escherichia coli O111:H- str. 11128]
 gi|260447996|gb|ACX38418.1| A/G-specific adenine glycosylase [Escherichia coli DH1]
 gi|284922904|emb|CBG35993.1| A/G-specific adenine glycosylase [Escherichia coli 042]
 gi|300318774|gb|EFJ68558.1| A/G-specific adenine glycosylase [Escherichia coli MS 175-1]
 gi|300452740|gb|EFK16360.1| A/G-specific adenine glycosylase [Escherichia coli MS 116-1]
 gi|300843554|gb|EFK71314.1| A/G-specific adenine glycosylase [Escherichia coli MS 78-1]
 gi|301077885|gb|EFK92691.1| A/G-specific adenine glycosylase [Escherichia coli MS 146-1]
 gi|309703316|emb|CBJ02652.1| A/G-specific adenine glycosylase [Escherichia coli ETEC H10407]
 gi|310332736|gb|EFP99949.1| A/G-specific adenine glycosylase [Escherichia coli 1827-70]
 gi|315137558|dbj|BAJ44717.1| adenine DNA glycosylase [Escherichia coli DH1]
 gi|315614876|gb|EFU95514.1| A/G-specific adenine glycosylase [Escherichia coli 3431]
 gi|323154674|gb|EFZ40873.1| A/G-specific adenine glycosylase [Escherichia coli EPECa14]
 gi|323180425|gb|EFZ65977.1| A/G-specific adenine glycosylase [Escherichia coli 1180]
 gi|323936036|gb|EGB32331.1| A/G-specific adenine glycosylase [Escherichia coli E1520]
 gi|323971752|gb|EGB66979.1| A/G-specific adenine glycosylase [Escherichia coli TA007]
 gi|332344862|gb|AEE58196.1| A/G-specific adenine glycosylase MutY [Escherichia coli UMNK88]
          Length = 350

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 173/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWALYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-IAADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|320656651|gb|EFX24547.1| adenine DNA glycosylase [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
          Length = 350

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 173/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTALANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAATNNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-IAADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|331659096|ref|ZP_08360038.1| A/G-specific adenine glycosylase [Escherichia coli TA206]
 gi|315295629|gb|EFU54952.1| A/G-specific adenine glycosylase [Escherichia coli MS 16-3]
 gi|331053678|gb|EGI25707.1| A/G-specific adenine glycosylase [Escherichia coli TA206]
          Length = 350

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 173/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVAALHGGKFPETFEEIA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-IAADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFIGCMDEDNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|218706479|ref|YP_002413998.1| adenine DNA glycosylase [Escherichia coli UMN026]
 gi|293406471|ref|ZP_06650397.1| adenine DNA glycosylase [Escherichia coli FVEC1412]
 gi|298382208|ref|ZP_06991805.1| A/G-specific adenine glycosylase [Escherichia coli FVEC1302]
 gi|300897564|ref|ZP_07115975.1| A/G-specific adenine glycosylase [Escherichia coli MS 198-1]
 gi|301027954|ref|ZP_07191240.1| A/G-specific adenine glycosylase [Escherichia coli MS 196-1]
 gi|218433576|emb|CAR14479.1| adenine DNA glycosylase [Escherichia coli UMN026]
 gi|291426477|gb|EFE99509.1| adenine DNA glycosylase [Escherichia coli FVEC1412]
 gi|298277348|gb|EFI18864.1| A/G-specific adenine glycosylase [Escherichia coli FVEC1302]
 gi|299878959|gb|EFI87170.1| A/G-specific adenine glycosylase [Escherichia coli MS 196-1]
 gi|300358682|gb|EFJ74552.1| A/G-specific adenine glycosylase [Escherichia coli MS 198-1]
          Length = 350

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 173/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-ISADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|323960899|gb|EGB56519.1| A/G-specific adenine glycosylase [Escherichia coli H489]
          Length = 350

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 173/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVAALHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-ISADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|54293874|ref|YP_126289.1| hypothetical protein lpl0930 [Legionella pneumophila str. Lens]
 gi|53753706|emb|CAH15164.1| hypothetical protein lpl0930 [Legionella pneumophila str. Lens]
          Length = 355

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 125/351 (35%), Positives = 181/351 (51%), Gaps = 14/351 (3%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
            +    +LDWYD + R  LPW+           SPY+VW+SEIMLQQT V+TV PYF +F
Sbjct: 8   QLFSQLLLDWYDLHGRKDLPWQ--------LPRSPYRVWVSEIMLQQTQVQTVIPYFNRF 59

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           ++ +P IF L++A+++E+LS W+GLGYY+RARNL   A II  +Y G FP  + IL +LP
Sbjct: 60  IEHFPDIFLLANAEEDEVLSLWSGLGYYSRARNLHNTAKIISDQYNGVFPEDLNILVQLP 119

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTS 182
           GIG  TA+AI++ AFN  A ++D N++R++SR+F I          K +   A       
Sbjct: 120 GIGPSTAAAILSQAFNKPAAILDGNVKRVLSRFFLIEGWSEQAQVKKKLWELASSCMPNE 179

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
           R  D+ QA+MDLGA  CT+  P C  CP++ +CL F   K HL     IKK+RP+ +   
Sbjct: 180 RCADYTQAIMDLGATCCTNKNPQCLRCPVKNHCLAFHNKKQHLYPTKKIKKQRPILSQQF 239

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHT 302
            +     N++ L KR  + L  G+  LP     +    +I         +  L     H+
Sbjct: 240 LVLHNRQNQVYLEKRPPSGLWGGLWCLPSINNQTCPIEHIQLFYKLQGDSPKLITRFKHS 299

Query: 303 FTHFTLTLFVWKTIV---PQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           F+HF L +      +      +      W   + L    L       LS  
Sbjct: 300 FSHFHLEITALSIKIESMNNFISESRGQWFTKETLPTLGLAKPTTLILSKL 350


>gi|52841134|ref|YP_094933.1| A/G specific adenine glycosylase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|54296919|ref|YP_123288.1| hypothetical protein lpp0960 [Legionella pneumophila str. Paris]
 gi|52628245|gb|AAU26986.1| A/G specific adenine glycosylase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|53750704|emb|CAH12111.1| hypothetical protein lpp0960 [Legionella pneumophila str. Paris]
          Length = 355

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 126/351 (35%), Positives = 180/351 (51%), Gaps = 14/351 (3%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
            +    +LDWYD + R  LPW+           SPY+VW+SEIMLQQT V+TV PYF +F
Sbjct: 8   QLFSQLLLDWYDLHGRKDLPWQ--------LPRSPYRVWVSEIMLQQTQVQTVIPYFNRF 59

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           ++ +P IF L++A ++E+LS W+GLGYY+RARNL   A II  +Y G FP  + IL +LP
Sbjct: 60  IEHFPDIFLLANADEDEVLSLWSGLGYYSRARNLHNTAKIISDQYNGVFPEDLNILVQLP 119

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAP--LYHKTIKNYARKITSTS 182
           GIG  TA+AI++ AFN  A ++D N++R++SR+F I          K +   A       
Sbjct: 120 GIGPSTAAAILSQAFNKPAAILDGNVKRVLSRFFLIEGWPEQAQVKKKLWGLASSCMPNE 179

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
           R  D+ QA+MDLGA  CT+  P C  CP++ +CL F   K HL     IKK+RP+ +   
Sbjct: 180 RCADYTQAIMDLGATCCTNKNPQCLRCPVKNHCLAFHNKKQHLYPTKKIKKQRPILSQQF 239

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHT 302
            +     N++ L KR  T L  G+  LP     +    +I         +  L     H+
Sbjct: 240 LVLHNRQNQVYLEKRPPTGLWGGLWCLPSINNQTCPIEHIQLFYRLQGDSPKLITRFKHS 299

Query: 303 FTHFTLTLFVWKTIV---PQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           F+HF L +      +      +      W   + L    L       LS  
Sbjct: 300 FSHFHLEITALSIRIESTNNFISESRGQWFTKETLPTLGLAKPTTLILSKL 350


>gi|170682894|ref|YP_001745123.1| adenine DNA glycosylase [Escherichia coli SMS-3-5]
 gi|170520612|gb|ACB18790.1| A/G-specific adenine glycosylase [Escherichia coli SMS-3-5]
          Length = 350

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 110/359 (30%), Positives = 172/359 (47%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHSGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C  CP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSFCPLQNGCIATANNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-IVADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|254283196|ref|ZP_04958164.1| A/G-specific adenine glycosylase [gamma proteobacterium NOR51-B]
 gi|219679399|gb|EED35748.1| A/G-specific adenine glycosylase [gamma proteobacterium NOR51-B]
          Length = 363

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 112/358 (31%), Positives = 180/358 (50%), Gaps = 16/358 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           +   +  + S++L+W+D + R  LPW+T          +PY+VWISEIMLQQT V TV P
Sbjct: 4   LHPTDRTLASRLLNWFDDHGRKDLPWQTDT--------TPYRVWISEIMLQQTQVATVIP 55

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           Y+++FM ++PT+  LS+A ++++L  W+GLGYY RARNL + A ++     G FP  V+ 
Sbjct: 56  YYERFMGEFPTVEALSAAPEDDVLKLWSGLGYYARARNLHRGAKMVTGDLGGEFPDTVDG 115

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPL--YHKTIKNYARK 177
           L  LPGIG  TA AI++IA    A ++D N++R+++R+  +            +  +A  
Sbjct: 116 LCTLPGIGRSTAGAIISIAMGGRAPILDGNVKRVLARHHAVDGWPGKSGVAAELWGHAEA 175

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
            T  +R  D+ QA+MDLGA +CT  +P C +CP+   C     G          K+  P 
Sbjct: 176 HTPNTRVADYTQAIMDLGATLCTRRRPQCLVCPLVDTCHAGRAGDPEQYPGKKPKRTTPT 235

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
           R+    + + +   +LL+KR  + +  G+  LP S     +  N+               
Sbjct: 236 RSAFFALVVDHTGAVLLQKRPPSGIWGGLWSLPQS-PDRGELENLAQRFGVVDPEVEQLP 294

Query: 298 TITHTFTHFTLTLFVWKTIVP----QIVIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
            I HTF+HF L +   +  +      +    +  WH         +P  + K L+  G
Sbjct: 295 MIEHTFSHFRLAITPLRIRLSTAHTSVSEPTEYKWHQFTQSLPGGIPAPVAKLLAEQG 352


>gi|156932549|ref|YP_001436465.1| adenine DNA glycosylase [Cronobacter sakazakii ATCC BAA-894]
 gi|156530803|gb|ABU75629.1| hypothetical protein ESA_00330 [Cronobacter sakazakii ATCC BAA-894]
          Length = 361

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 100/351 (28%), Positives = 161/351 (45%), Gaps = 16/351 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                   ++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 2   MQAQQFSRQVLDWYDKYGRKTLPWQQ--------EKTPYKVWLSEVMLQQTQVTTVIPYF 53

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++P +  L++A  +++L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 54  ERFMARFPDVTALANAPLDDVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVA 113

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPG+G  TA A+++++      ++D N++R+++R + +            +   +  +T
Sbjct: 114 ALPGVGRSTAGAVLSLSLGKHFPILDGNVKRVLARCYAVEGWPGKKEVENRLWQISETVT 173

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT +KP C +CP+   C  F+            K+  P   
Sbjct: 174 PAEGVARFNQAMMDLGAMVCTRSKPKCEICPLNNGCEAFAHQSYAKYPGKKPKQILPE-K 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
              F+ + ++  + L++R    L  G+   P     +     +                 
Sbjct: 233 TGYFLLLQHEGALFLQQRPPVGLWGGLYCFPQFESETALREWLSARGINDDG-LTQLTAF 291

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKAL 347
            HTF+HF L +      V Q     D     W++        L   +++ L
Sbjct: 292 RHTFSHFHLDIVPMWLGVQQTAACMDEASGLWYNLAQPPAVGLAAPVERLL 342


>gi|91781718|ref|YP_556924.1| A/G-specific DNA-adenine glycosylase [Burkholderia xenovorans
           LB400]
 gi|91685672|gb|ABE28872.1| A/G-specific DNA-adenine glycosylase [Burkholderia xenovorans
           LB400]
          Length = 375

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 107/362 (29%), Positives = 180/362 (49%), Gaps = 24/362 (6%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               ++++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+ KF
Sbjct: 24  SDFSARLIAWQRQHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVIPYYAKF 75

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           + ++P++  L++A  +++++ WAGLGYYTRARNL +CA ++V+++ G FP  VE L +LP
Sbjct: 76  LARFPSVAALAAAPSDDVMALWAGLGYYTRARNLHRCAQVVVEQHGGGFPTSVEELAELP 135

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTS 182
           GIG  TA+AI + AF   A ++D N++R+++R F +            +   A  +  ++
Sbjct: 136 GIGRSTAAAIASFAFGARATILDGNVKRVLARVFGVEGFPGEKKVENAMWTLAESLLPSN 195

Query: 183 RPG----DFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
                   + Q +MDLGA +C   KP C  CP   +C+    G+  LL     KK  P R
Sbjct: 196 ASDAEVSAYTQGLMDLGATLCVRGKPDCLRCPFAVDCVANVTGRQRLLPTARPKKTVPTR 255

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
                + + + N ++L KR  + +  G+  LP +A  +                      
Sbjct: 256 RT-WMLVLRDGNAVMLEKRPPSGIWGGLWSLPEAADETALAERARAFGG--DGAVSPLAP 312

Query: 299 ITHTFTHFTLTLFVWKTIVPQI------VIIPDSTWHDAQNLANAALPTVMKKALSAGGI 352
           +TH FTHF L +      + +       +   D+ W    +L +  +P  ++K L +   
Sbjct: 313 LTHVFTHFKLDIEPRLAELDRGVGALAALGDADTAWVALSDLDSFGVPAPVRKLLDSLQG 372

Query: 353 KV 354
            +
Sbjct: 373 SL 374


>gi|296106480|ref|YP_003618180.1| A/G-specific adenine glycosylase [Legionella pneumophila 2300/99
           Alcoy]
 gi|295648381|gb|ADG24228.1| A/G-specific adenine glycosylase [Legionella pneumophila 2300/99
           Alcoy]
          Length = 355

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 126/351 (35%), Positives = 181/351 (51%), Gaps = 14/351 (3%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
            +    +LDWYD + R  LPW+           SPY+VW+SEIMLQQT V+TV PYF +F
Sbjct: 8   QLFSQLLLDWYDLHGRKDLPWQ--------LPRSPYRVWVSEIMLQQTQVQTVIPYFNRF 59

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           ++ +P IF L++A+++E+LS W+GLGYY+RARNL   A II  +Y G FP  + IL +LP
Sbjct: 60  IEHFPDIFLLANAEEDEVLSLWSGLGYYSRARNLHNTAKIISDQYNGVFPEDLNILVQLP 119

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAP--LYHKTIKNYARKITSTS 182
           GIG  TA+AI++ AFN  A ++D N++R++SR+F I          K +   A       
Sbjct: 120 GIGPSTAAAILSQAFNKPAAILDGNVKRVLSRFFLIEGWPEQAQVKKKLWGLASSCMPNE 179

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
           R  D+ QA+MDLGA  CT+  P C  CP++ +CL F   K HL     IKK+RP+ +   
Sbjct: 180 RCADYTQAIMDLGATCCTNKNPHCLRCPVKNHCLAFHNKKQHLYPTKKIKKQRPILSQQF 239

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHT 302
            +     N++ L KR  T L  G+  LP     +    +I         +  L     H+
Sbjct: 240 LVLHNEQNQVYLEKRPPTGLWGGLWCLPSINNQTCPIEHIQLFYKLQGESPKLITRFKHS 299

Query: 303 FTHFTLTLFVWKTIV---PQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           F+HF L +      +      +      W   + L    L       LS  
Sbjct: 300 FSHFHLEITALSIRIESMNNFISESRGQWFTKETLPTLGLAKPTTLILSKL 350


>gi|170724079|ref|YP_001751767.1| A/G-specific adenine glycosylase [Pseudomonas putida W619]
 gi|169762082|gb|ACA75398.1| A/G-specific adenine glycosylase [Pseudomonas putida W619]
          Length = 355

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 124/354 (35%), Positives = 179/354 (50%), Gaps = 15/354 (4%)

Query: 7   IIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
              S +LDWYD + R  LPW+           +PY+VW+SEIMLQQT V TV  YF +FM
Sbjct: 5   QFSSAVLDWYDQHGRHDLPWQQ--------GINPYRVWVSEIMLQQTQVSTVLNYFDRFM 56

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
           Q  PT+  L+ A ++E+L  W GLGYYTRARNL+K A I+V+++ G FP  VE L +LPG
Sbjct: 57  QALPTVQALAEAPEDEVLHLWTGLGYYTRARNLQKAARIVVEQHGGEFPRSVEQLTELPG 116

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTSR 183
           IG  TA AI +I+      ++D N++R+++R+         P     +   A + T   R
Sbjct: 117 IGRSTAGAIASISMGIRVPILDGNVKRVLARFTAQAGYPGEPKVANALWATAERFTPQQR 176

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVF 243
              + QAMMDLGA +CT +KP C LCP++  C     G+         +K  P R   + 
Sbjct: 177 ANHYTQAMMDLGATLCTRSKPSCLLCPVRSGCEAHLHGEETRYPEPKPRKALPQRRTLMP 236

Query: 244 IAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTF 303
           +   ++  ILL +R ++ L  G+  LP        D     H      +    + +THTF
Sbjct: 237 LLANHEGAILLYRRPSSGLWGGLWSLPELDAIEQLDDLAYQHGLRLAES-RALDGLTHTF 295

Query: 304 THFTLTLFVWKTIVP---QIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
           +HF L +  W   V    Q V   D  W++        L   +KK L     ++
Sbjct: 296 SHFQLAIEPWLVRVDPVGQHVAEADWLWYNLATPPRLGLAAPVKKLLKRAADEL 349


>gi|194436798|ref|ZP_03068898.1| A/G-specific adenine glycosylase [Escherichia coli 101-1]
 gi|194424280|gb|EDX40267.1| A/G-specific adenine glycosylase [Escherichia coli 101-1]
          Length = 350

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 110/359 (30%), Positives = 172/359 (47%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVAALHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C  CP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSHCPLQNGCIAAANNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-ISADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|167623088|ref|YP_001673382.1| A/G-specific adenine glycosylase [Shewanella halifaxensis HAW-EB4]
 gi|167353110|gb|ABZ75723.1| A/G-specific adenine glycosylase [Shewanella halifaxensis HAW-EB4]
          Length = 354

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 108/352 (30%), Positives = 171/352 (48%), Gaps = 18/352 (5%)

Query: 8   IQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
             ++I+ WYD   R  LPW+ +         +PYKVWISEIMLQQT V TV PYF+KF+ 
Sbjct: 7   FSTRIIQWYDNFGRKQLPWQLN--------KTPYKVWISEIMLQQTQVATVIPYFEKFIA 58

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++P I  L+SA+ +E+L  W GLGYY RARNL K A I+  ++   FP   + +  LPGI
Sbjct: 59  RFPDIDSLASAEQDEVLHHWTGLGYYARARNLHKAAQIMQSEFNSTFPTDFDHVLALPGI 118

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTSRP 184
           G  TA A+++++      ++D N++R+++R+  I          + +      +T     
Sbjct: 119 GRSTAGAVLSLSLGLNFAILDGNVKRVLARHGAIEGWPGKKTVEQALWLLTEALTPAKDI 178

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA +CT +KP C  CP+  +C     G+          KK      A  +
Sbjct: 179 QKYNQAMMDIGATVCTRSKPNCAQCPVAIDCKAQLSGRQSEYPGKK-PKKVIPEKSAWLL 237

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFT 304
            I + +++ L KR    +  G+   P  +  +  D  I  +     +   L     HTF+
Sbjct: 238 VIEDKHQVHLEKRPPAGIWGGLWCFPQFSDRAELDTYIKDNQLSVNSQQELVG-FRHTFS 296

Query: 305 HFTLTLFVWKTIV-----PQIVIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
           HF L +      V      QI+    + W++  +     L    ++ L+  G
Sbjct: 297 HFHLDIQPMLVRVSGISDNQIMEQASTVWYNLTHPPKVGLAAATERILADLG 348


>gi|221199990|ref|ZP_03573033.1| A/G-specific adenine glycosylase [Burkholderia multivorans CGD2M]
 gi|221206855|ref|ZP_03579867.1| A/G-specific adenine glycosylase [Burkholderia multivorans CGD2]
 gi|221173510|gb|EEE05945.1| A/G-specific adenine glycosylase [Burkholderia multivorans CGD2]
 gi|221180229|gb|EEE12633.1| A/G-specific adenine glycosylase [Burkholderia multivorans CGD2M]
          Length = 370

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 105/364 (28%), Positives = 174/364 (47%), Gaps = 27/364 (7%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
                +++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+ +F
Sbjct: 18  RTFAPRLIAWQRQHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVVPYYTRF 69

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           ++++P +  L++A  +++++ WAGLGYY+RARNL +CA ++V ++ G FP   + L +LP
Sbjct: 70  LERYPDVAALAAAPIDDVMALWAGLGYYSRARNLHRCAQVVVAEHGGAFPATPDALAELP 129

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTS 182
           GIG  TA+AI + A+   A ++D N++R+++R F I            +   A  +   +
Sbjct: 130 GIGRSTAAAIASFAYGARATILDGNVKRVLARVFGIEGFPGEKRVENDMWALAESLLPDA 189

Query: 183 RPGD----FVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
              D    + Q +MDLGA +C   KP C  CP   +C+  S G+   L     KK  P R
Sbjct: 190 AHPDDVSAYTQGLMDLGATLCVRGKPDCTRCPFAGDCVAQSTGRQRELPAARPKKAVPTR 249

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
                + + + + +LL +R    +  G+  LP +   +                 +    
Sbjct: 250 KT-WMLVLRDGDAVLLERRPPAGIWGGLWSLPQADGDAELADLARRFGGGGP---VPLAP 305

Query: 299 ITHTFTHFTLTLFVWKTIVPQIVI--------IPDSTWHDAQNLANAALPTVMKKALSAG 350
           +THTFTHF L +    + V               D+ W     L    +P  ++K L A 
Sbjct: 306 LTHTFTHFRLEIEPRLSDVASEAAAVPFAQAQDADTAWVPLSGLDAYGVPAPVRKLLDAL 365

Query: 351 GIKV 354
              +
Sbjct: 366 SGPL 369


>gi|331678955|ref|ZP_08379629.1| A/G-specific adenine glycosylase [Escherichia coli H591]
 gi|323946674|gb|EGB42696.1| A/G-specific adenine glycosylase [Escherichia coli H120]
 gi|331073785|gb|EGI45106.1| A/G-specific adenine glycosylase [Escherichia coli H591]
          Length = 355

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 111/360 (30%), Positives = 173/360 (48%), Gaps = 16/360 (4%)

Query: 2   PQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
                   +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PY
Sbjct: 5   TMQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPY 56

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           F++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E +
Sbjct: 57  FERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEV 116

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKI 178
             LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++
Sbjct: 117 AALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQV 176

Query: 179 TSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
           T       F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P R
Sbjct: 177 TPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWALYPGKKPKQTLPER 236

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
           TG   +    D  +LL +R  + L  G+   P  A   +    +         N      
Sbjct: 237 TGYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRHWLAQRQ-IAADNLTQLTA 294

Query: 299 ITHTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
             HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 295 FRHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 354


>gi|187731126|ref|YP_001881735.1| adenine DNA glycosylase [Shigella boydii CDC 3083-94]
 gi|187428118|gb|ACD07392.1| A/G-specific adenine glycosylase [Shigella boydii CDC 3083-94]
          Length = 360

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 110/360 (30%), Positives = 173/360 (48%), Gaps = 16/360 (4%)

Query: 2   PQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
                   +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PY
Sbjct: 10  TMQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPY 61

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           F++FM ++PT+  L++A  +E+L  W GLGYY RARN+ K A  +   + G FP   E +
Sbjct: 62  FERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNMHKAAQQVATLHGGKFPETFEEV 121

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKI 178
             LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++
Sbjct: 122 AALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQV 181

Query: 179 TSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
           T       F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P R
Sbjct: 182 TPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPER 241

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
           TG   +    D  +LL +R  + L  G+   P  A   +    +         N      
Sbjct: 242 TGYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-IAADNLTQLTA 299

Query: 299 ITHTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
             HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 300 FRHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 359


>gi|307609690|emb|CBW99199.1| hypothetical protein LPW_09811 [Legionella pneumophila 130b]
          Length = 355

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 125/351 (35%), Positives = 181/351 (51%), Gaps = 14/351 (3%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
            +    +LDWYD + R  LPW+           SPY+VW+SEIMLQQT V+TV PYF +F
Sbjct: 8   QLFSQLLLDWYDLHGRKDLPWQ--------LPRSPYRVWVSEIMLQQTQVQTVIPYFNRF 59

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           ++ +P IF L++A+++E+LS W+GLGYY+RARNL   A II  +Y G FP  + IL +LP
Sbjct: 60  IEHFPDIFLLANAEEDEVLSLWSGLGYYSRARNLHNTAKIISDQYNGVFPEDLNILVQLP 119

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAP--LYHKTIKNYARKITSTS 182
           GIG  TA+AI++ AFN  A ++D N++R++SR+F I          K +   A       
Sbjct: 120 GIGPSTAAAILSQAFNKPAAILDGNVKRVLSRFFLIEGWPEQAQVKKKLWGLASSCMPNE 179

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
           R  D+ QA+MDLGA  CT+  P C  CP++ +CL F   K HL     IKK+RP+ +   
Sbjct: 180 RCADYTQAIMDLGATCCTNKNPQCLRCPVKNHCLAFHNKKQHLYPTKKIKKQRPILSQQF 239

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHT 302
            +     N++ L KR  + L  G+  LP     +    +I         +  L     H+
Sbjct: 240 LVLHNGQNQVYLEKRPPSGLWGGLWCLPSINNQTCPIEHIQLFYKLQGDSPKLITRFKHS 299

Query: 303 FTHFTLTLFVWKTIV---PQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           F+HF L +      +      +      W   + L    L       LS  
Sbjct: 300 FSHFHLEITALSIRIEPMNNFISESRGQWFTKETLPTLGLAKPTTLILSKL 350


>gi|26249383|ref|NP_755423.1| adenine DNA glycosylase [Escherichia coli CFT073]
 gi|26109791|gb|AAN81996.1|AE016766_84 A/G-specific adenine glycosylase [Escherichia coli CFT073]
          Length = 360

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 111/360 (30%), Positives = 173/360 (48%), Gaps = 16/360 (4%)

Query: 2   PQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
                   +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PY
Sbjct: 10  TMQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPY 61

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           F++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E +
Sbjct: 62  FERFMVRFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVAALHGGKFPETFEEV 121

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKI 178
             LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++
Sbjct: 122 AALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQV 181

Query: 179 TSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
           T       F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P R
Sbjct: 182 TPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPER 241

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
           TG   +    D  +LL +R  + L  G+   P  A   +    +         N      
Sbjct: 242 TGYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-IAADNLTQLTA 299

Query: 299 ITHTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
             HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 300 FRHTFSHFHLDIVPMWLPVSSFTGCMDEDNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 359


>gi|172087663|ref|YP_203805.2| adenine DNA glycosylase [Vibrio fischeri ES114]
 gi|171902258|gb|AAW84917.2| adenine DNA glycosylase [Vibrio fischeri ES114]
          Length = 350

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 111/351 (31%), Positives = 166/351 (47%), Gaps = 18/351 (5%)

Query: 7   IIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
                IL+WYD   R  LPW+           +PYKVW+SEIMLQQT V TV PYF++FM
Sbjct: 3   SFSQAILEWYDNYGRKTLPWQ--------LEKTPYKVWLSEIMLQQTQVTTVIPYFERFM 54

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
            ++PTI  L+ A+ +E+L  W GLGYY RARNL K A II ++Y G FP  ++ +  LPG
Sbjct: 55  TRFPTIVDLAHAEQDEVLHLWTGLGYYARARNLHKTAQIIAEQYNGIFPTNIDDVIALPG 114

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTSR 183
           IG  TA A+++++      ++D N++R +SR F I            +   A   T    
Sbjct: 115 IGRSTAGAVLSLSLQQHHPILDGNVKRTLSRCFAIEGWPGKKSVENEMWAVAETHTPKQG 174

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVF 243
              + QAMMD+GA++CT +KP C LCP+   C   ++ K          KK      A F
Sbjct: 175 VERYNQAMMDMGAMVCTRSKPKCELCPVNDLCQAKAQDKQLDFPT-KKPKKEKPVKEAWF 233

Query: 244 IAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTF 303
               +D  + L +R  + +  G+   P     +     +        A+        HTF
Sbjct: 234 AIYYHDGEVWLEQRPQSGIWGGLFCFP--EQPTNTLDELSEDYGFKVASKQQLIAFRHTF 291

Query: 304 THFTLTLFVWKTIVPQ----IVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ L +      + +    I+      W++        L   ++K L A 
Sbjct: 292 SHYHLDITPVLITLAKKPNMIMEGTRGVWYNLSQPMTVGLAAPVQKLLDAL 342


>gi|148360455|ref|YP_001251662.1| A/G specific adenine glycosylase [Legionella pneumophila str.
           Corby]
 gi|148282228|gb|ABQ56316.1| A/G specific adenine glycosylase [Legionella pneumophila str.
           Corby]
          Length = 355

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 126/351 (35%), Positives = 181/351 (51%), Gaps = 14/351 (3%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
            +    +LDWYD + R  LPW+           SPY+VW+SEIMLQQT V+TV PYF +F
Sbjct: 8   QLFSQLLLDWYDLHGRKDLPWQ--------LPRSPYRVWVSEIMLQQTQVQTVIPYFNRF 59

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           ++ +P IF L++A+++E+LS W+GLGYY+RARNL   A II  +Y G FP  + IL +LP
Sbjct: 60  IEHFPDIFLLANAEEDEVLSLWSGLGYYSRARNLHNTAKIISDQYNGVFPEDLNILVQLP 119

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAP--LYHKTIKNYARKITSTS 182
           GIG  TA+AI++ AFN  A ++D N++R++SR+F I          K +   A       
Sbjct: 120 GIGPSTAAAILSQAFNKPAAILDGNVKRVLSRFFLIEGWPEQAQVKKKLWGLASSCMPNE 179

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
           R  D+ QA+MDLGA  CT+  P C  CP++ +CL F   K HL     IKK+RP+ +   
Sbjct: 180 RCADYTQAIMDLGATCCTNKNPHCLRCPVKNHCLAFHNKKQHLYPTKKIKKQRPILSQQF 239

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHT 302
            +     N++ L KR  T L  G+  LP     +    +I         +  L     H+
Sbjct: 240 LVLHNEQNQVYLEKRPPTGLWGGLWCLPSINNQTCPIEHIQLFYKLQGDSPKLITRFKHS 299

Query: 303 FTHFTLTLFVWKTIV---PQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           F+HF L +      +      +      W   + L    L       LS  
Sbjct: 300 FSHFHLEITALSIRIESTNNFISESRGQWFTKETLPTLGLAKPTTLILSKL 350


>gi|218550211|ref|YP_002384002.1| adenine DNA glycosylase [Escherichia fergusonii ATCC 35469]
 gi|218357752|emb|CAQ90396.1| adenine DNA glycosylase [Escherichia fergusonii ATCC 35469]
          Length = 350

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 109/359 (30%), Positives = 173/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   + + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFDEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNECIATANNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  + L +R  + L  G+   P  A   +    +         N +     
Sbjct: 233 GYFLLLQHEDE-VFLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-IAADNLMQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|226942610|ref|YP_002797683.1| A/G-specific adenine glycosylase [Azotobacter vinelandii DJ]
 gi|226717537|gb|ACO76708.1| A/G-specific adenine glycosylase [Azotobacter vinelandii DJ]
          Length = 362

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 119/358 (33%), Positives = 177/358 (49%), Gaps = 15/358 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  S +L WYD + R  LPW+           +PY+VW+SEIMLQQT V TV  Y+
Sbjct: 1   MTPEQFGSAVLAWYDDHGRKDLPWQRD--------ITPYRVWVSEIMLQQTQVATVLGYY 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM   PT+  L++A ++E+L  W GLGYY+RARNL K A I+V ++ G FP  VE L 
Sbjct: 53  ERFMAALPTVQTLAAAPEDEVLHLWTGLGYYSRARNLHKTAKILVAEHAGEFPRSVEALA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
           +LPGIG  TA AI +I     A ++D N++R+++RY         P   K +   A + T
Sbjct: 113 ELPGIGRSTAGAIASIGMGLRAPILDGNVKRVLARYLAEDGHPGEPRAAKRLWEAAERFT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             +R   + QAMMDLGA +CT  +P C LCP+   C     G+         +++ P + 
Sbjct: 173 PEARVNHYTQAMMDLGATLCTRTRPSCLLCPLASGCRAHLLGRETDYPTPRPRRELPRKR 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +  + D  ILL +R ++ L  G+  LP     +  +     H+            +
Sbjct: 233 TLMPLLASRDGAILLYRRPSSGLWGGLWSLPELDDLAALETLAARHALRLGER-RALPGL 291

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
           THTF+HF L +  W   V      V   D  W++        L   +KK L     ++
Sbjct: 292 THTFSHFQLAIEPWLVTVESAGPAVAEADWLWYNLAAPPRLGLAAPVKKLLKRAQGEL 349


>gi|312115737|ref|YP_004013333.1| A/G-specific adenine glycosylase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220866|gb|ADP72234.1| A/G-specific adenine glycosylase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 390

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 151/368 (41%), Positives = 203/368 (55%), Gaps = 30/368 (8%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               Q  +L WYD   R LPWR  P      L  PY+VW+SEIMLQQTTVK V PYF+ F
Sbjct: 21  AESFQRALLRWYDVARRDLPWRAKP----GELADPYRVWLSEIMLQQTTVKAVIPYFEAF 76

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
            ++WPT+  L+ A  +E+L+AWAGLGYY+RARNL  CA  +    +G FP     L+ LP
Sbjct: 77  TRRWPTVDALADASRDEVLAAWAGLGYYSRARNLHACAQALA---QGGFPADEVGLRALP 133

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRP 184
           G+G YT++AI AIAF+  A VVD N+ER+++R F +  P P     ++  A ++T  SRP
Sbjct: 134 GVGAYTSAAIAAIAFDLPAAVVDGNVERVLARVFALETPLPAAKGELRKLAAELTPASRP 193

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
           GD+ QAMMDLGA IC+   P C +CP++  C   ++G +    +   K  RP R G  F+
Sbjct: 194 GDYAQAMMDLGAGICSPRSPSCLVCPVRAFCAAAAKGDAERFPLRAAKAARPTRRGEAFV 253

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAW-------------------SSTKDGNIDTH 285
            I  D  ILLR+R +  LL GM E+P S W                    +    +    
Sbjct: 254 -IVRDGCILLRRRADKGLLGGMMEVPTSDWVADGAVAARSTRGRPKVGADAAAIASPRAD 312

Query: 286 SAPFTANWILCNTITHTFTHFTLTLFVWKTIVPQIVIIP---DSTWHDAQNLANAALPTV 342
           ++P  A W+   T+ HTFTHF L L V+                 W    NLA  ALP+V
Sbjct: 313 TSPAGAAWLPGRTVQHTFTHFHLELRVFAADADTAPSAAAAFSGEWAALDNLAAFALPSV 372

Query: 343 MKKALSAG 350
           MKKA+++G
Sbjct: 373 MKKAVASG 380


>gi|218247825|ref|YP_002373196.1| A/G-specific adenine glycosylase [Cyanothece sp. PCC 8801]
 gi|218168303|gb|ACK67040.1| A/G-specific adenine glycosylase [Cyanothece sp. PCC 8801]
          Length = 352

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 118/359 (32%), Positives = 179/359 (49%), Gaps = 18/359 (5%)

Query: 7   IIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
            ++  +L WY    R LPWR         +  PY +W+SEIMLQQT VKTV PY+++++ 
Sbjct: 2   ALRRSLLLWYQHQGRELPWRN--------IDDPYAIWVSEIMLQQTQVKTVIPYYQRWLA 53

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++P I  L+++  + +L AW GLGYYTRARNL K A II+K Y G FP ++E + KLPGI
Sbjct: 54  QFPNIQTLATSDLQTVLKAWEGLGYYTRARNLYKTAQIILKDYRGIFPRELEKVVKLPGI 113

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGD 186
           G  TA  I++ AFN    ++D N++R+++R   +  P     + + + +  +     P D
Sbjct: 114 GRTTAGGILSSAFNQPISILDGNVKRVLARLVALSDPPAKAIQFLWDVSDSLLDPDNPRD 173

Query: 187 FVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAI 246
           F Q +MDLGA ICT ++P C LCP   +C  + +GK + L +       P +   V +  
Sbjct: 174 FNQGLMDLGATICTRSQPKCLLCPWLSHCQAYQQGKQNQLPMREDSSPLPHKKIGVAVIY 233

Query: 247 TNDNRILLRKRTNTRLLEGMDELPGSAWSSTK------DGNIDTHSAPFTANWILCNTIT 300
            N   IL+ +R +  LL G+ E PG      +         I    A          T+ 
Sbjct: 234 NNAGEILIDRRPDKGLLGGLWEFPGGKIEENETVEECIKREILEEIAIDIEVGEHLITLD 293

Query: 301 HTFTHFTLTLFVWKTI----VPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
           + +THF +TL V         PQ +   +  W     + +   P    K + A     P
Sbjct: 294 YAYTHFKVTLIVHLCRHVAGEPQAIECQEIRWTTLDEIDSFPFPKANSKIIEALRNNQP 352


>gi|154685326|ref|YP_001420487.1| YfhQ [Bacillus amyloliquefaciens FZB42]
 gi|154351177|gb|ABS73256.1| YfhQ [Bacillus amyloliquefaciens FZB42]
          Length = 365

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 109/356 (30%), Positives = 176/356 (49%), Gaps = 18/356 (5%)

Query: 1   MPQPE-HIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M Q +    +  ++ W++   R+LPWR +          PY+VW+SE+MLQQT V+TV P
Sbjct: 8   MKQKDIDKFREDLITWFEREQRILPWREN--------QDPYRVWVSEVMLQQTRVETVIP 59

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF++F++++PT+  L+ A +E++L AW GLGYY+R RNL+     + ++Y G  P + + 
Sbjct: 60  YFRRFVEQFPTVSALAEADEEKVLKAWEGLGYYSRVRNLQSAVKEVHERYGGVVPAEEKE 119

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARK 177
              L G+G YT  A+++IA+N     VD N+ R++SR   I      P      +     
Sbjct: 120 FGGLKGVGPYTKGAVLSIAYNKPIPAVDGNVMRVMSRILSIWDDIAKPKTRTIFEQAVSA 179

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
             S  +P +F Q +M+LGA+ICT   P C LCP+QK+C  F+EG    L + + KKK  +
Sbjct: 180 FISHEKPSEFNQGLMELGAIICTPKSPSCLLCPVQKHCSAFAEGTERELPVKSKKKKPGI 239

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWS-------STKDGNIDTHSAPFT 290
           +T A  +   +   + + KR    LL  + E P +             +  ++       
Sbjct: 240 KTMAAVVLTDDQGDVYIHKRPPKGLLANLWEFPNTETQKGIKTEREQLEAYLEKEMGTTA 299

Query: 291 ANWILCNTITHTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKA 346
               L   + H FTH    + V+   V Q+    +      + L   A P   +K 
Sbjct: 300 EIGELEGIVEHVFTHLVWNISVFFGKVKQVSDTTEFIRVTKEELEEYAFPVSHQKI 355


>gi|191167918|ref|ZP_03029721.1| A/G-specific adenine glycosylase [Escherichia coli B7A]
 gi|193067254|ref|ZP_03048222.1| A/G-specific adenine glycosylase [Escherichia coli E110019]
 gi|218555520|ref|YP_002388433.1| adenine DNA glycosylase [Escherichia coli IAI1]
 gi|218696559|ref|YP_002404226.1| adenine DNA glycosylase [Escherichia coli 55989]
 gi|300815567|ref|ZP_07095791.1| A/G-specific adenine glycosylase [Escherichia coli MS 107-1]
 gi|307310418|ref|ZP_07590066.1| A/G-specific adenine glycosylase [Escherichia coli W]
 gi|309794051|ref|ZP_07688476.1| A/G-specific adenine glycosylase [Escherichia coli MS 145-7]
 gi|190902003|gb|EDV61749.1| A/G-specific adenine glycosylase [Escherichia coli B7A]
 gi|192959211|gb|EDV89646.1| A/G-specific adenine glycosylase [Escherichia coli E110019]
 gi|218353291|emb|CAU99258.1| adenine DNA glycosylase [Escherichia coli 55989]
 gi|218362288|emb|CAQ99909.1| adenine DNA glycosylase [Escherichia coli IAI1]
 gi|300531496|gb|EFK52558.1| A/G-specific adenine glycosylase [Escherichia coli MS 107-1]
 gi|306909313|gb|EFN39808.1| A/G-specific adenine glycosylase [Escherichia coli W]
 gi|308122458|gb|EFO59720.1| A/G-specific adenine glycosylase [Escherichia coli MS 145-7]
 gi|315062267|gb|ADT76594.1| adenine DNA glycosylase [Escherichia coli W]
 gi|320202629|gb|EFW77199.1| A/G-specific adenine glycosylase [Escherichia coli EC4100B]
 gi|323183534|gb|EFZ68931.1| A/G-specific adenine glycosylase [Escherichia coli 1357]
 gi|323377149|gb|ADX49417.1| A/G-specific adenine glycosylase [Escherichia coli KO11]
          Length = 350

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 173/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRHWLAQRQ-IAADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|327412901|emb|CAX67915.1| A/G-specific adenine glycosylase [Salmonella bongori]
          Length = 350

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 115/359 (32%), Positives = 176/359 (49%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+ +         SPYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQIN--------KSPYKVWLSEVMLQQTQVTTVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L+ A  +E+L  W GLGYY RARNL K A  +V  + G FP   + + 
Sbjct: 53  ERFMARFPTVTDLAKAPLDEVLHLWTGLGYYARARNLHKAAQQVVALHGGKFPQTFDEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPG+G  TA A++++A      ++D N++R+++R + I            + + + ++T
Sbjct: 113 ALPGVGRSTAGAVLSLALGKHYPILDGNVKRVLARCYAISGWPGKKEVENALWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT +KP C LCP+Q  C+  +            K+  P RT
Sbjct: 173 PAHGVERFNQAMMDLGAMVCTRSKPKCSLCPLQSGCIAAANESWSRYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G  F+ + ++  ILL +R  + L  G+   P  A        +         N    N  
Sbjct: 233 G-YFLLLQHNKEILLAQRPPSGLWGGLYCFPQFASEDELREWLAQRHVHAD-NLTQLNAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V  +    D   S W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSLDACMDEGGSLWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|293412323|ref|ZP_06655046.1| adenine DNA glycosylase [Escherichia coli B354]
 gi|291469094|gb|EFF11585.1| adenine DNA glycosylase [Escherichia coli B354]
          Length = 350

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 173/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHSGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSERVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-IAADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|89074117|ref|ZP_01160616.1| putative A/G-specific adenine glycosylase [Photobacterium sp.
           SKA34]
 gi|89050053|gb|EAR55579.1| putative A/G-specific adenine glycosylase [Photobacterium sp.
           SKA34]
          Length = 354

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 107/356 (30%), Positives = 168/356 (47%), Gaps = 17/356 (4%)

Query: 7   IIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
                IL WYD   R  LPW+ +         +PYKVW+SEIMLQQT V TV PYF+ FM
Sbjct: 4   TFSDAILAWYDKFGRKTLPWQQN--------KTPYKVWLSEIMLQQTQVATVIPYFESFM 55

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
           +++PT+  L++A+ +E+L  W GLGYY RARNL K A +IV ++ G FP  +  ++ LPG
Sbjct: 56  ERFPTVQDLAAAEQDEVLHLWTGLGYYARARNLHKAAQLIVSEHNGIFPTDIVQVQALPG 115

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTSR 183
           IG  TA A+++++      ++D N++R ++R + I       +    +   A   T    
Sbjct: 116 IGRSTAGAVLSLSLAQHHPILDGNVKRTLARCYAIEGWPGKKIVENKLWQIAETNTPEMG 175

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVF 243
              + QAMMD+GA+ICT +KP C LCP+   C+   E +         KK  P +    F
Sbjct: 176 VERYNQAMMDMGAMICTRSKPKCELCPVSTQCIALKELRQTEFPGKKPKKTLPEKQT-WF 234

Query: 244 IAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTH--SAPFTANWILCNTITH 301
             +   +++ L +R    +  G+   P    +                           H
Sbjct: 235 AILQCGDKVWLEQRPQVGIWGGLWCFPQHDNADLTSLLDKQLGQQLSLIEQQSQLTAFRH 294

Query: 302 TFTHFTLTLFVWKTIV---PQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
           TF+H+ L +      +   P ++      W+D  N     L   ++K L +    +
Sbjct: 295 TFSHYHLDIVPILYELKSQPTVINEALGQWYDLNNPPKIGLAAPVQKILDSLAYSL 350


>gi|308172762|ref|YP_003919467.1| A/G-specific adenine glycosylase [Bacillus amyloliquefaciens DSM 7]
 gi|307605626|emb|CBI41997.1| A/G-specific adenine glycosylase [Bacillus amyloliquefaciens DSM 7]
 gi|328552483|gb|AEB22975.1| A/G-specific adenine glycosylase [Bacillus amyloliquefaciens TA208]
 gi|328910879|gb|AEB62475.1| A/G-specific adenine glycosylase [Bacillus amyloliquefaciens LL3]
          Length = 365

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 109/356 (30%), Positives = 176/356 (49%), Gaps = 18/356 (5%)

Query: 1   MPQPE-HIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M Q +    +  ++ W++   R+LPWR +          PY+VW+SE+MLQQT V+TV P
Sbjct: 8   MKQKDIDKFREDLITWFEREQRILPWREN--------QDPYRVWVSEVMLQQTRVETVIP 59

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF++F++++PT+  L+ A +E++L AW GLGYY+R RNL+     + ++Y G  P + + 
Sbjct: 60  YFRRFVEQFPTVSALAEADEEKVLKAWEGLGYYSRVRNLQSAVQEVHERYGGIVPAEEKE 119

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARK 177
              L G+G YT  A+++IA+N     VD N+ R++SR   I      P      +     
Sbjct: 120 FGGLKGVGPYTKGAVLSIAYNKPIPAVDGNVMRVMSRILSIWDDIAKPKTRTIFEQAVSA 179

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
             S  +P +F Q +M+LGA+ICT   P C LCP+QK+C  F+EG    L + + KKK  +
Sbjct: 180 FISHEKPSEFNQGLMELGAIICTPKSPSCLLCPVQKHCSAFAEGTERELPVKSKKKKPGV 239

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWS-------STKDGNIDTHSAPFT 290
           +T A  +   + + + + KR    LL  + E P +             +  ++       
Sbjct: 240 KTMAAVVLTDDQDNVYIHKRPPKGLLANLWEFPNTETQKGTKTEREQLEAFLEKEMGATA 299

Query: 291 ANWILCNTITHTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKA 346
               L   + H FTH    + V+   V Q+    +        L   A P   +K 
Sbjct: 300 EIGELEGIVEHVFTHLVWNISVFFGKVKQVSDTSELIRVTKGELEEYAFPVSHQKI 355


>gi|212636435|ref|YP_002312960.1| A/G-specific adenine glycosylase MutY [Shewanella piezotolerans
           WP3]
 gi|212557919|gb|ACJ30373.1| A/G-specific adenine glycosylase MutY [Shewanella piezotolerans
           WP3]
          Length = 367

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 177/359 (49%), Gaps = 19/359 (5%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M  P      +I+ WYD + R  LPW+ +         +PYKVWISEIMLQQT V TV P
Sbjct: 14  MKTPA-PFSQRIISWYDLHGRKQLPWQQN--------KTPYKVWISEIMLQQTQVATVIP 64

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF+KF+ ++P+I  L+ A+ +E+L  W GLGYY RARNL K A  IV  ++G+FP   E 
Sbjct: 65  YFEKFISRFPSIEILAGAEQDEVLHHWTGLGYYARARNLHKAAQQIVALHQGSFPVDFED 124

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLY--HKTIKNYARK 177
           +  LPGIG  TA A+++++      ++D N++R+++R+  I            +      
Sbjct: 125 VLSLPGIGRSTAGAVLSLSLGLNHPILDGNVKRVLARHGAIDGWPGKKLVENQLWQLTEA 184

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T       + QAMMD+GA +CT  KP C  CP+  +C     G+         KK  P 
Sbjct: 185 LTPAKEIHKYNQAMMDIGATVCTRTKPNCAACPVAIDCKAQLSGRQLEYPGKKPKKVVPE 244

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
           ++    + + ++N + L+KR  + +  G+   P     +  +  +  H+        L  
Sbjct: 245 KSA-WLLVVEHENHVHLQKRPPSGIWGGLWCFPQFTNQAELEEYLSEHAFNIKHREDLVG 303

Query: 298 TITHTFTHFTLTLFVWKTIVPQIVIIP-----DSTWHDAQNLANAALPTVMKKALSAGG 351
              HTF+HF L +      V +I          S W++  +     L +  ++ L++ G
Sbjct: 304 -FRHTFSHFHLDIQPVLVSVNKISDNQIMEQDSSVWYNLPHPPKVGLASATERILASLG 361


>gi|332086899|gb|EGI92035.1| A/G-specific adenine glycosylase [Shigella boydii 5216-82]
          Length = 350

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 173/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAATNNSWSLYLGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRHWLAQRQ-IAADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|193063588|ref|ZP_03044677.1| A/G-specific adenine glycosylase [Escherichia coli E22]
 gi|194426289|ref|ZP_03058844.1| A/G-specific adenine glycosylase [Escherichia coli B171]
 gi|260845634|ref|YP_003223412.1| adenine DNA glycosylase MutY [Escherichia coli O103:H2 str. 12009]
 gi|293449294|ref|ZP_06663715.1| adenine DNA glycosylase [Escherichia coli B088]
 gi|300824802|ref|ZP_07104906.1| A/G-specific adenine glycosylase [Escherichia coli MS 119-7]
 gi|331669708|ref|ZP_08370554.1| A/G-specific adenine glycosylase [Escherichia coli TA271]
 gi|192930865|gb|EDV83470.1| A/G-specific adenine glycosylase [Escherichia coli E22]
 gi|194415597|gb|EDX31864.1| A/G-specific adenine glycosylase [Escherichia coli B171]
 gi|195183154|dbj|BAG66699.1| adenine DNA glycosylase [Escherichia coli O111:H-]
 gi|257760781|dbj|BAI32278.1| adenine DNA glycosylase MutY [Escherichia coli O103:H2 str. 12009]
 gi|291322384|gb|EFE61813.1| adenine DNA glycosylase [Escherichia coli B088]
 gi|300522709|gb|EFK43778.1| A/G-specific adenine glycosylase [Escherichia coli MS 119-7]
 gi|323162592|gb|EFZ48439.1| A/G-specific adenine glycosylase [Escherichia coli E128010]
 gi|323173814|gb|EFZ59443.1| A/G-specific adenine glycosylase [Escherichia coli LT-68]
 gi|331063376|gb|EGI35289.1| A/G-specific adenine glycosylase [Escherichia coli TA271]
          Length = 350

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 173/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWALYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRHWLAQRQ-IAADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|301019353|ref|ZP_07183538.1| A/G-specific adenine glycosylase [Escherichia coli MS 69-1]
 gi|300399293|gb|EFJ82831.1| A/G-specific adenine glycosylase [Escherichia coli MS 69-1]
          Length = 350

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 173/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHSGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-ISADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|254251384|ref|ZP_04944702.1| A/G-specific DNA glycosylase [Burkholderia dolosa AUO158]
 gi|124893993|gb|EAY67873.1| A/G-specific DNA glycosylase [Burkholderia dolosa AUO158]
          Length = 481

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 105/363 (28%), Positives = 176/363 (48%), Gaps = 26/363 (7%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               S+++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+ +F
Sbjct: 130 RTFASRLIAWQRIHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVIPYYTRF 181

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           ++++P +  L++A  +++++ WAGLGYY+RARNL +CA ++V ++ G FP   + L +LP
Sbjct: 182 LERYPDVAALAAAPIDDVMALWAGLGYYSRARNLHRCAQVVVAEHGGAFPSTPDALAELP 241

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITST- 181
           GIG  TA+AI + A+   A ++D N++R+++R F +            +   A  +    
Sbjct: 242 GIGRSTAAAIASFAYGARATILDGNVKRVLARVFGVEGFPGDKRVENDMWALAESLLPDA 301

Query: 182 ---SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
              +    + Q +MDLGA +C   KP C  CP   +C+  S G+   L     KK  P R
Sbjct: 302 ANAADVSAYTQGLMDLGATLCVRGKPDCARCPFAGDCVAQSTGRQRELPAARPKKTVPTR 361

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
                + + + + +LL +R    +  G+  LP +   +                 +    
Sbjct: 362 RT-WMLVLRDGDAVLLERRPPAGIWGGLWSLPQADGDAALAALARRFGGGGP---VPLAP 417

Query: 299 ITHTFTHFTLTLFVWKTIVPQIVIIP-------DSTWHDAQNLANAALPTVMKKALSAGG 351
           +THTFTHF L +    + V     +P       D+ W     L    +P  ++K L A  
Sbjct: 418 LTHTFTHFRLEIEPRLSDVADGGGLPLAHAQDADTAWVPLSGLDAYGVPAPVRKLLDALS 477

Query: 352 IKV 354
             +
Sbjct: 478 GPL 480


>gi|168463703|ref|ZP_02697620.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197265477|ref|ZP_03165551.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|205354032|ref|YP_002227833.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207858371|ref|YP_002245022.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|195633533|gb|EDX51947.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197243732|gb|EDY26352.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|205273813|emb|CAR38809.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|206710174|emb|CAR34530.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|326629145|gb|EGE35488.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 350

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 112/359 (31%), Positives = 174/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+ +         +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQIN--------KTPYKVWLSEVMLQQTQVTTVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP     + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGEFPQTFAEIA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPG+G  TA AI+++A      ++D N++R+++R + +           T+   + ++T
Sbjct: 113 ALPGVGRSTAGAILSLALGKHYPILDGNVKRVLARCYAVSGWPGKKEVENTLWTLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT +KP C LCP+Q  C+  +            K+  P RT
Sbjct: 173 PARGVERFNQAMMDLGAMVCTRSKPKCTLCPLQNGCIAAAHESWSCYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G  F+ + ++  I L +R  + L  G+   P  A        +         N    N  
Sbjct: 233 G-YFLLLQHNQEIFLAQRPPSGLWGGLYCFPQFASEDELREWLAQRHVNAD-NLTQLNAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V  +    D   + W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSLDACMDEGSALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|307728387|ref|YP_003905611.1| A/G-specific adenine glycosylase [Burkholderia sp. CCGE1003]
 gi|307582922|gb|ADN56320.1| A/G-specific adenine glycosylase [Burkholderia sp. CCGE1003]
          Length = 365

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 108/367 (29%), Positives = 180/367 (49%), Gaps = 24/367 (6%)

Query: 1   MPQPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M         +++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV P
Sbjct: 9   MSPLAPHFAPRLIAWQREHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVIP 60

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           Y+ KF+ ++P +  L++A  +++++ WAGLGYYTRARNL +CA  +V+++ G FP  VE 
Sbjct: 61  YYAKFLARFPDVAALAAAPVDDVMALWAGLGYYTRARNLHRCAQTVVEQHGGAFPASVEQ 120

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARK 177
           L +LPGIG  TA+AI + AF   A ++D N++R+++R F +            +   A  
Sbjct: 121 LAELPGIGRSTAAAIASFAFGARATILDGNVKRVLARVFGVEGFPGEKKVENAMWTLAES 180

Query: 178 ITSTSRPGD----FVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKK 233
           +  ++   D    + Q +MDLGA +C   KP C  CP   +C+    G+   L     KK
Sbjct: 181 LLPSNASDDEVSAYTQGLMDLGATLCVRGKPDCARCPFAADCVANVTGRQRELPAARPKK 240

Query: 234 KRPMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANW 293
             P R     + + + + ++L KR  + +  G+  LP +A  +      +   +      
Sbjct: 241 TVPTRRT-WMLVLRDGDAVMLEKRPPSGIWGGLWSLPEAADEAALAARAEEFGS--AGGV 297

Query: 294 ILCNTITHTFTHFTLTLFVWKTIVPQIV----IIPDST--WHDAQNLANAALPTVMKKAL 347
                +TH FTHF L +      + + V     + D    W    +L +  +P  ++K L
Sbjct: 298 RRLAPLTHVFTHFRLDIEPRLAELDRGVGALAALGDGQTAWVALSDLDSFGVPAPVRKLL 357

Query: 348 SAGGIKV 354
            +    +
Sbjct: 358 DSLQGSL 364


>gi|168819857|ref|ZP_02831857.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205343275|gb|EDZ30039.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|320087545|emb|CBY97309.1| adenine glycosylase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
          Length = 350

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 112/359 (31%), Positives = 175/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+ +         +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQIN--------KTPYKVWLSEVMLQQTQVTTVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP     + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGEFPQTFAEIA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPG+G  TA AI+++A      ++D N++R+++R + +           T+   + ++T
Sbjct: 113 ALPGVGRSTAGAILSLALGKHYPILDGNVKRVLARCYAVSGWPGKKEVENTLWTLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT +KP C LCP+Q  C+  +            K+  P RT
Sbjct: 173 PAHGVERFNQAMMDLGAMVCTRSKPKCTLCPLQNGCIAAAHESWSCYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G  F+ + ++  I L +R  + L  G+   P  A  +     +         N    N  
Sbjct: 233 G-YFLLLQHNQEIFLAQRPPSGLWGGLYCFPQFASEAELREWLAQRHVNAD-NLTQLNAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V  +    D   + W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSLDACMDEGSALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|291086173|ref|ZP_06355020.2| A/G-specific adenine glycosylase [Citrobacter youngae ATCC 29220]
 gi|291068437|gb|EFE06546.1| A/G-specific adenine glycosylase [Citrobacter youngae ATCC 29220]
          Length = 383

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 108/354 (30%), Positives = 173/354 (48%), Gaps = 16/354 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++L WYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 34  MQASQFSAQVLSWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 85

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L+ A  +E+L  W GLGYY RARNL K A  +V  + G FP   + + 
Sbjct: 86  ERFMARFPTVTDLAHAPLDEVLHLWTGLGYYARARNLHKAAQQVVALHGGTFPQTFDEVA 145

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            +   + ++T
Sbjct: 146 ALPGVGRSTAGAILSLSLGQHFPILDGNVKRVLARCYAVSGWPGKKEVEKKLWELSEQVT 205

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT +KP C LCP++  C+  +     L      K+  P RT
Sbjct: 206 PAHGVERFNQAMMDLGAMVCTRSKPKCSLCPLENGCVASANASWALYPGKKPKQTLPERT 265

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G  F+ + +D+ +LL +R  + L  G+   P           +         N    N  
Sbjct: 266 G-YFLLLQHDDEVLLSQRPPSGLWGGLYCFPQFDDEDGLRNWLAQRQINAD-NLTQLNAF 323

Query: 300 THTFTHFTLTLFVWKTIVP---QIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            HTF+HF L +      V      +   ++ W++     +  L   +++ L   
Sbjct: 324 RHTFSHFHLDIVPMWLPVSSFTSCMDEGNALWYNLAQPPSVGLAAPVERLLQQL 377


>gi|52079318|ref|YP_078109.1| putative A/G-specific adenine glycosylase YfhQ [Bacillus
           licheniformis ATCC 14580]
 gi|52784683|ref|YP_090512.1| YfhQ [Bacillus licheniformis ATCC 14580]
 gi|319646897|ref|ZP_08001125.1| YfhQ protein [Bacillus sp. BT1B_CT2]
 gi|52002529|gb|AAU22471.1| putative A/G-specific adenine glycosylase YfhQ [Bacillus
           licheniformis ATCC 14580]
 gi|52347185|gb|AAU39819.1| YfhQ [Bacillus licheniformis ATCC 14580]
 gi|317390956|gb|EFV71755.1| YfhQ protein [Bacillus sp. BT1B_CT2]
          Length = 361

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 110/353 (31%), Positives = 166/353 (47%), Gaps = 17/353 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFK 62
           +     Q  ++ WY+   R LPWR        S   PYKVW+SE+MLQQT V TV PYF 
Sbjct: 11  KNIKQFQEDLISWYEQEKRDLPWR--------SDSDPYKVWVSEVMLQQTRVDTVIPYFN 62

Query: 63  KFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKK 122
            F++K+PT+  L+ A +E++L AW GLGYY+R RNL+     + ++Y G  P   E    
Sbjct: 63  NFIEKFPTVEALAEADEEKVLKAWEGLGYYSRVRNLQSAVREVHERYGGVVPPSKEEFGS 122

Query: 123 LPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITS 180
           L G+G YT  A+++IA+N     VD N+ R++SR   +      P      +       S
Sbjct: 123 LKGVGPYTRGAVLSIAYNQPVPAVDGNVMRVMSRILSVWDDIAKPKTKTLFEKIVEAFIS 182

Query: 181 TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG 240
             +P +F Q +M+LGA+ICT   P C LCP++++C  F+EG    L + + KKK  ++T 
Sbjct: 183 EEKPSEFNQGLMELGAVICTPKSPSCLLCPVREHCSAFAEGCEKELPVKSKKKKPSVKTL 242

Query: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKD-------GNIDTHSAPFTANW 293
           A  +    +  I + KR  + LL  + E P +                +   +       
Sbjct: 243 AAVVLTDEEGYIYIHKRPASGLLANLWEFPNTETQKGLKYEREQLAAFLKEEAGIEAEIG 302

Query: 294 ILCNTITHTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKA 346
            L   + H FTH    + V+                  + LA  A P   +K 
Sbjct: 303 PLEGVVEHVFTHLVWNISVFFGKTLDQPDDSYFKKVTKEELAEYAFPVSHQKI 355


>gi|311278122|ref|YP_003940353.1| A/G-specific adenine glycosylase [Enterobacter cloacae SCF1]
 gi|308747317|gb|ADO47069.1| A/G-specific adenine glycosylase [Enterobacter cloacae SCF1]
          Length = 350

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 107/354 (30%), Positives = 167/354 (47%), Gaps = 16/354 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQPSEFSAQVLDWYDKYGRKTLPWQI--------EKTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   + + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHNGQFPETFDEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            +   +  +T
Sbjct: 113 ALPGVGRSTAGAILSLSLGQHFPILDGNVKRVLARCYAVGGWPGKKEVENRLWQISEAVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT +KP C LCP+   C   +            K+  P R+
Sbjct: 173 PAKGVERFNQAMMDLGAMVCTRSKPKCELCPLGNGCEAKASSSWAQYPGKKPKQTLPERS 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    DN +LL +R  + L  G+   P  A  +     +         N       
Sbjct: 233 GYFLLM-QQDNDVLLLQRPPSGLWGGLFCFPQFADEAALREWLAQRQIKAD-NLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAG 350
            HTF+HF L +      V       D   + W++     +  L   +++ L   
Sbjct: 291 RHTFSHFHLDIVPMWLTVHSSAACMDEGGALWYNLAQPPSVGLAAPVERLLQQL 344


>gi|82778267|ref|YP_404616.1| adenine DNA glycosylase [Shigella dysenteriae Sd197]
 gi|309785210|ref|ZP_07679841.1| A/G-specific adenine glycosylase [Shigella dysenteriae 1617]
 gi|81242415|gb|ABB63125.1| adenine glycosylase [Shigella dysenteriae Sd197]
 gi|308926330|gb|EFP71806.1| A/G-specific adenine glycosylase [Shigella dysenteriae 1617]
          Length = 350

 Score =  249 bits (636), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 173/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAATNNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-IAADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 QHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|196250626|ref|ZP_03149315.1| A/G-specific adenine glycosylase [Geobacillus sp. G11MC16]
 gi|196209845|gb|EDY04615.1| A/G-specific adenine glycosylase [Geobacillus sp. G11MC16]
          Length = 368

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 113/351 (32%), Positives = 171/351 (48%), Gaps = 16/351 (4%)

Query: 4   PEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKK 63
           P    Q  +LDW+    R LPWR            PYKVW+SE+MLQQT V+TV PYF+K
Sbjct: 11  PAREFQRDLLDWFARERRDLPWRQD--------RDPYKVWVSEVMLQQTRVETVIPYFEK 62

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           F++++PT+  L+ A ++E+L AW GLGYY+R RNL      + ++Y G  P   +   KL
Sbjct: 63  FIRQFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKERYGGKVPDNPDEFSKL 122

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPL--YHKTIKNYARKITST 181
            G+G YT  A++++A+      VD N+ R++SR F +          K  +   R+I + 
Sbjct: 123 KGVGPYTVGAVLSLAYGVPEPAVDGNVMRVLSRLFLVTDDIAKASTRKRFEQIVREIMAY 182

Query: 182 SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGA 241
            +PG F +A+++LGAL+CT  +P C LCP+Q +C  F+EG    L + T K        A
Sbjct: 183 EQPGAFNEALIELGALVCTPRRPSCLLCPVQAHCRAFAEGVPEELPVKTKKTAVKQVPLA 242

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAWS-----STKDGNIDTHSAPFTANWILC 296
           V +    D RIL+RKR +T LL  + E P             +                 
Sbjct: 243 VAVLTDQDGRILIRKRDHTGLLANLWEFPSCEMKGEGETENLERAFLNEQGLDVKLGEPI 302

Query: 297 NTITHTFTHFTLTLFVWKTIVPQIVIIPD-STWHDAQNLANAALPTVMKKA 346
            +  H F+H    L V+   +     + +       + L   A P   ++ 
Sbjct: 303 ASFDHVFSHLVWKLTVFYGRLLDGERLEEPYRLVSERELETYAFPVSHQRV 353


>gi|152994789|ref|YP_001339624.1| A/G-specific adenine glycosylase [Marinomonas sp. MWYL1]
 gi|150835713|gb|ABR69689.1| A/G-specific adenine glycosylase [Marinomonas sp. MWYL1]
          Length = 350

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 113/355 (31%), Positives = 184/355 (51%), Gaps = 15/355 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
           QP      ++L W+D + R  LPW+ +         +PY+VWISEIMLQQT V TV PY+
Sbjct: 2   QPVENFAPRVLAWFDEHGRKSLPWQEN--------KTPYRVWISEIMLQQTQVTTVIPYY 53

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            KFM  +PT+  L+ A+ +E+L+ W+GLGYY RARN+ K A ++V +++  FP  VE + 
Sbjct: 54  HKFMTSFPTVEALAEAEQDEVLAHWSGLGYYARARNMHKAAKMLVDEFDSEFPQTVEGVC 113

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
           +LPGIG  TA+AI++I+    A ++D N++R+++R+  +            +   A    
Sbjct: 114 ELPGIGRSTAAAILSISRGVQAAILDGNVKRVLARFHAVPTWPGDKKTENAMWELAECYM 173

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTF-SEGKSHLLGINTIKKKRPMR 238
              R GD+ QAMMDLGA +CT +KP C LCP+Q +C    ++  +        K  +P +
Sbjct: 174 PNERCGDYTQAMMDLGATLCTRSKPQCLLCPLQDDCQARLTQDPTQFPIRKPKKSAKPEK 233

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
           +  + + +    + LL KR +T +  G+  LP  A+  +   +I+   A         + 
Sbjct: 234 SIQLLVLMNQQGQWLLEKRPSTGIWGGLWSLPELAFDESVVLHIEQRFATQVEAVTPLSP 293

Query: 299 ITHTFTHFTLTL---FVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
             HTF+H+ L +    +       ++      W   Q+     LP  ++  L   
Sbjct: 294 FRHTFSHYHLDISPSHIQIADTKLVMEGEKYQWFSQQDAMAQGLPAPVRSILEQL 348


>gi|323139601|ref|ZP_08074645.1| A/G-specific adenine glycosylase [Methylocystis sp. ATCC 49242]
 gi|322395151|gb|EFX97708.1| A/G-specific adenine glycosylase [Methylocystis sp. ATCC 49242]
          Length = 355

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 137/346 (39%), Positives = 185/346 (53%), Gaps = 7/346 (2%)

Query: 9   QSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKW 68
            + +L WYD + R LPWR  P         PY VW+SEIMLQQTTV TV+ YF KF+ +W
Sbjct: 12  AAALLAWYDAHRRELPWRARPGEAV----DPYAVWLSEIMLQQTTVATVKGYFLKFLARW 67

Query: 69  PTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGD 128
           P++  L+    EE L+ WAGLGYY RARNL  CA ++ +++ G FP   E L  LPGIG 
Sbjct: 68  PSVEALAETPLEETLAEWAGLGYYARARNLHACAGVVAREFGGRFPASEEALLGLPGIGP 127

Query: 129 YTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFV 188
           YTA+AI AIAFN   V VD N+ER+I+R   I  P       I+   + +   SR GDF 
Sbjct: 128 YTAAAIAAIAFNQPCVAVDGNVERVIARLHAIDTPPRRAKPLIRETTQAMLPPSRAGDFA 187

Query: 189 QAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITN 248
           QA+MDLGA +C    P CP CP+   C    +G      +   + ++P R GA+F  +  
Sbjct: 188 QALMDLGATVCAPRAPDCPACPLADFCAACRDGTQDRYPVKEARAEKPKRRGAIF-ILRR 246

Query: 249 DNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT-ITHTFTHFT 307
            + +LLR+R    LL GM+E P +  +           AP  A W      ++H FTHF+
Sbjct: 247 GDEVLLRRRPPKGLLGGMNEFPSTPLTQDVAPKELRDHAPCAAPWRALEEPVSHVFTHFS 306

Query: 308 LTLFVWKTIVPQIVIIP-DSTWHDAQNLANAALPTVMKKALSAGGI 352
           L+  V+            +  W    NL    LPT+M+KA    G+
Sbjct: 307 LSATVFVAKTAAAAPPAHNCRWAACDNLDKEGLPTLMRKAAIRAGL 352


>gi|300980151|ref|ZP_07174863.1| A/G-specific adenine glycosylase [Escherichia coli MS 45-1]
 gi|301049242|ref|ZP_07196216.1| A/G-specific adenine glycosylase [Escherichia coli MS 185-1]
 gi|300298975|gb|EFJ55360.1| A/G-specific adenine glycosylase [Escherichia coli MS 185-1]
 gi|300409352|gb|EFJ92890.1| A/G-specific adenine glycosylase [Escherichia coli MS 45-1]
 gi|315293943|gb|EFU53295.1| A/G-specific adenine glycosylase [Escherichia coli MS 153-1]
          Length = 350

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 173/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMVRFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVAALHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-IAADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEDNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|262042612|ref|ZP_06015768.1| A/G-specific adenine glycosylase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259040046|gb|EEW41161.1| A/G-specific adenine glycosylase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 352

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 107/361 (29%), Positives = 171/361 (47%), Gaps = 16/361 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M        +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV P
Sbjct: 1   MTFLATQFSAQVLDWYDKYGRKTLPWQI--------AKTPYKVWLSEVMLQQTQVTTVIP 52

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   + 
Sbjct: 53  YFERFMARFPTVVDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGEFPRTFDE 112

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARK 177
           +  LPG+G  TA AI++++      ++D N++R+++R + +            + + + +
Sbjct: 113 VAALPGVGRSTAGAILSLSLGQHYPILDGNVKRVLARCYAVSGWPGKKEVEKRLWDISEE 172

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T       F QAMMDLGA++CT +KP C LCP+   C+ ++            K+  P 
Sbjct: 173 VTPAEGVERFNQAMMDLGAMVCTRSKPKCELCPLSNGCVAYANHSWAEYPGKKPKQTLPE 232

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
           RTG   +    D  + L +R    L  G+   P  A  +     +         N     
Sbjct: 233 RTGYFLLMQHGDE-VFLSQRPPVGLWGGLFCFPQFADEAELREWLAQRQIKAD-NLTQLT 290

Query: 298 TITHTFTHFTLTLFVWKTIVPQI---VIIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
              HTF+HF L +      V      +   ++ W++     +  L   +++ L       
Sbjct: 291 AFRHTFSHFHLDIIPMWLTVHSSGACMDEGNALWYNLAQPPSVGLAAPVERLLQQLKAGA 350

Query: 355 P 355
           P
Sbjct: 351 P 351


>gi|90425840|ref|YP_534210.1| A/G-specific adenine glycosylase [Rhodopseudomonas palustris
           BisB18]
 gi|90107854|gb|ABD89891.1| A/G-specific DNA-adenine glycosylase [Rhodopseudomonas palustris
           BisB18]
          Length = 371

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 143/352 (40%), Positives = 186/352 (52%), Gaps = 10/352 (2%)

Query: 4   PEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKK 63
           P       +L WYD + R LPWR  P         PY+VW+SEIMLQQTTVK V PYF+K
Sbjct: 16  PGSAYPRLLLAWYDRHRRALPWRALPGQAA----DPYRVWLSEIMLQQTTVKAVGPYFEK 71

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           F+ +WP +  L  A  +++L  WAGLGYY+RARNL  CA  + + + G FP     L+ L
Sbjct: 72  FLARWPNVAALGRASQDDVLRMWAGLGYYSRARNLFACAVAVSRDHGGAFPDTEAGLRAL 131

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSR 183
           PGIG YTA+AI AIAF    + VD NIER++SR F +    P     I   A  +   +R
Sbjct: 132 PGIGPYTAAAIAAIAFGRHCMPVDGNIERVVSRLFAVEDALPQAKPKISELALTLAGEAR 191

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVF 243
            GD  QA+MDLGA ICT  KP C LCP+ ++C+  S G          K    +R GA F
Sbjct: 192 AGDSAQALMDLGATICTPKKPACALCPLNEDCVARSRGDQETFPRKAAKTTGKLRRGAAF 251

Query: 244 IAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPF---TANWILC-NTI 299
           +    D  ++  +     LL GM E+PGS W + +D  I    AP     A W      +
Sbjct: 252 VVRRGDELLVRSRA-EKGLLGGMTEVPGSDWIADQDDTIARQQAPALPGVARWQRKPGVV 310

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIP-DSTWHDAQNLANAALPTVMKKALSAG 350
            H FTHF L L V+   +P     P    W     L + ALP VM+K ++ G
Sbjct: 311 NHVFTHFPLELVVYTATMPARSRAPIGMRWVKIATLQHEALPNVMRKVIAHG 362


>gi|163745414|ref|ZP_02152774.1| A/G-specific adenine glycosylase, putative [Oceanibulbus indolifex
           HEL-45]
 gi|161382232|gb|EDQ06641.1| A/G-specific adenine glycosylase, putative [Oceanibulbus indolifex
           HEL-45]
          Length = 354

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 145/339 (42%), Positives = 200/339 (58%), Gaps = 3/339 (0%)

Query: 12  ILDWYDTNHRVLPWRTSPKTE-KSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPT 70
           +L+WYDT+ R LPWR  P        P PY++W+SE+MLQQTTV TV+ YF +F  +WP 
Sbjct: 14  LLEWYDTHARALPWRVPPHDRMAGVTPDPYRIWLSEVMLQQTTVATVKDYFARFTTRWPD 73

Query: 71  IFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYT 130
           +  L++A D+++++ WAGLGYY RARNL KCA  +V ++ GNFP   + L KLPGIG YT
Sbjct: 74  VGALAAAADKDVMAEWAGLGYYARARNLLKCARAVVAEHGGNFPADHDALLKLPGIGPYT 133

Query: 131 ASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQA 190
           A+AI +IAF+    V+D N+ER+++R ++I  P P     +   A  +T   RPGD+ QA
Sbjct: 134 AAAISSIAFDLPHAVLDGNVERVMARVYNIHTPLPAAKPELMARAVALTPQGRPGDYAQA 193

Query: 191 MMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDN 250
           +MDLGA ICT   P C +CP ++ C+  +EG + LL   T KK +P+R G V++A   D 
Sbjct: 194 VMDLGATICTPKSPACGICPWREPCVARAEGTAALLPKKTPKKPKPVRHGTVYLAQREDG 253

Query: 251 RILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILC-NTITHTFTHFTLT 309
             LL  R +  LL GM   PGS W  T +      + P TA+W      + HTFTHF L 
Sbjct: 254 AWLLETRPDKGLLGGMLGWPGSDWIDTSEPR-PEGTPPMTADWQPLPGEVRHTFTHFHLM 312

Query: 310 LFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALS 348
           L V    V          +      + + LPTVM+KA  
Sbjct: 313 LTVQHARVGHGTAPEIGEFIGQNQFSPSDLPTVMRKAFD 351


>gi|16761886|ref|NP_457503.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29143373|ref|NP_806715.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213425494|ref|ZP_03358244.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213609558|ref|ZP_03369384.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213646177|ref|ZP_03376230.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213850187|ref|ZP_03381085.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|289825380|ref|ZP_06544624.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|25292161|pir||AG0879 A/G-specific adenine glycosylase STY3265 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16504188|emb|CAD02935.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29139007|gb|AAO70575.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
          Length = 350

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 112/359 (31%), Positives = 174/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+ +         +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQIN--------KTPYKVWLSEVMLQQTQVTTVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP     + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGEFPQTFAEIA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPG+G  TA AI+++A      ++D N++R+++R + +           T+   + ++T
Sbjct: 113 ALPGVGRSTAGAILSLALGKHYPILDGNVKRVLARCYAVSGWPGKKEVENTLWTLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT +KP C LCP+Q  C+  +            K+  P RT
Sbjct: 173 PARGVERFNQAMMDLGAMVCTRSKPKCTLCPLQNGCIAAAHESWSRYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G  F+ + ++  I L +R  + L  G+   P  A        +         N    N  
Sbjct: 233 G-YFLLLQHNQEIFLAQRPPSGLWGGLYCFPQFASEDELREWLAQRHVNAD-NLTQLNAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V  +    D   + W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSLDACMDEGGALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|104784110|ref|YP_610608.1| A/G specific adenine glycosylase [Pseudomonas entomophila L48]
 gi|95113097|emb|CAK17825.1| A/G specific adenine glycosylase [Pseudomonas entomophila L48]
          Length = 355

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 126/358 (35%), Positives = 182/358 (50%), Gaps = 15/358 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  S +L WYD + R  LPW+           +PY+VW+SEIMLQQT V TV  YF
Sbjct: 1   MTPQQFSSAVLAWYDQHGRHDLPWQQ--------GITPYRVWVSEIMLQQTQVSTVLNYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FMQ  PT+  L+ A ++E+L  W GLGYYTRARNL+K A I+V+++ G FP  VE L 
Sbjct: 53  DRFMQALPTVQALAEAPEDEVLHLWTGLGYYTRARNLQKAAKIVVEQHGGEFPRSVEQLT 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
           +LPGIG  TA AI +I+    A ++D N++R+++R+         P     +   A ++T
Sbjct: 113 ELPGIGRSTAGAIASISMGIRAPILDGNVKRVLARFTAQAGYPGEPKVANQLWATAERVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             +R   F QAMMD+GA +CT +KP C +CP+Q+ C     G+         +K  P R 
Sbjct: 173 PMTRVNHFTQAMMDMGATLCTRSKPSCLICPLQRGCEAHLHGEETRYPEPKPRKALPQRK 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +    +  ILL +R +T L  G+  LP        D     H      +  L   +
Sbjct: 233 TLMPLLTNPEGAILLYRRPSTGLWGGLWSLPELDNLEQLDDLAYQHGLRLAGSQALAG-L 291

Query: 300 THTFTHFTLTLFVWKTIVPQI---VIIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
           THTF+HF L +  W   V  +   V  PD  W++        L   +KK L     ++
Sbjct: 292 THTFSHFQLAIEPWLVRVDPVGPHVAEPDWLWYNLATPPRLGLAAPVKKLLQRAADEL 349


>gi|258625599|ref|ZP_05720481.1| A/G-specific adenine glycosylase [Vibrio mimicus VM603]
 gi|258582101|gb|EEW06968.1| A/G-specific adenine glycosylase [Vibrio mimicus VM603]
          Length = 369

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 105/351 (29%), Positives = 174/351 (49%), Gaps = 17/351 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
               IL WYD   R  LPW+ +         + Y+VW+SEIMLQQT V TV PYF++F++
Sbjct: 20  FAQAILTWYDAYGRKNLPWQQN--------KNAYRVWLSEIMLQQTQVATVIPYFERFLE 71

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A  +E+L  W GLGYY RARNL K A ++V +Y G FP  +E +  LPG+
Sbjct: 72  RFPTVQALAAAPQDEVLHFWTGLGYYARARNLHKAAQMVVNEYGGEFPIDLEQMNALPGV 131

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++  +     ++D N++R ++R F +            + +YA   T +   
Sbjct: 132 GRSTAAAVLSSVYKKPHAILDGNVKRTLARCFAVEGWPGQKSVENQLWHYAEMHTPSVDV 191

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA+ICT +KP C LCP++  CL   +G          K  +P++    F+
Sbjct: 192 DKYNQAMMDMGAMICTRSKPKCSLCPVESFCLAKQQGNPQDYPGKKPKTDKPVKET-WFV 250

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSA-PFTANWILCNTITHTF 303
            + +D+ + L +R  T +  G+   P S  ++ +              +        HTF
Sbjct: 251 MLYHDDAVWLEQRPQTGIWGGLYCFPQSEIANIQTTIDQRAIGDSTITSQKTLIAFRHTF 310

Query: 304 THFTLTLFVWKTIVPQIV----IIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ L +      + +            W++        L   +K+ L + 
Sbjct: 311 SHYHLDITPILLELSRKPDIVMEGSKGLWYNLSQPDEIGLAAPVKQLLHSL 361


>gi|109896407|ref|YP_659662.1| A/G-specific adenine glycosylase [Pseudoalteromonas atlantica T6c]
 gi|109698688|gb|ABG38608.1| A/G-specific DNA-adenine glycosylase [Pseudoalteromonas atlantica
           T6c]
          Length = 354

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 123/350 (35%), Positives = 185/350 (52%), Gaps = 17/350 (4%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               ++IL W+D++ R  LPW+           +PY VW+SEIMLQQT VKTV PY++KF
Sbjct: 9   SSFANRILTWFDSHGRKDLPWQQ--------GKTPYSVWVSEIMLQQTQVKTVIPYYQKF 60

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M ++P I  L++A  +E+L  W GLGYY RARNL+K A +I  +Y G FP  +  +  LP
Sbjct: 61  MLRFPDILSLANAPQDEVLHHWTGLGYYARARNLQKAAQVIRDEYGGVFPPDINDVVALP 120

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLY--HKTIKNYARKITSTS 182
           GIG  TA A++++A      ++D N++R+++RYF +          + +  YA  +T +S
Sbjct: 121 GIGRSTAGAVLSLACGQHHSILDGNVKRVLARYFAVDGWPGKKDVEQALWQYADSLTPSS 180

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
           R GD+ QAMMD+GA ICT +KP C  CP+Q++CL F++G+   L     KK  P+RT  +
Sbjct: 181 RTGDYTQAMMDMGATICTRSKPKCDNCPLQQSCLAFAQGRQSELPGKKPKKDIPVRTTVM 240

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHT 302
            I     +++L+ +R +T L  G+     +      D                     HT
Sbjct: 241 LIP-MWQSQVLIYQRPSTGLWGGLWGFYEADTLEALDKTAQQLGLSDYTRVT-LEPFRHT 298

Query: 303 FTHFTLTLFVWKTIVPQIVIIP----DSTWHDAQNLANAALPTVMKKALS 348
           F+HF L +      + Q   +        W+D  N  N  L    KK L+
Sbjct: 299 FSHFHLDIQPVILQLAQPTSLQINEKQQIWYDLLNQPNVGLAAPTKKLLT 348


>gi|254262213|emb|CAZ90540.1| A/G-specific adenine glycosylase mutY [Enterobacter helveticus]
          Length = 384

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 105/356 (29%), Positives = 167/356 (46%), Gaps = 16/356 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           +         ++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV P
Sbjct: 33  LMMQPQQFSRQVLDWYDKYGRKTLPWQQ--------EKTPYKVWLSEVMLQQTQVTTVIP 84

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF++FM ++PT+  L+ A  +E+L  W GLGYY RARNL K A  +   + G FP   + 
Sbjct: 85  YFERFMARFPTVSDLADAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGQFPDTFDA 144

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARK 177
           +  LPG+G  TA A+++++      ++D N++R+++R + +          K +   +  
Sbjct: 145 VSALPGVGRSTAGAVLSLSLGQRFPILDGNVKRVLARCYAVEGWPGRKEVEKRLWEISDA 204

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T       F QAMMDLGAL+CT +KP C +CP+   C+ +++G          K++ P 
Sbjct: 205 VTPAQGVERFNQAMMDLGALVCTRSKPKCEICPLNNGCVAYAQGSWAKYPGKKPKQQLPE 264

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
           +TG   +    D  + L +R  + L  G+   P  A  +     +               
Sbjct: 265 KTGYFLLMQQGDE-VYLNQRPPSGLWGGLFCFPQFASEADLRAWLHE-RGVEAHGLTQLT 322

Query: 298 TITHTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAG 350
              HTF+HF L +      V       D     W++        L   +++ L   
Sbjct: 323 AFRHTFSHFHLDIVPMWLSVSGSGACMDEGTGLWYNLALPPAVGLAAPVERLLQQL 378


>gi|323669731|emb|CBJ94855.1| A/G-specific adenine glycosylase [Salmonella bongori]
          Length = 350

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 117/359 (32%), Positives = 177/359 (49%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+ +         SPYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQMN--------KSPYKVWLSEVMLQQTQVTTVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L+ A  +E+L  W GLGYY RARNL K A  +V  + G FP   + + 
Sbjct: 53  ERFMARFPTVTDLAKAPLDEVLHLWTGLGYYARARNLHKAAQQVVALHGGKFPQTFDEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPG+G  TA A++++A      ++D N++R+++R + I           T+ + + ++T
Sbjct: 113 ALPGVGRSTAGAVLSLALGKHYPILDGNVKRVLARCYAISGWPGKKEVENTLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +            K+  P RT
Sbjct: 173 PAHGVERFNQAMMDLGAMICTRSKPKCSLCPLQSGCIAAANESWSRYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G  F+ + ++  ILL +R  + L  G+   P  A        +         N    N  
Sbjct: 233 G-YFLLLQHNKEILLAQRPPSGLWGGLYCFPQFASEDELREWLAQRHVHAD-NLTQLNAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V  +    D   S W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSLDACMDEGGSLWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|146339051|ref|YP_001204099.1| adenine glycosylase mutY [Bradyrhizobium sp. ORS278]
 gi|146191857|emb|CAL75862.1| adenine glycosylase mutY [Bradyrhizobium sp. ORS278]
          Length = 364

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 149/346 (43%), Positives = 193/346 (55%), Gaps = 10/346 (2%)

Query: 10  SKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWP 69
           +++L WYD + R LPWR            PY+VW+SEIMLQQTTVK V PYF+KF+ +WP
Sbjct: 21  AQLLAWYDRHRRRLPWRAPSGQRS----DPYRVWLSEIMLQQTTVKAVGPYFEKFLARWP 76

Query: 70  TIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDY 129
            +  L SA  E++L  WAGLGYY+RARNL  CA  +++++ G FP   E L+KLPGIG Y
Sbjct: 77  DVSALGSADLEDVLRMWAGLGYYSRARNLHACAVTVLREHGGVFPDTEEGLRKLPGIGPY 136

Query: 130 TASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQ 189
           TA+AI AIAF+   + VD NIER+ +R F + +  P     I+  A  +   SR GD  Q
Sbjct: 137 TAAAIAAIAFDRQTMPVDGNIERVTTRLFRVEQALPQAKPQIQALAATLLGPSRAGDSAQ 196

Query: 190 AMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITND 249
           A+MDLGA ICT  KP C LCP+ ++C     G          KK   +R GA F+ +  D
Sbjct: 197 ALMDLGATICTPKKPACSLCPLNEDCAARQHGDQETFPRKAAKKTGTLRRGAAFVVVRGD 256

Query: 250 NRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTAN----WILCNTITHTFTH 305
             +L+R R    LL GM E+PGS W +  D       AP  A           +TH FTH
Sbjct: 257 E-LLVRSRPAKGLLGGMTEVPGSNWLAGHDDVEALAQAPDIAAVKRWHRKLGVVTHVFTH 315

Query: 306 FTLTLFVWKTIVPQIVIIPDS-TWHDAQNLANAALPTVMKKALSAG 350
           F L L V+   VP     PD   W     L   ALP VM+K ++ G
Sbjct: 316 FPLELVVYTATVPARTRAPDGMRWAKIATLDGEALPNVMRKVVAHG 361


>gi|152971911|ref|YP_001337020.1| adenine DNA glycosylase [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|150956760|gb|ABR78790.1| adenine DNA glycosylase [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
          Length = 352

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 107/361 (29%), Positives = 171/361 (47%), Gaps = 16/361 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M        +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV P
Sbjct: 1   MTFLATQFSAQVLDWYDKYGRKTLPWQI--------AKTPYKVWLSEVMLQQTQVTTVIP 52

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   + 
Sbjct: 53  YFERFMARFPTVVDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGEFPRTFDE 112

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARK 177
           +  LPG+G  TA AI++++      ++D N++R+++R + +            + + + +
Sbjct: 113 VAALPGVGRSTAGAILSLSLGQHYPILDGNVKRVLARCYAVSGWPGKKEVEKRLWDISEE 172

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T       F QAMMDLGA++CT +KP C LCP+   C+ ++            K+  P 
Sbjct: 173 VTPAEGVERFNQAMMDLGAMVCTRSKPKCELCPLSNGCVAYANHSWAEYPGKKPKQTLPE 232

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
           RTG   +    D  + L +R    L  G+   P  A  +     +         N     
Sbjct: 233 RTGYFLLMQHGDE-VFLSQRPPVGLWGGLFCFPQFADEAELREWLAQRQIKAD-NLTQLT 290

Query: 298 TITHTFTHFTLTLFVWKTIVPQI---VIIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
              HTF+HF L +      V      +   ++ W++     +  L   +++ L       
Sbjct: 291 AFRHTFSHFHLDIVPMWLTVHSSGACMDEGNALWYNLAQPPSVGLAAPVERLLQQLKAGA 350

Query: 355 P 355
           P
Sbjct: 351 P 351


>gi|322613507|gb|EFY10448.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322621099|gb|EFY17957.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322624163|gb|EFY20997.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322628098|gb|EFY24887.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322633217|gb|EFY29959.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322636205|gb|EFY32913.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322639543|gb|EFY36231.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322647524|gb|EFY44013.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322648708|gb|EFY45155.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322653763|gb|EFY50089.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322657869|gb|EFY54137.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322663972|gb|EFY60171.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322669017|gb|EFY65168.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322672989|gb|EFY69096.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322678020|gb|EFY74083.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322681196|gb|EFY77229.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322687874|gb|EFY83841.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323194930|gb|EFZ80117.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323199634|gb|EFZ84724.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202619|gb|EFZ87659.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323207894|gb|EFZ92840.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323212554|gb|EFZ97371.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323214963|gb|EFZ99711.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323222693|gb|EGA07058.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323225436|gb|EGA09668.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323230549|gb|EGA14667.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323235100|gb|EGA19186.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323239139|gb|EGA23189.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323244503|gb|EGA28509.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323247118|gb|EGA31084.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323253399|gb|EGA37228.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323256294|gb|EGA40030.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323262530|gb|EGA46086.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323267374|gb|EGA50858.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323269222|gb|EGA52677.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 350

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 112/359 (31%), Positives = 175/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+ +         +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQIN--------KTPYKVWLSEVMLQQTQVTTVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP     + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGEFPQTFAEIA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPG+G  TA AI+++A      ++D N++R+++R + +           T+   + ++T
Sbjct: 113 ALPGVGRSTAGAILSLALGKHYPILDGNVKRVLARCYAVSGWPGKKEVENTLWTLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT +KP C LCP+Q +C+  +            K+  P RT
Sbjct: 173 PARGVERFNQAMMDLGAMVCTRSKPKCTLCPLQNSCIAAAHESWSRYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G  F+ + ++  I L +R  + L  G+   P  A        +         N    N  
Sbjct: 233 G-YFLLLQHNQEIFLAQRPPSGLWGGLYCFPQFASEDELREWLAQRHVNAD-NLTQLNAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V  +    D   + W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSLDACMDEGSALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|146284409|ref|YP_001174562.1| A / G specific adenine glycosylase [Pseudomonas stutzeri A1501]
 gi|145572614|gb|ABP81720.1| A / G specific adenine glycosylase [Pseudomonas stutzeri A1501]
          Length = 355

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 119/358 (33%), Positives = 181/358 (50%), Gaps = 15/358 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  + +LDW+D + R  LPW+           +PY+VW+SEIMLQQT V TV  YF
Sbjct: 1   MSPEQFGAAVLDWFDRHGRKDLPWQQD--------ITPYRVWVSEIMLQQTQVSTVLGYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FM   P++  L+ A+++E+L  W GLGYY+RARNL K A +IV +Y+G FP  V+ L 
Sbjct: 53  DRFMDALPSVEALAKAEEDEVLHLWTGLGYYSRARNLHKTAKVIVAEYDGIFPADVDKLA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
           +LPGIG  TA AI +I+    A ++D N++R+++RY         P   + +   A + T
Sbjct: 113 ELPGIGRSTAGAIASISLGLRAPILDGNVKRVLARYVAQDGYPGEPKVARQLWEVAERFT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              R   + QAMMDLGA +CT ++P C LCP++  C     G+     +   +K  P + 
Sbjct: 173 PQQRVNHYTQAMMDLGATLCTRSRPSCLLCPLKDGCRAHLLGRETDFPVPKPRKALPQKR 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +    D  ILL +R ++ L  G+  LP     +  D   + H+     +      +
Sbjct: 233 TLMPLLANRDGAILLYRRPSSGLWGGLWSLPELDDLAALDPLAERHALQL-EDRRELPGL 291

Query: 300 THTFTHFTLTLFVWKTIV---PQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
           THTF+HF L +  W   V   P  V   D  W++        L   +K  L     ++
Sbjct: 292 THTFSHFQLAIEPWLIRVKTAPDAVAEADWLWYNLATPPRLGLAAPVKTLLKRAAAEL 349


>gi|56415048|ref|YP_152123.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62181621|ref|YP_218038.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|168236178|ref|ZP_02661236.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|194737851|ref|YP_002116058.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197363977|ref|YP_002143614.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|200388239|ref|ZP_03214851.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|224584904|ref|YP_002638703.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|56129305|gb|AAV78811.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62129254|gb|AAX66957.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|194713353|gb|ACF92574.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197095454|emb|CAR61013.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|197290729|gb|EDY30083.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|199605337|gb|EDZ03882.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|224469432|gb|ACN47262.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|322716104|gb|EFZ07675.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 350

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 112/359 (31%), Positives = 174/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+ +         +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQIN--------KTPYKVWLSEVMLQQTQVTTVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP     + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGEFPQTFAEIA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPG+G  TA AI+++A      ++D N++R+++R + +           T+   + ++T
Sbjct: 113 ALPGVGRSTAGAILSLALGKHYPILDGNVKRVLARCYAVSGWPGKKEVENTLWTLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT +KP C LCP+Q  C+  +            K+  P RT
Sbjct: 173 PARGVERFNQAMMDLGAMVCTRSKPKCTLCPLQNGCIAAAHESWSRYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G  F+ + ++  I L +R  + L  G+   P  A        +         N    N  
Sbjct: 233 G-YFLLLQHNQEIFLAQRPPSGLWGGLYCFPQFASEDELREWLAQRHVNAD-NLTQLNAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V  +    D   + W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSLDACMDEGSALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|197251051|ref|YP_002148025.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197214754|gb|ACH52151.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
          Length = 350

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 112/359 (31%), Positives = 175/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+ +         +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQIN--------KTPYKVWLSEVMLQQTQVTTVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP     + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGEFPQTFAEIA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPG+G  TA AI+++A      ++D N++R+++R + +           T+   + ++T
Sbjct: 113 ALPGVGRSTAGAILSLALGKHYPILDGNVKRVLARCYAVSGWPGKKEVENTLWTLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT +KP C LCP+Q  C+  +            K+  P RT
Sbjct: 173 PARGVERFNQAMMDLGAMVCTRSKPKCTLCPLQNGCIAAAHESWSRYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G  F+ + ++  I L +R  + L  G+   P  A  +     +         N    N  
Sbjct: 233 G-YFLLLQHNQEIFLAQRPPSGLWGGLYCFPQFASEAELREWLAQRHVNAD-NLTQLNAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V  +    D   + W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSLDACMDEGSALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|238909908|ref|ZP_04653745.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
          Length = 350

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 174/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+ +         +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQIN--------KTPYKVWLSEVMLQQTQVTTVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP     + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGEFPQTFAEIA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPG+G  TA AI+++A      ++D N++R+++R + +           T+   + ++T
Sbjct: 113 ALPGVGRSTAGAILSLALGKHYPILDGNVKRVLARCYAVSGWPGKKEVENTLWTLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAM+DLGA++CT +KP C LCP+Q  C+  +            K+  P RT
Sbjct: 173 PARGVERFNQAMIDLGAMVCTRSKPKCTLCPLQNGCIAAAHESWSRYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G  F+ + ++  I L +R  + L  G+   P  A        +         N    N  
Sbjct: 233 G-YFLLLQHNQEIFLAQRPPSGLWGGLYCFPQFASEDELREWLAQRHVNAD-NLTQLNAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V  +    D   + W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSLDACMDEGSALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|194431805|ref|ZP_03064096.1| A/G-specific adenine glycosylase [Shigella dysenteriae 1012]
 gi|194420161|gb|EDX36239.1| A/G-specific adenine glycosylase [Shigella dysenteriae 1012]
          Length = 360

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 111/360 (30%), Positives = 173/360 (48%), Gaps = 16/360 (4%)

Query: 2   PQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
                   +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PY
Sbjct: 10  TMQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPY 61

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           F++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E +
Sbjct: 62  FERFMARFPTVTDLANALLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEV 121

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKI 178
             LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++
Sbjct: 122 AALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQV 181

Query: 179 TSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
           T       F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P R
Sbjct: 182 TPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAATNNSWSLYPGKKPKQTLPER 241

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
           TG   +    D  +LL +R  + L  G+   P  A   +    +         N      
Sbjct: 242 TGYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRHWLAQRQ-IAADNLTQLTA 299

Query: 299 ITHTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
             HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 300 FRHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 359


>gi|21231855|ref|NP_637772.1| A/G-specific adenine glycosylase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66768018|ref|YP_242780.1| A/G-specific adenine glycosylase [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|21113575|gb|AAM41696.1| A/G-specific adenine glycosylase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66573350|gb|AAY48760.1| A/G-specific adenine glycosylase [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 356

 Score =  249 bits (634), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 115/364 (31%), Positives = 168/364 (46%), Gaps = 22/364 (6%)

Query: 1   MPQPE----HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVK 55
           MP P          ++L W+D + R  LPW+           +PY+VW+SEIMLQQT V 
Sbjct: 1   MPVPATLTTDAFVDRLLHWFDGHGRHDLPWQHP--------RAPYRVWLSEIMLQQTQVA 52

Query: 56  TVEPYFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPH 115
            V PYF+KF+  +PT+  L++A ++ +++ WAGLGYY RARNL   A   V  + G  P 
Sbjct: 53  VVIPYFQKFVASFPTLADLAAADNDTVMAHWAGLGYYARARNLHAAAKQCVALHAGELPR 112

Query: 116 KVEILKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA-----PLYHKT 170
             + L  LPGIG  TA AI++ A+N    ++D N++R+++R   I               
Sbjct: 113 DFDALLALPGIGRSTAGAILSQAWNDRFPIMDGNVKRVLTRIHGIAGYPGLPVVEKQLWQ 172

Query: 171 IKNYARKITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINT 230
           +           R  D+ QA MD GA +CT  +P C +CP+Q+NC+   EG    L    
Sbjct: 173 LAANHVAHVPAGRLADYTQAQMDFGATLCTRARPACMVCPLQENCVARREGLVEALPTPK 232

Query: 231 IKKKRPMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFT 290
             K+ P R     +     N ILL++R  T +   +  LP +   S        H     
Sbjct: 233 PGKQLPEREATALLLENAHNEILLQRRPPTGIWASLWTLPQAETDSDLREWFAAHIDGDY 292

Query: 291 ANWILCNTITHTFTHFTLTLFVWKTIVPQ----IVIIPDSTWHDAQNLANAALPTVMKKA 346
                   I HTF+H+ L L   +         +    D  W    +LA   LP  ++K 
Sbjct: 293 DRADEMPMIVHTFSHYRLHLQPLRLRKVALRQVLRDNDDLRWVARADLATLGLPAPIRKL 352

Query: 347 LSAG 350
           L A 
Sbjct: 353 LDAL 356


>gi|126730851|ref|ZP_01746660.1| A/G-specific adenine glycosylase [Sagittula stellata E-37]
 gi|126708567|gb|EBA07624.1| A/G-specific adenine glycosylase [Sagittula stellata E-37]
          Length = 352

 Score =  249 bits (634), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 144/347 (41%), Positives = 199/347 (57%), Gaps = 3/347 (0%)

Query: 9   QSKILDWYDTNHRVLPWRTSPKTE-KSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQK 67
            + +L WYD + R LPWR  P    K   P PY++W+SEIMLQQTTV  V+ YF+ F ++
Sbjct: 7   AADLLQWYDRHARDLPWRVGPSARAKGIAPDPYRIWLSEIMLQQTTVAAVKDYFRLFTER 66

Query: 68  WPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIG 127
           WPT+  L++A D E+++AWAGLGYY RARNL KCA ++ ++  G FP   ++L  LPG+G
Sbjct: 67  WPTVDALAAAPDAEVMAAWAGLGYYARARNLLKCARVVAEETGGVFPADHDVLLTLPGVG 126

Query: 128 DYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDF 187
            YTA+AI AIAF+   VVVD N+ER+++R  D   P P     +  YA  +T  +RPGD+
Sbjct: 127 PYTAAAISAIAFDVPRVVVDGNVERVMARLHDEHTPLPAAKPILTAYAAALTPNARPGDY 186

Query: 188 VQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAIT 247
            QA+MDLGA ICT  +P C LCP + +C  ++ G +  L     KK++P+R G  ++A  
Sbjct: 187 AQAVMDLGATICTPKRPACGLCPWRTSCAAWANGTAAELPKKAPKKRKPVRQGVAYLARR 246

Query: 248 NDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILC-NTITHTFTHF 306
            D   LL  R +  LL GM   PG+ W    +G       P  A W        HTFTHF
Sbjct: 247 VDGAWLLETRPDKGLLGGMLGWPGTDW-LDVEGPAPDEDPPIRAEWKTVGGEARHTFTHF 305

Query: 307 TLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIK 353
            L L V   +VP         +    + + + LPTVM+KA      +
Sbjct: 306 HLRLVVKTALVPMDRKPHRGDFIALPDFSPSDLPTVMRKAFDLAQGR 352


>gi|161616075|ref|YP_001590040.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|168242914|ref|ZP_02667846.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168264444|ref|ZP_02686417.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|194447840|ref|YP_002047099.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|161365439|gb|ABX69207.1| hypothetical protein SPAB_03876 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194406144|gb|ACF66363.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|205338089|gb|EDZ24853.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205347087|gb|EDZ33718.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
          Length = 350

 Score =  249 bits (634), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 112/359 (31%), Positives = 174/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+ +         +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQIN--------KTPYKVWLSEVMLQQTQVTTVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP     + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGEFPQTFAEIA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPG+G  TA AI+++A      ++D N++R+++R + +           T+   + ++T
Sbjct: 113 ALPGVGRSTAGAILSLALGKHYPILDGNVKRVLARCYAVSGWPGKKEVENTLWTLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT +KP C LCP+Q  C+  +            K+  P RT
Sbjct: 173 PAHGVERFNQAMMDLGAMVCTRSKPKCTLCPLQNGCIAAAHESWSRYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G  F+ + ++  I L +R  + L  G+   P  A        +         N    N  
Sbjct: 233 G-YFLLLQHNQEIFLAQRPPSGLWGGLYCFPQFAREDELREWLAQRHVNAD-NLTQLNAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V  +    D   + W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSLDACMDEGSALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|16766411|ref|NP_462026.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|167990362|ref|ZP_02571462.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|198243866|ref|YP_002217085.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|462663|sp|Q05869|MUTY_SALTY RecName: Full=A/G-specific adenine glycosylase
 gi|154184|gb|AAA27165.1| mutB [Salmonella enterica subsp. enterica serovar Typhimurium]
 gi|16421664|gb|AAL21985.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|197938382|gb|ACH75715.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|205331157|gb|EDZ17921.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|261248241|emb|CBG26078.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267995276|gb|ACY90161.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301159665|emb|CBW19184.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312914132|dbj|BAJ38106.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321225784|gb|EFX50838.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|323131466|gb|ADX18896.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|326624857|gb|EGE31202.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|332989977|gb|AEF08960.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 350

 Score =  249 bits (634), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 112/359 (31%), Positives = 174/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+ +         +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQIN--------KTPYKVWLSEVMLQQTQVTTVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP     + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGEFPQTFAEIA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPG+G  TA AI+++A      ++D N++R+++R + +           T+   + ++T
Sbjct: 113 ALPGVGRSTAGAILSLALGKHYPILDGNVKRVLARCYAVSGWPGKKEVENTLWTLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT +KP C LCP+Q  C+  +            K+  P RT
Sbjct: 173 PARGVERFNQAMMDLGAMVCTRSKPKCTLCPLQNGCIAAAHESWSRYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G  F+ + ++  I L +R  + L  G+   P  A        +         N    N  
Sbjct: 233 G-YFLLLQHNQEIFLAQRPPSGLWGGLYCFPQFAREDELREWLAQRHVNAD-NLTQLNAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V  +    D   + W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSLDACMDEGSALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|329998619|ref|ZP_08303184.1| A/G-specific adenine glycosylase [Klebsiella sp. MS 92-3]
 gi|328538600|gb|EGF64701.1| A/G-specific adenine glycosylase [Klebsiella sp. MS 92-3]
          Length = 352

 Score =  249 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 107/361 (29%), Positives = 171/361 (47%), Gaps = 16/361 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M        +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV P
Sbjct: 1   MTFLATQFSAQVLDWYDKYGRKTLPWQI--------AKTPYKVWLSEVMLQQTQVTTVIP 52

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   + 
Sbjct: 53  YFERFMARFPTVVDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVTTLHGGEFPRTFDE 112

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARK 177
           +  LPG+G  TA AI++++      ++D N++R+++R + +            + + + +
Sbjct: 113 VAALPGVGRSTAGAILSLSLGQHYPILDGNVKRVLARCYAVSGWPGKKEVEKRLWDISEE 172

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T       F QAMMDLGA++CT +KP C LCP+   C+ ++            K+  P 
Sbjct: 173 VTPAEGVERFNQAMMDLGAMVCTRSKPKCELCPLSNGCVAYANHSWAEYPGKKPKQTLPE 232

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
           RTG   +    D  + L +R    L  G+   P  A  +     +         N     
Sbjct: 233 RTGYFLLMQHGDE-VFLSQRPPVGLWGGLFCFPQFADEAELREWLAQRQIKAD-NLTQLT 290

Query: 298 TITHTFTHFTLTLFVWKTIVPQI---VIIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
              HTF+HF L +      V      +   ++ W++     +  L   +++ L       
Sbjct: 291 AFRHTFSHFHLDIVPMWLTVHSSGACMDEGNALWYNLAQPPSVGLAAPVERLLQQLKAGA 350

Query: 355 P 355
           P
Sbjct: 351 P 351


>gi|163749423|ref|ZP_02156671.1| A/G-specific adenine glycosylase [Shewanella benthica KT99]
 gi|161330832|gb|EDQ01759.1| A/G-specific adenine glycosylase [Shewanella benthica KT99]
          Length = 361

 Score =  249 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 107/352 (30%), Positives = 167/352 (47%), Gaps = 18/352 (5%)

Query: 7   IIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
              S+I+ WY+   R  LPW+           +PYKVW+SEIMLQQT V TV PY+ KFM
Sbjct: 13  SFSSRIISWYEKCGRKHLPWQQD--------KTPYKVWVSEIMLQQTQVSTVIPYYLKFM 64

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
           + +PTI  L+ A  +E+L  W GLGYY RARNL K A +I  ++   FP   E +  LPG
Sbjct: 65  EHFPTIDSLADAPQDEVLHYWTGLGYYARARNLHKSAQLIRDEHGSQFPRDFEDVLSLPG 124

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKITSTSR 183
           IG  TA A++++A      ++D N++R+++R+  I            + +   K+T    
Sbjct: 125 IGRSTAGAVLSLALAQHHAILDGNVKRVLARHGAIDGWPGKKQVENKLWDLTEKLTPDLD 184

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVF 243
              + QAMMD+GA IC+ ++P+C  CP+  +C     G+          KK      A  
Sbjct: 185 VQKYNQAMMDIGASICSRSRPVCSDCPVAIDCQAQLTGRQSEYPGKK-PKKVIPEKNAYM 243

Query: 244 IAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTF 303
           + +   + ++L KR    +  G+   P  +     D  + T         +L     HTF
Sbjct: 244 LVLAKGDEVILEKRPPAGIWGGLWCFPQFSTREELDEYLITKGLTVFEEEVLPG-FRHTF 302

Query: 304 THFTLTLFVWKTIV-----PQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +HF L +             QI+    S W++  +     L    ++ L++ 
Sbjct: 303 SHFHLDISPILVSAEGFSDNQIMEDKPSLWYNLPHPPKVGLAAATERILASL 354


>gi|204928168|ref|ZP_03219368.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|204322490|gb|EDZ07687.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
          Length = 350

 Score =  249 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 113/359 (31%), Positives = 175/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+ +         +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQIN--------KTPYKVWLSEVMLQQTQVTTVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP     + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGEFPQTFAEIA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPG+G  TA AI+++A      ++D N++R+++R + +           T+   + ++T
Sbjct: 113 ALPGVGRSTAGAILSLALGKHYPILDGNVKRVLARCYAVSGWPGKKEVENTLWTLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT +KP C LCP+Q  C+  +            K+  P RT
Sbjct: 173 PAHGVERFNQAMMDLGAMVCTRSKPKCTLCPLQNGCIAAAHESWSRYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G  F+ + ++  ILL +R  + L  G+   P  A        +         N    N  
Sbjct: 233 G-YFLLLQHNQEILLAQRPPSGLWGGLYCFPQFASEDELREWLAQRHVNAD-NLTQLNAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V  +    D   + W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSLDACMDEGSALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|86136903|ref|ZP_01055481.1| A/G-specific adenine glycosylase [Roseobacter sp. MED193]
 gi|85826227|gb|EAQ46424.1| A/G-specific adenine glycosylase [Roseobacter sp. MED193]
          Length = 372

 Score =  249 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 148/356 (41%), Positives = 201/356 (56%), Gaps = 10/356 (2%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTVEPYFKK 63
           E  +  ++L WYD N R +PWR SP      L   PY+VW+SE+MLQQTTV  V  YF++
Sbjct: 18  ETELNQQLLGWYDRNARTMPWRVSPADRARGLRPDPYRVWLSEVMLQQTTVAAVTEYFQR 77

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           F ++WP++  L++A+D E+++ WAGLGYY RARNL KCA ++ ++ EG FP   + L KL
Sbjct: 78  FTRRWPSVLDLAAAQDAEVMAEWAGLGYYARARNLLKCARVVAQELEGTFPDSYDALLKL 137

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSR 183
           PGIG YTA+A+ +IAF+    V+D N+ER+++R  DI  P P     +K +A  +T   R
Sbjct: 138 PGIGPYTAAAVASIAFDRAETVLDGNVERVMARLHDIHDPLPAVKPVLKEHAGVLTPQLR 197

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVF 243
           PGD+ QA+MDLGA ICT   P C +CP +  C     G +  L   T K+ +P R G  +
Sbjct: 198 PGDYAQAVMDLGATICTPKNPACGICPWRSPCQARIAGTAPELPKKTPKQPKPTRLGLAY 257

Query: 244 IAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILC-NTITHT 302
           +A   D   LL +R +  LL GM   PGS W++  D        PF ANW      + HT
Sbjct: 258 LARRADGAWLLERRPDKGLLGGMLGWPGSEWNAAPDP-----RPPFEANWQDLGGEVRHT 312

Query: 303 FTHFTLTLFVWKTIVPQI-VIIPDSTWHDAQNLANAALPTVMKKALS--AGGIKVP 355
           FTHF L L V    +P    + P              LPTVM+KA    AG    P
Sbjct: 313 FTHFHLILQVKLAELPSGYNLSPGQELLTRHAFRPQDLPTVMRKAFDLWAGSEFNP 368


>gi|229530295|ref|ZP_04419683.1| A/G-specific adenine glycosylase [Vibrio cholerae 12129(1)]
 gi|229332068|gb|EEN97556.1| A/G-specific adenine glycosylase [Vibrio cholerae 12129(1)]
          Length = 378

 Score =  249 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 104/351 (29%), Positives = 170/351 (48%), Gaps = 17/351 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
               IL WYD   R  LPW+ +         + Y+VW+SEIMLQQT V TV PYF++F++
Sbjct: 29  FAQAILTWYDAYGRKNLPWQQN--------KNAYRVWLSEIMLQQTQVATVIPYFERFLE 80

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A  +E+L  W GLGYY RARNL K A ++V +Y G FP  +E +  LPG+
Sbjct: 81  RFPTVQALAAAPQDEVLHFWTGLGYYARARNLHKAAQMVVSEYGGEFPTDLEQMNALPGV 140

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++  +     ++D N++R ++R F +            + +YA   T     
Sbjct: 141 GRSTAAAVLSSVYKKPHAILDGNVKRTLARCFAVEGWPGQKSVENQLWHYAEMHTPKVDV 200

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA+ICT +KP C LCP++  CL   +G          K  +       F+
Sbjct: 201 DKYNQAMMDMGAMICTRSKPKCSLCPVESFCLAKQQGNPQEYPGKKPKTDK-PVKATWFV 259

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSA-PFTANWILCNTITHTF 303
            + +DN + L +R  + +  G+   P S  ++ +              +        HTF
Sbjct: 260 MLYHDNAVWLEQRPQSGIWGGLYCFPQSEIANIQTTIDQRAIGDSTITSQKTLIAFRHTF 319

Query: 304 THFTLTLFVWKTIVPQIV----IIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ L +      + +            W++        L   +K+ L + 
Sbjct: 320 SHYHLDITPILLQLSRKPDIVMEGSKGLWYNLSQPDEIGLAAPVKQLLHSL 370


>gi|170765545|ref|ZP_02900356.1| A/G-specific adenine glycosylase [Escherichia albertii TW07627]
 gi|170124691|gb|EDS93622.1| A/G-specific adenine glycosylase [Escherichia albertii TW07627]
          Length = 360

 Score =  248 bits (633), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 109/355 (30%), Positives = 174/355 (49%), Gaps = 16/355 (4%)

Query: 2   PQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
                   +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PY
Sbjct: 10  TMQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPY 61

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           F++FM ++PT+  L++A  +++L  W GLGYY RARNL K A  +   + G FP   E +
Sbjct: 62  FERFMARFPTVTDLANAPLDDVLHLWTGLGYYARARNLHKAAQHVATLHGGKFPETFEEV 121

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKI 178
             LPG+G  TA AI++++      ++D N++R+++R + +            +   + ++
Sbjct: 122 AALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWRLSEQV 181

Query: 179 TSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
           T       F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P R
Sbjct: 182 TPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPER 241

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
           TG  F+ + +D+ +LL +R  + L  G+   P  A   +    +                
Sbjct: 242 TG-YFLLLQHDDEVLLAQRPPSGLWGGLFCFPQFADEESLRQWLAQRQINADK-LTQLTA 299

Query: 299 ITHTFTHFTLTLFVWKTIVP---QIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
             HTF+HF L +      V      +   ++ W++     +  L   +++ L   
Sbjct: 300 FRHTFSHFHLDIVPMWLPVSSFTDCMDEGNALWYNLAQPPSVGLAAPVERLLQQL 354


>gi|126724762|ref|ZP_01740605.1| A/G-specific adenine glycosylase [Rhodobacterales bacterium
           HTCC2150]
 gi|126705926|gb|EBA05016.1| A/G-specific adenine glycosylase [Rhodobacterales bacterium
           HTCC2150]
          Length = 353

 Score =  248 bits (633), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 149/344 (43%), Positives = 200/344 (58%), Gaps = 8/344 (2%)

Query: 8   IQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQK 67
           I   +L WYD N R LPWR  P +      +PY +W+SE+MLQQTTV TV+ YF KF   
Sbjct: 10  ISDDLLAWYDKNARDLPWRVPPNS--GHHANPYAIWLSEVMLQQTTVATVKAYFLKFRSL 67

Query: 68  WPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIG 127
           WPT+  L++A D ++++AWAGLGYY RARNL KCA ++   + G FP+ ++ L  LPGIG
Sbjct: 68  WPTVQDLAAANDADVMAAWAGLGYYARARNLLKCARVVTDDHNGQFPNTLDELLALPGIG 127

Query: 128 DYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDF 187
            YTA+AI +IAF++ A VVD N+ER+++R F   +P P   KT+   A   T ++RPGD+
Sbjct: 128 PYTAAAISSIAFDNVATVVDGNVERVMARVFAHTEPLPKAKKTLTRLAANCTPSNRPGDY 187

Query: 188 VQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAIT 247
            QA+MDLGA ICT   P C +C IQ +C   ++  +H L   T K  +P R G V++A  
Sbjct: 188 AQAVMDLGATICTPRNPKCDICHIQNHCKGLAQNIAHTLPAKTPKPPKPTRYGHVYLAQR 247

Query: 248 NDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN-TITHTFTHF 306
           ND   LL +R    LL GM   PG AW     G+  + + P    W     T+THTFTHF
Sbjct: 248 NDGAWLLERRPEKGLLGGMLGWPGGAW-----GDAPSKTPPVQTKWHTLPDTVTHTFTHF 302

Query: 307 TLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            L L V    V   V      +  +      +LPT M+KA  A 
Sbjct: 303 HLVLTVHFGTVDHHVKPDIGDFVGSNAFDAKSLPTAMRKAYDAA 346


>gi|194444686|ref|YP_002042370.1| adenine DNA glycosylase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194403349|gb|ACF63571.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
          Length = 350

 Score =  248 bits (633), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 174/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+ +         +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQIN--------KTPYKVWLSEVMLQQTQVTTVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP     + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGEFPQTFAEIA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPG+G  TA AI+++A      ++D N++R+++R + +           T+   + ++T
Sbjct: 113 ALPGVGRSTAGAILSLALGKHYPILDGNVKRVLARCYAVSGWPGKKEVENTLWTLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT +KP C LCP+Q  C+  +            K+  P RT
Sbjct: 173 PARGVERFNQAMMDLGAMVCTRSKPKCTLCPLQNGCIAAAHESWSRYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G  F+ + ++  I L +R  + L  G+   P  A        +         N    N  
Sbjct: 233 G-YFLLLQHNQEIFLAQRPPSGLWGGLYCFPQFASEDELREWLAQRHVNAD-NLTQLNAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQI---VIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V  +   +    + W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSLGVCMDEGSALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|157148510|ref|YP_001455829.1| adenine DNA glycosylase [Citrobacter koseri ATCC BAA-895]
 gi|157085715|gb|ABV15393.1| hypothetical protein CKO_04336 [Citrobacter koseri ATCC BAA-895]
          Length = 383

 Score =  248 bits (633), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 105/360 (29%), Positives = 175/360 (48%), Gaps = 16/360 (4%)

Query: 2   PQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
                   +++L WYD   R  LPW+           +PYKVW+SE+MLQQT V TV PY
Sbjct: 33  TMQASQFSAQVLGWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPY 84

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           F++FM  +PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   + +
Sbjct: 85  FERFMSHFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGRFPETFDEV 144

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKI 178
             LPG+G  TA A+++++ +    ++D N++R+++R + +            + + + ++
Sbjct: 145 AALPGVGRSTAGAVLSLSLDKHFPILDGNVKRVLARCYAVSGWPGKKEVEKRLWDLSEQV 204

Query: 179 TSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
           T  +    F QAMMDLGA++CT ++P C LCP+Q  C+  +     L      K+  P R
Sbjct: 205 TPANGVARFNQAMMDLGAMVCTRSRPKCSLCPLQNGCVAAANESWSLYPGKKPKQTLPER 264

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
           TG  F+ + +++ + L +R  + L  G+   P           +         N    N 
Sbjct: 265 TG-YFLLLQHNDDVFLAQRPPSGLWGGLYCFPQFEDEDGLRQWLAQ-RHIQADNLSQLNA 322

Query: 299 ITHTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
             HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 323 FRHTFSHFHLDIVPMWLPVSSFTVCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 382


>gi|317493455|ref|ZP_07951876.1| A/G-specific adenine glycosylase [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316918398|gb|EFV39736.1| A/G-specific adenine glycosylase [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 363

 Score =  248 bits (633), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 104/359 (28%), Positives = 172/359 (47%), Gaps = 16/359 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           +          +L WYD   R  LPW++          +PY+VW+SE+MLQQT V TV P
Sbjct: 9   LMMLAQQFAQSVLTWYDRYGRKTLPWQSP--------KTPYQVWLSEVMLQQTQVATVIP 60

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF +FM+K+P +  L++A  +E+L  W GLGYY R RNL K A  I++K+ G FP   + 
Sbjct: 61  YFLRFMEKFPDVRALAAAPQDEVLHLWTGLGYYARGRNLHKAAQTIMEKHGGEFPTSFDD 120

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLY--HKTIKNYARK 177
           +  LPG+G  TA AI++++      ++D N++R+++R + +            +   + +
Sbjct: 121 VCALPGVGRSTAGAILSLSLGQHYPILDGNVKRVLARCYAVEGWPGKKDVENRLWEISEQ 180

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T  +    F QAMMDLGA++CT +KP C LCP+   C+ ++            K+  P 
Sbjct: 181 VTPANGVSQFNQAMMDLGAMVCTRSKPKCELCPLSSGCIAYANSSWSQYPGKKPKQTIPE 240

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
           +TG   +  + DN + L +R N  L  G+   P          ++ +             
Sbjct: 241 KTGYFLMMQSGDN-VWLEQRPNVGLWGGLYCFPQFINEDALREHVASLGIKQPKLHQ-LT 298

Query: 298 TITHTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIK 353
           +  HTF+HF L +      + Q     D     W++     +  L   +++ L     +
Sbjct: 299 SFRHTFSHFHLDIVPIWFDITQQSHCMDEGTGLWYNLAQPPSVGLAAPVERLLQQLSKE 357


>gi|229512514|ref|ZP_04401985.1| A/G-specific adenine glycosylase [Vibrio cholerae TMA 21]
 gi|229350407|gb|EEO15356.1| A/G-specific adenine glycosylase [Vibrio cholerae TMA 21]
          Length = 378

 Score =  248 bits (633), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 103/351 (29%), Positives = 170/351 (48%), Gaps = 17/351 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
               IL WYD   R  LPW+ +         + Y+VW+SEIMLQQT V TV PYF++F++
Sbjct: 29  FAQAILTWYDAYGRKNLPWQQN--------KNAYRVWLSEIMLQQTQVATVIPYFERFLE 80

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A  +E+L  W GLGYY RARNL K A  +V +Y G FP  +E +  LPG+
Sbjct: 81  RFPTVQALAAAPQDEVLHFWTGLGYYARARNLHKAAQTVVNEYGGEFPTDLEQMNALPGV 140

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++  +     ++D N++R ++R F +            + +YA   T +   
Sbjct: 141 GRSTAAAVLSSVYKKPHAILDGNVKRTLARCFAVEGWPGQKSVENQLWHYAEMHTPSVDV 200

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA+ICT +KP C LCP++  CL   +G          K ++       F+
Sbjct: 201 DKYNQAMMDMGAMICTRSKPKCSLCPVESFCLAKQQGNPQEYPGKKPKTEK-PVKATWFV 259

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSA-PFTANWILCNTITHTF 303
            + + N + L +R  + +  G+   P S  ++ +              +        HTF
Sbjct: 260 MLYHGNAVWLEQRPQSGIWGGLYCFPQSEIANIQTTIDQRAIGDSTITSQKTLIAFRHTF 319

Query: 304 THFTLTLFVWKTIVPQIV----IIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ L +      + +            W++        L   +K+ L + 
Sbjct: 320 SHYHLDITPILLQLSRKPDIVMEGSKGLWYNLSQPDEIGLAAPVKQLLHSL 370


>gi|332974269|gb|EGK11201.1| A/G-specific adenine glycosylase [Desmospora sp. 8437]
          Length = 385

 Score =  248 bits (633), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 124/352 (35%), Positives = 180/352 (51%), Gaps = 18/352 (5%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
              ++ K+LDWYD N R LPWR +          PY++W+SEIMLQQT V TV PY+++F
Sbjct: 24  IQAVREKLLDWYDRNRRDLPWREN--------KDPYRIWVSEIMLQQTRVDTVIPYYERF 75

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M  +PT   L++A+++E++ AW GLGYY+RARNL      +V+ Y G  P     + +L 
Sbjct: 76  MSLFPTPGELAAAEEDEVIKAWEGLGYYSRARNLHTAVKEVVETYGGKVPDDPAAVSRLK 135

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDI--IKPAPLYHKTIKNYARKITSTS 182
           G+G YTA AI++IA+N     VD N+ R++SR+F +          +  +   R +    
Sbjct: 136 GVGPYTAGAILSIAYNRPVPAVDGNVFRVLSRWFALRDDVTRTSTRRKFEELDRLLIPED 195

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
           RPGDF QA+M+LGALIC    P C  CP+Q  C    +G    L + T  K         
Sbjct: 196 RPGDFNQALMELGALICIPVSPACADCPVQGECQAHHDGIQAELPVKTRGKPPVP-VRMT 254

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKD---GNIDTHSAPFTANWIL---C 296
           F  I N  R+LL++R +  LL GM  LP       +    G +  H A    N  L    
Sbjct: 255 FGWIMNGTRVLLQRRPSEGLLGGMWGLPSVETLPEEPVPGGTLRDHWAGLGLNLELGAVV 314

Query: 297 NTITHTFTHFTLTLFVWK-TIVPQIVIIPDSTWHDAQNLANAALPTVMKKAL 347
             + H F+H    + + +     +  +  D  W +   L   ALP V +KA+
Sbjct: 315 GELEHVFSHRRWFVTLVQGLCSAEESLPEDCRWVEENELERYALPNVYRKAV 366


>gi|209694127|ref|YP_002262055.1| A/G-specific adenine glycosylase [Aliivibrio salmonicida LFI1238]
 gi|208008078|emb|CAQ78219.1| A/G-specific adenine glycosylase [Aliivibrio salmonicida LFI1238]
          Length = 350

 Score =  248 bits (633), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 107/351 (30%), Positives = 164/351 (46%), Gaps = 18/351 (5%)

Query: 7   IIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
                IL+WYD   R  LPW+           +PYKVW+SEIMLQQT V TV PYF++FM
Sbjct: 3   SFSHAILEWYDNYGRKTLPWQ--------LEKTPYKVWLSEIMLQQTQVTTVIPYFERFM 54

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
            ++PT+  L++A  +E+L  W GLGYY RARNL K A II ++Y G FP  ++ +  LPG
Sbjct: 55  TRFPTVIDLANADQDEVLHLWTGLGYYARARNLHKTAQIIAEQYNGRFPETIDEVIALPG 114

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSR 183
           IG  TA A+++++      ++D N++R +SR F I            +   A + T    
Sbjct: 115 IGRSTAGAVLSLSLKQRHPILDGNVKRTLSRCFAIEGWSGKKSVENAMWEIAEEHTPELG 174

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVF 243
              + QAMMD+GA++CT +KP C +CP+   C   ++ +          KK      A F
Sbjct: 175 VERYNQAMMDMGAIVCTRSKPKCEICPVNDLCQAKAQDRQLDFPT-KKPKKEKPMKEAWF 233

Query: 244 IAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTF 303
               +D  + L +R  T +  G+   P          ++         +        HTF
Sbjct: 234 AIYYHDGEVWLEQRPQTGIWGGLFCFP--EQPENTLVDLSVRYGVEIKSTQQLIAFRHTF 291

Query: 304 THFTLTLFVWKTIVPQIV----IIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ L +      + +            W++        L   ++K L A 
Sbjct: 292 SHYHLDITPVLITLVKKPNMVMEGTRGVWYNLSQPMTVGLAAPVQKLLDAL 342


>gi|110806873|ref|YP_690393.1| adenine DNA glycosylase [Shigella flexneri 5 str. 8401]
 gi|110616421|gb|ABF05088.1| A/G-specific adenine glycosylase [Shigella flexneri 5 str. 8401]
 gi|281602301|gb|ADA75285.1| Adenine glycosylase [Shigella flexneri 2002017]
          Length = 360

 Score =  248 bits (633), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 111/360 (30%), Positives = 172/360 (47%), Gaps = 16/360 (4%)

Query: 2   PQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
                   +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PY
Sbjct: 10  TMQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPY 61

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           F++FM  +PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E +
Sbjct: 62  FERFMAHFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEV 121

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKI 178
             LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++
Sbjct: 122 AALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQV 181

Query: 179 TSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
           T       F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P R
Sbjct: 182 TPAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAATNNSWSLYPGKKPKQTLPER 241

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
           TG   +    D  +LL +R  + L  G+   P  A   +    +         N      
Sbjct: 242 TGYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRHWLAQRQ-IAADNLTQLTA 299

Query: 299 ITHTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
             HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 300 FRHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 359


>gi|323524677|ref|YP_004226830.1| A/G-specific adenine glycosylase [Burkholderia sp. CCGE1001]
 gi|323381679|gb|ADX53770.1| A/G-specific adenine glycosylase [Burkholderia sp. CCGE1001]
          Length = 383

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 108/362 (29%), Positives = 178/362 (49%), Gaps = 24/362 (6%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
              +++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+ KF+ 
Sbjct: 30  FSVRLIAWQRKHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVIPYYAKFLA 81

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++P +  L++A  +++++ WAGLGYYTRARNL +CA  +V+++ G FP  VE L +LPGI
Sbjct: 82  RFPDVAALAAAPVDDVMALWAGLGYYTRARNLHRCAQAVVEQHGGAFPASVEELAELPGI 141

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTSRP 184
           G  TA+AI + AF   A ++D N++R+++R F +            +   A  +  ++  
Sbjct: 142 GRSTAAAIASFAFGARATILDGNVKRVLARVFGVEGFPGEKKVENAMWTLAESLLPSNAS 201

Query: 185 GD----FVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG 240
            D    + Q +MDLGA +C   KP C  CP   +C+    G+   L     KK  P R  
Sbjct: 202 DDDVSAYTQGLMDLGATLCVRGKPDCLRCPFAADCVANVTGRQRELPAARPKKAVPTRRT 261

Query: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWIL--CNT 298
              + + + N ++L KR  + +  G+  LP +A  +                  L     
Sbjct: 262 -WMLVLRDGNAVMLEKRPPSGIWGGLWSLPEAADEAALAARAREFGGDGGGVPQLSPLAP 320

Query: 299 ITHTFTHFTLTLFVWKTIVPQI------VIIPDSTWHDAQNLANAALPTVMKKALSAGGI 352
           +TH FTHF L +      + +       +   D+ W    +L +  +P  ++K L +   
Sbjct: 321 LTHVFTHFKLDIEPRLAELDRGVGALAALGDADTAWVALSDLDSFGVPAPVRKLLDSLQG 380

Query: 353 KV 354
            +
Sbjct: 381 SL 382


>gi|91975679|ref|YP_568338.1| A/G-specific adenine glycosylase [Rhodopseudomonas palustris BisB5]
 gi|91682135|gb|ABE38437.1| A/G-specific DNA-adenine glycosylase [Rhodopseudomonas palustris
           BisB5]
          Length = 376

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 140/346 (40%), Positives = 190/346 (54%), Gaps = 10/346 (2%)

Query: 10  SKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWP 69
           + +L WYD + R+LPWR            PY VW+SEIMLQQTTV+ V PYF+KFM +WP
Sbjct: 34  AALLAWYDRHRRILPWR----PPAGVPADPYAVWLSEIMLQQTTVRAVGPYFEKFMARWP 89

Query: 70  TIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDY 129
           ++  L  A  +++L  WAGLGYY+RARNL  CA  + + + G FP   + L+ LPG+G Y
Sbjct: 90  SVKALGEASLDDVLRMWAGLGYYSRARNLHACAVAVTRDHGGAFPDTEQGLRALPGVGPY 149

Query: 130 TASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQ 189
           TA+AI AIAF    + VD NIER++SR   + +  P     I+  A  +    R GD  Q
Sbjct: 150 TAAAIAAIAFGRQTMPVDGNIERVVSRLHAVEEELPKAKPRIQELAATLLGPERAGDSAQ 209

Query: 190 AMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITND 249
           A+MDLGA ICT  KP C LCP+   C+    G +        KK   +R GA F+ +T  
Sbjct: 210 ALMDLGATICTPKKPACALCPLNDGCVARLRGDAETFPRKAPKKTGALRRGAAFV-VTRG 268

Query: 250 NRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPF---TANWILC-NTITHTFTH 305
           +++LLR R    LL GM E+P S W + +D  +    AP       W      +TH FTH
Sbjct: 269 DQLLLRSRAAKGLLGGMTEVPNSDWRADQDDAVARAQAPALKGVTRWQRKPGVVTHVFTH 328

Query: 306 FTLTLFVWKTIVPQIVIIPDS-TWHDAQNLANAALPTVMKKALSAG 350
           F L L V+    P     P    W +   LA+ ALP +M+K ++  
Sbjct: 329 FPLELVVYTAQAPAGTRAPAGMRWAEVATLADEALPNLMRKVIAHA 374


>gi|229525143|ref|ZP_04414548.1| A/G-specific adenine glycosylase [Vibrio cholerae bv. albensis
           VL426]
 gi|229338724|gb|EEO03741.1| A/G-specific adenine glycosylase [Vibrio cholerae bv. albensis
           VL426]
          Length = 378

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 103/351 (29%), Positives = 170/351 (48%), Gaps = 17/351 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
               IL WYD   R  LPW+ +         + Y+VW+SEIMLQQT V TV PYF++F++
Sbjct: 29  FAQAILTWYDAYGRKNLPWQQN--------KNAYRVWLSEIMLQQTQVATVIPYFERFLE 80

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A  +E+L  W GLGYY RARNL K A ++V +Y G FP  +E +  L G+
Sbjct: 81  RFPTVHALAAAPQDEVLHFWTGLGYYARARNLHKAAQMVVSEYGGEFPTDLEQMNALSGV 140

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++  +     ++D N++R ++R F +            + +YA   T +   
Sbjct: 141 GRSTAAAVLSSVYKKPHAILDGNVKRTLARCFAVEGWPGQKSVENQLWHYAEMHTPSVDV 200

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA+ICT +KP C LCP++  CL   +G          K  +       F+
Sbjct: 201 DKYNQAMMDMGAMICTRSKPKCSLCPVESFCLAKQQGNPQEYPGKKPKTDK-PVKATWFV 259

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSA-PFTANWILCNTITHTF 303
            + +DN + L +R  + +  G+   P S  ++ +              +        HTF
Sbjct: 260 MLYHDNAVWLEQRPQSGIWGGLYCFPQSEIANIQTTIDQRAIGDSTITSQKTLIAFRHTF 319

Query: 304 THFTLTLFVWKTIVPQIV----IIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ L +      + +            W++        L   +K+ L + 
Sbjct: 320 SHYHLDITPILLQLSRKPDIVMEGSKGLWYNLSQPDEIGLAAPVKQLLHSL 370


>gi|237749459|ref|ZP_04579939.1| A/G-specific adenine glycosylase [Oxalobacter formigenes OXCC13]
 gi|229380821|gb|EEO30912.1| A/G-specific adenine glycosylase [Oxalobacter formigenes OXCC13]
          Length = 377

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 106/357 (29%), Positives = 173/357 (48%), Gaps = 24/357 (6%)

Query: 7   IIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
                ++ W   + R  LPW+ +         + Y++W+SEIMLQQT V TV PY+ +F+
Sbjct: 18  SFGETLVAWQKRHGRHSLPWQNT--------RNAYRIWLSEIMLQQTQVATVIPYYLRFL 69

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
           +++P +  L+ A+ EE++S W+GLGYY+RARNL +CA IIV++Y+G FP    +L+ LPG
Sbjct: 70  ERFPDVSALAYAEQEEVMSYWSGLGYYSRARNLHRCAQIIVEEYKGIFPSDPVLLEDLPG 129

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSR 183
           IG  TA+AI   +    A ++D N+ R+ SR F I +        + +   A ++   S 
Sbjct: 130 IGKSTAAAIAVFSSGVRAAILDGNVVRVFSRIFGIAEQASDKKAKEKLWQLAYELLPESD 189

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVF 243
              + Q +MDLGA +C  ++P C +CP   +C+  +E +   L     KK  P R   + 
Sbjct: 190 LEAYTQGLMDLGATVCVRSRPDCSICPFSTSCIALAENRIEELPAKKTKKVSPTRKTIML 249

Query: 244 IAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFT---------ANWI 294
           + ++    +LL KR    +  G+  LP                +            +++ 
Sbjct: 250 VLLSEGK-VLLEKRPEAGIWGGLLSLPECELPEDAGDEEIADVSRLKSVASSFGKTSSFR 308

Query: 295 LCNTITHTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALS 348
                TH F+HF L +      +             W+D   L  A LP  ++K L+
Sbjct: 309 FLEPFTHVFSHFRLQITPCLIGLDSRQLRAEEEKYVWYDMNRLDEAPLPAPVRKLLN 365


>gi|168234339|ref|ZP_02659397.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|194471222|ref|ZP_03077206.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194457586|gb|EDX46425.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|205331718|gb|EDZ18482.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
          Length = 350

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 112/359 (31%), Positives = 175/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+ +         +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQIN--------KTPYKVWLSEVMLQQTQVTTVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP     + 
Sbjct: 53  ERFMTRFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGEFPQTFAEIA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPG+G  TA AI+++A      ++D N++R+++R + +           T+   + ++T
Sbjct: 113 ALPGVGRSTAGAILSLALGKHYPILDGNVKRVLARCYAVSGWPGKKEVENTLWTLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT +KP C LCP+Q  C+  +            K+  P RT
Sbjct: 173 PARGVERFNQAMMDLGAMVCTRSKPKCTLCPLQNGCIAAAHESWSRYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G  F+ + ++  I L +R  + L  G+   P  A  +     +         N    N  
Sbjct: 233 G-YFLLLQHNQEIFLAQRPPSGLWGGLYCFPQFASEAELREWLAQRHVNAD-NLTQLNAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V  +    D   + W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSLDACMDEGSALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|85714256|ref|ZP_01045244.1| A/G-specific adenine glycosylase MutY [Nitrobacter sp. Nb-311A]
 gi|85698703|gb|EAQ36572.1| A/G-specific adenine glycosylase MutY [Nitrobacter sp. Nb-311A]
          Length = 383

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 144/361 (39%), Positives = 194/361 (53%), Gaps = 25/361 (6%)

Query: 10  SKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWP 69
           +++L+WYD N R LPWR  P         PY++W+SEIMLQQTTVK V PYF+KF+ +WP
Sbjct: 6   ARLLEWYDRNRRRLPWRVLPGETV----DPYRIWLSEIMLQQTTVKAVGPYFEKFLARWP 61

Query: 70  TIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDY 129
            +  +  A  ++IL  WAGLGYY+RARNL  CA  +++ + G FP   E L+ LPGIG Y
Sbjct: 62  DVESMGRASLDDILRMWAGLGYYSRARNLHACAAKVLRDHGGRFPDTEEGLRALPGIGPY 121

Query: 130 TASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGD--- 186
           TA+AI AIAFN   + VD NIER+++R F + +P P     I+  A  +    R G    
Sbjct: 122 TAAAIAAIAFNRRTMPVDGNIERVVTRLFAMDEPLPKAKPHIQALAATLLDGCRAGRDGK 181

Query: 187 ------------FVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKK 234
                         QA+MDLGA ICT  KP C LCP+  +C   + G          KK 
Sbjct: 182 SRAGDVKTRAGDIAQALMDLGAAICTPKKPGCVLCPLNDDCAARARGDQETFPRKAPKKA 241

Query: 235 RPMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTAN-- 292
             +R GA F+ +   N +L+R R    LL GM E+P SAW + +D       APF  +  
Sbjct: 242 GELRRGAAFV-VRRGNEVLVRTRPAKGLLGGMTEVPTSAWLAAQDDGAALKQAPFLESAP 300

Query: 293 --WILCNTITHTFTHFTLTLFVWKTIVPQIVIIPDS-TWHDAQNLANAALPTVMKKALSA 349
                   +TH FTHF L L V+   V      P+   W     L + ALP +M+K ++ 
Sbjct: 301 RWQRKIGAVTHVFTHFPLELAVYTAAVATRTAAPEGMRWVPIARLNDEALPNLMRKVIAH 360

Query: 350 G 350
           G
Sbjct: 361 G 361


>gi|206579997|ref|YP_002236589.1| A/G-specific adenine glycosylase [Klebsiella pneumoniae 342]
 gi|288933571|ref|YP_003437630.1| A/G-specific adenine glycosylase [Klebsiella variicola At-22]
 gi|290511362|ref|ZP_06550731.1| adenine DNA glycosylase [Klebsiella sp. 1_1_55]
 gi|206569055|gb|ACI10831.1| A/G-specific adenine glycosylase [Klebsiella pneumoniae 342]
 gi|288888300|gb|ADC56618.1| A/G-specific adenine glycosylase [Klebsiella variicola At-22]
 gi|289776355|gb|EFD84354.1| adenine DNA glycosylase [Klebsiella sp. 1_1_55]
          Length = 352

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 108/361 (29%), Positives = 172/361 (47%), Gaps = 16/361 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M        +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV P
Sbjct: 1   MTFLAAQFSAQVLDWYDKYGRKTLPWQI--------AKTPYKVWLSEVMLQQTQVTTVIP 52

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +  ++ G FP   E 
Sbjct: 53  YFERFMARFPTVVDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATQHGGIFPQSFEE 112

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARK 177
           +  LPG+G  TA AI++++      ++D N++R+++R + +            + + + +
Sbjct: 113 VAALPGVGRSTAGAILSLSLGQHYPILDGNVKRVLARCYAVSGWPGKKEVEKRLWDISEE 172

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T       F QAMMDLGA++CT +KP C LCP+   C+ ++            K+  P 
Sbjct: 173 VTPAQGVERFNQAMMDLGAMVCTRSKPKCELCPLSNGCVAYANHSWAEYPGKKPKQTIPE 232

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
           RTG   +    D  + L +R    L  G+   P  A  +     +         N     
Sbjct: 233 RTGYFLLMQHGDE-VFLSQRPPVGLWGGLFCFPQFADEAELREWLAQRQIKAD-NLTQLT 290

Query: 298 TITHTFTHFTLTLFVWKTIVPQI---VIIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
              HTF+HF L +      V      +   ++ W++     +  L   +++ L       
Sbjct: 291 AFRHTFSHFHLDIVPMWLTVHSSGACMDEGNALWYNLAQPPSVGLAAPVERLLQQLKAGT 350

Query: 355 P 355
           P
Sbjct: 351 P 351


>gi|187922597|ref|YP_001894239.1| A/G-specific adenine glycosylase [Burkholderia phytofirmans PsJN]
 gi|187713791|gb|ACD15015.1| A/G-specific adenine glycosylase [Burkholderia phytofirmans PsJN]
          Length = 353

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 106/362 (29%), Positives = 179/362 (49%), Gaps = 24/362 (6%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               ++++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+ KF
Sbjct: 2   SDFSTRLIAWQRQHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVIPYYAKF 53

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           + ++PT+  L++A  +++++ WAGLGYYTRARNL +CA ++++++ G FP  VE L +LP
Sbjct: 54  LARFPTVAALAAAPSDDVMALWAGLGYYTRARNLHRCAQVVIEQHGGAFPASVEELAELP 113

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTS 182
           GIG  TA+AI + AF   A ++D N++R+++R F +            +   A  +  ++
Sbjct: 114 GIGRSTAAAIASFAFGARATILDGNVKRVLARVFGVEGFPGEKKVENAMWTLAESLLPSN 173

Query: 183 RPG----DFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
                   + Q +MDLGA +C   KP C  CP   +C+    G+  +L     KK  P R
Sbjct: 174 ASDADVSAYTQGLMDLGATLCVRGKPDCLRCPFAADCVANVTGRQRVLPTARPKKTVPTR 233

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
                + + + N ++L KR  + +  G+  LP +A  +                      
Sbjct: 234 HT-WMLVLRDGNAVMLEKRPPSGIWGGLWSLPEAADEAALAERARAFGG--DGAVSPLAP 290

Query: 299 ITHTFTHFTLTLFVWKTIVPQI------VIIPDSTWHDAQNLANAALPTVMKKALSAGGI 352
           +TH FTHF L +      + +       +   D+ W    +L +  +P  ++K L     
Sbjct: 291 LTHVFTHFKLDIEPRLAELDRGVGALAALGDADTAWVALSDLDSFGVPAPVRKLLDGLQG 350

Query: 353 KV 354
            +
Sbjct: 351 SL 352


>gi|76808820|ref|YP_332172.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei 1710b]
 gi|254260868|ref|ZP_04951922.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei 1710a]
 gi|76578273|gb|ABA47748.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei 1710b]
 gi|254219557|gb|EET08941.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei 1710a]
          Length = 368

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 101/362 (27%), Positives = 170/362 (46%), Gaps = 25/362 (6%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
                 ++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+ +F
Sbjct: 18  SAFAPTLIAWQRKHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVVPYYVRF 69

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           ++++P +  L++A  +++++ WAGLGYY+RARNL +CA  +V+++ G FP   E L +LP
Sbjct: 70  LERYPDVAALAAAPIDDVMALWAGLGYYSRARNLHRCAQAVVERHGGAFPASPEALAELP 129

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITS-- 180
           GIG  TA+AI + AF   A ++D N++R+++R F +            +   A  +    
Sbjct: 130 GIGRSTAAAIASFAFGARATILDGNVKRVLARVFGVEGFPGDKRIENEMWALAEALLPDA 189

Query: 181 --TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
              +    + Q +MDLGA +C   KP C  CP   +C+    G+   L     KK  P R
Sbjct: 190 AEPTDVTAYTQGLMDLGATLCVRGKPECGRCPFAGDCVAQRSGRQRELPAARPKKAVPTR 249

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
                + + + + +LL++R    +  G+  LP +   +              A  +    
Sbjct: 250 RT-WMLVLRDGDAVLLQRRPPAGIWGGLWSLPEADGDAALARRAREFGG---AALVPLAP 305

Query: 299 ITHTFTHFTLTLFVWKTIV------PQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGI 352
           + HTFTHF L +      +             ++ W     L    +P  ++K L     
Sbjct: 306 LKHTFTHFRLEIEPRLAELDGAAGGAPPAADDETAWVLLDRLDAYGVPAPVRKLLDGLSG 365

Query: 353 KV 354
            +
Sbjct: 366 PL 367


>gi|238896493|ref|YP_002921231.1| adenine DNA glycosylase [Klebsiella pneumoniae NTUH-K2044]
 gi|238548813|dbj|BAH65164.1| adenine DNA glycosylase [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 403

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 105/357 (29%), Positives = 169/357 (47%), Gaps = 16/357 (4%)

Query: 5   EHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKK 63
                +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF++
Sbjct: 56  ATQFSAQVLDWYDKYGRKTLPWQI--------AKTPYKVWLSEVMLQQTQVTTVIPYFER 107

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   + +  L
Sbjct: 108 FMARFPTVVDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGEFPRTFDEVAAL 167

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKITST 181
           PG+G  TA AI++++      ++D N++R+++R + +            + + + ++T  
Sbjct: 168 PGVGRSTAGAILSLSLGQHYPILDGNVKRVLARCYAVSGWPGKKEVEKRLWDISEEVTPA 227

Query: 182 SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGA 241
                F QAMMDLGA++CT +KP C LCP+   C+ ++            K+  P RTG 
Sbjct: 228 EGVERFNQAMMDLGAMVCTRSKPKCELCPLSNGCVAYANHSWAEYPGKKPKQTLPERTGY 287

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITH 301
             +    D   L ++     L  G+   P  A  +     +         N        H
Sbjct: 288 FLLMQHGDEVFLSQRPPVG-LWGGLFCFPQFADEAELREWLAQRQIKAD-NLTQLTAFRH 345

Query: 302 TFTHFTLTLFVWKTIVPQI---VIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
           TF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 346 TFSHFHLDIVPMWLTVHSSGACMDEGNALWYNLAQPPSVGLAAPVERLLQQLKAGAP 402


>gi|88705278|ref|ZP_01102989.1| A/G-specific adenine glycosylase [Congregibacter litoralis KT71]
 gi|88700368|gb|EAQ97476.1| A/G-specific adenine glycosylase [Congregibacter litoralis KT71]
          Length = 358

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 109/351 (31%), Positives = 173/351 (49%), Gaps = 15/351 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
             +++L WYD + R  LPW+           +PY VW+SEIMLQQT V TV PY+++F  
Sbjct: 4   FATRLLAWYDLHGRHDLPWQRDA--------TPYHVWLSEIMLQQTQVATVIPYYERFTS 55

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++P I  L++A+ +++L  W+GLGYY RARNL K A ++V  + G FP  VE L+ LPGI
Sbjct: 56  RFPDIQTLAAAEADDVLHHWSGLGYYARARNLHKAAKMLVADFSGTFPADVEALQSLPGI 115

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHK--TIKNYARKITSTSRP 184
           G  TA AI++ A    A ++D N++R+++R+  +            +   A   T   R 
Sbjct: 116 GRSTAGAILSTALGGRAAILDGNVKRVLARFHAVEGWPGKNAVASRLWELAESHTPDCRV 175

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
            D+ Q +MDLGA +CT +KP CP CP+  +C   + G+         +K  P RT +  I
Sbjct: 176 ADYTQGIMDLGATLCTRSKPDCPRCPMADDCAALALGRQGEFPGRKPRKVIPTRTTSFVI 235

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFT 304
           A T    +LL +R  + +  G+   P     +      +   A   A  +   T+ H+F+
Sbjct: 236 AHTPKGELLLERRQPSGIWGGLWCFPEVDDDAGAIRYCEETLAVDVARTMALPTLRHSFS 295

Query: 305 HFTLTLFVWKTIVPQ----IVIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
           H+ L +      + +    I    +     A+      L   +K+      
Sbjct: 296 HYHLEISPLLLTLSKTPALIREGQELRCWPAEKAPAVGLAAPVKRLWEQAA 346


>gi|325273134|ref|ZP_08139431.1| A/G-specific adenine glycosylase [Pseudomonas sp. TJI-51]
 gi|324101739|gb|EGB99288.1| A/G-specific adenine glycosylase [Pseudomonas sp. TJI-51]
          Length = 354

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 123/358 (34%), Positives = 181/358 (50%), Gaps = 15/358 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  S +LDWYD + R  LPW+           +PY+VW+SEIMLQQT V TV  YF
Sbjct: 1   MTPEQFSSAVLDWYDEHGRHDLPWQQ--------GITPYRVWVSEIMLQQTQVSTVLNYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FMQ  PT+  L+ A ++E+L  W GLGYYTRARNL+K A I+V ++ G FP  VE L 
Sbjct: 53  DRFMQALPTVQALAEAPEDEVLHLWTGLGYYTRARNLQKAAKIVVAQHGGEFPRSVEQLT 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYF--DIIKPAPLYHKTIKNYARKIT 179
           +LPGIG  TA AI +I+    A ++D N++R+++R+         P     +   A + T
Sbjct: 113 ELPGIGRSTAGAIASISMGIRAPILDGNVKRVLARFTAQGGYPGEPKVANQLWATAERFT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              R   + QAMMD+GA +CT +KP C +CP+Q+ C     G+         +K  P R 
Sbjct: 173 PQQRANHYTQAMMDMGATLCTRSKPSCLICPLQRGCEAHLHGEETRYPEPKPRKALPQRR 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +   ++  ILL +R ++ L  G+  LP     +  D     H      +  +   +
Sbjct: 233 TLMPLLANHEGAILLYRRPSSGLWGGLWSLPELDDIAQLDDLAYQHGLRLAGSQAMDG-L 291

Query: 300 THTFTHFTLTLFVWKTIVP---QIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
           THTF+HF L +  W   V    + V   D  W++        L   +KK L     ++
Sbjct: 292 THTFSHFQLAIEPWLVRVAPLGEHVAEADWLWYNLATPPRLGLAAPVKKLLKRAADEL 349


>gi|99082485|ref|YP_614639.1| A/G-specific DNA-adenine glycosylase [Ruegeria sp. TM1040]
 gi|99038765|gb|ABF65377.1| A/G-specific DNA-adenine glycosylase [Ruegeria sp. TM1040]
          Length = 353

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 142/352 (40%), Positives = 206/352 (58%), Gaps = 12/352 (3%)

Query: 2   PQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTVEPY 60
           P     +   +L WYDT+ R +PWR  P    S +   PY++W+SE+MLQQTTV  V+ Y
Sbjct: 5   PVSAEQLSQDLLVWYDTHAREMPWRVGPAARASGVRPDPYRIWLSEVMLQQTTVAAVKDY 64

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           F++F ++WP +  L++A+D ++++ WAGLGYY RARNL KCA ++ +++EG FP   E L
Sbjct: 65  FERFTRRWPRVGDLAAAEDGDVMAEWAGLGYYARARNLLKCARVVAEEFEGVFPDAYEGL 124

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITS 180
             LPGIG YTA+AI AIAF+    V+D N+ER+++R  D  +P P     +K +A  +T 
Sbjct: 125 IALPGIGPYTAAAISAIAFDRPETVLDGNVERVMARLHDEHEPLPAVKPVLKAHAAHLTP 184

Query: 181 TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG 240
           ++RPGD+ QA+MDLGA ICT   P C +CP +  C    +G +  L   T KK +P R G
Sbjct: 185 SARPGDYAQAVMDLGATICTPKSPACGICPWRDPCRARVKGTAPELPKKTPKKPKPTRYG 244

Query: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN-TI 299
            V++A + +   LL +R +  LL GM   PGS W+        T + PF A+W      +
Sbjct: 245 FVYLARSAEGDWLLERRPDKGLLGGMLGWPGSEWNDAP-----TETPPFDADWQDLGAEV 299

Query: 300 THTFTHFTLTLFVWKTIVP---QIVIIPDSTWHDAQNLANAALPTVMKKALS 348
            HTFTHF L L V    +P   +     +       +   ++LPTVM+KA  
Sbjct: 300 RHTFTHFHLILQVRSAELPADFEPRAGQEL--VRRHDFRPSSLPTVMRKAFD 349


>gi|237729891|ref|ZP_04560372.1| adenine DNA glycosylase [Citrobacter sp. 30_2]
 gi|226908497|gb|EEH94415.1| adenine DNA glycosylase [Citrobacter sp. 30_2]
          Length = 364

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 107/354 (30%), Positives = 170/354 (48%), Gaps = 16/354 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++L WYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 15  MQASQFSAQVLSWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 66

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L+ A  +E+L  W GLGYY RARNL K A  +V  + G FP   + + 
Sbjct: 67  ERFMARFPTVTDLAHAPLDEVLHLWTGLGYYARARNLHKAAQQVVTLHSGIFPQTFDEVA 126

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            +   + ++T
Sbjct: 127 ALPGVGRSTAGAILSLSLGQHFPILDGNVKRVLARCYAVSGWPGKKEVEKKLWELSEQVT 186

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT +KP C LCP++  C+  +     L      K+  P RT
Sbjct: 187 PAQGVERFNQAMMDLGAMVCTRSKPKCSLCPLENGCVASANASWALYPGKKPKQTLPERT 246

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +   +D  +LL +R  + L  G+   P           +         N    N  
Sbjct: 247 GYFLLMQHDDE-VLLSQRPPSGLWGGLYCFPQFDDEDGLRNWLAQRQINAD-NLTQLNAF 304

Query: 300 THTFTHFTLTLFVWKTIVP---QIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            HTF+HF L +      V      +   ++ W++     +  L   +++ L   
Sbjct: 305 RHTFSHFHLDIVPMWLPVSSFTSCMDEGNALWYNLAQPPSVGLAAPVERLLQQL 358


>gi|296445781|ref|ZP_06887734.1| A/G-specific adenine glycosylase [Methylosinus trichosporium OB3b]
 gi|296256761|gb|EFH03835.1| A/G-specific adenine glycosylase [Methylosinus trichosporium OB3b]
          Length = 351

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 132/344 (38%), Positives = 184/344 (53%), Gaps = 9/344 (2%)

Query: 11  KILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPT 70
            +L WYD   R LPWR            PY VW+SEIMLQQTTV+ V+PYF  F+ +WP 
Sbjct: 12  ALLRWYDRRRRALPWR----ARAGETADPYAVWLSEIMLQQTTVEAVKPYFAAFLARWPD 67

Query: 71  IFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYT 130
           +  L++A  EE++ AWAGLGYY RARNL  CA  I     G FP +   L  LPG+G YT
Sbjct: 68  VAALAAAPQEEVMKAWAGLGYYARARNLHACARAIAA--RGAFPREQRELLALPGVGPYT 125

Query: 131 ASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQA 190
           A+AI AIA++   V VD N+ER+++R F I +PA      ++  A+ +    R GDF QA
Sbjct: 126 AAAIAAIAYDAPVVAVDGNVERVVARLFAIERPAREAKAELREQAQSLFPGRRAGDFTQA 185

Query: 191 MMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDN 250
           +MDLGA +CT   P C  CP    C     G +    +   K ++P R GA F+ +++  
Sbjct: 186 LMDLGATVCTPRGPRCGDCPFHGACAAERSGDAEAFPVKPPKTQKPERRGAAFVLLSDGA 245

Query: 251 RILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILC-NTITHTFTHFTLT 309
            + +R R    LL GM E P + + +  D       AP  A W      + H FTHF+L 
Sbjct: 246 AL-IRTRPPRGLLGGMAEFPSTPFRADFDPRKARAHAPAAAPWRELPGMVEHVFTHFSLR 304

Query: 310 LFVWKTIVPQIVII-PDSTWHDAQNLANAALPTVMKKALSAGGI 352
           L +++  +P       +  W +   L    LPT+M+K  +  G+
Sbjct: 305 LTIFRATLPPPRPGIENCRWTELGRLEAEGLPTLMRKVAAHAGL 348


>gi|15613494|ref|NP_241797.1| adenine glycosylase [Bacillus halodurans C-125]
 gi|10173546|dbj|BAB04650.1| adenine glycosylase [Bacillus halodurans C-125]
          Length = 372

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 112/354 (31%), Positives = 178/354 (50%), Gaps = 19/354 (5%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               Q+ ++ W+  ++R LPWR +          PY+VW+SEIMLQQT V TV PY++ F
Sbjct: 10  ISTFQNDLVTWFSNHYRELPWREN--------KDPYRVWVSEIMLQQTRVDTVIPYYQAF 61

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M+++PT+  L+ A+++++L AW GLGYY+RARNL+     +V+ Y G  P   + + KL 
Sbjct: 62  MRQFPTLETLAYAEEDQVLKAWEGLGYYSRARNLQSAVREVVESYGGEVPSTRKEISKLK 121

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKITSTS 182
           G+G YTA AI++IA++     VD N+ R++SR   I +           ++    + S  
Sbjct: 122 GVGPYTAGAILSIAYDQPEPAVDGNVMRVLSRVLYIEEDIAKVKTRTLFESLLYDLISKE 181

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
            P  F Q +M+LGAL+CT   P C LCP++ +C  F+ G    L I   KKK   +    
Sbjct: 182 NPSFFNQGLMELGALVCTPTSPGCLLCPVRDHCRAFAAGVQEQLPIKAKKKKPKAKQLIA 241

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDG------NIDTHSAPFTANWILC 296
            +      ++L+ +R    LL  + + P     STK+        I        A     
Sbjct: 242 AVIRNEKGQVLIERRPEKGLLAKLWQFPNVELESTKNAQQVLGDYIHERFHLDAAVGEYV 301

Query: 297 NTITHTFTHFTLTLFVWKTIVPQIVIIPDST---WHDAQNLANAALPTVMKKAL 347
            T+ H F+H    + V++  V  +  + D     W D + + N A P   +K +
Sbjct: 302 QTVEHVFSHLIWNIRVYEATVKGVPSLNDKYEADWVDDRTIENYAFPVSHQKII 355


>gi|148557583|ref|YP_001265165.1| A/G-specific DNA-adenine glycosylase [Sphingomonas wittichii RW1]
 gi|148502773|gb|ABQ71027.1| A/G-specific DNA-adenine glycosylase [Sphingomonas wittichii RW1]
          Length = 344

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 137/334 (41%), Positives = 179/334 (53%), Gaps = 9/334 (2%)

Query: 10  SKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWP 69
             +L WYD +HR LPWR +P         PY+VW+SEIMLQQTTV  V+PYF +F  +WP
Sbjct: 8   ENLLAWYDAHHRRLPWRAAPGEA---PTDPYRVWLSEIMLQQTTVAAVKPYFDRFTTRWP 64

Query: 70  TIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDY 129
           T+  L+ A + E+++AWAGLGYY RARNL  CA  +   + G FP     L+ LPGIGDY
Sbjct: 65  TVTDLARADEGEVMAAWAGLGYYARARNLIACARAVADDHGGRFPDSEAGLRALPGIGDY 124

Query: 130 TASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQ 189
           +A+AI AIAF   AVVVD N+ER+ SR F   +  P     ++    +IT  +R GDF Q
Sbjct: 125 SAAAIAAIAFGRRAVVVDANVERVASRLFAFDEALPRARPALRALVDRITPDARAGDFAQ 184

Query: 190 AMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITND 249
           AMMDLG+ ICT   P C LCP+   C     G      +   KK +  +       I + 
Sbjct: 185 AMMDLGSSICTVRAPQCLLCPLSAGCAARIAGNPEDYPVKAAKKAK-PQRLGTAFWIEDG 243

Query: 250 NRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLT 309
            R+ L +R +  +L GM  LP   W+    G  D   AP  A W    ++ H FTHF L 
Sbjct: 244 ARVWLVRRPDKGMLGGMRALPSGPWTDEDPGLAD---APVDAPWREAGSVDHVFTHFALR 300

Query: 310 LFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVM 343
           L V      Q +   D  W     +  A LPT+ 
Sbjct: 301 LRV--VTAVQPLRANDGEWWPIDEIEQAGLPTLF 332


>gi|332304467|ref|YP_004432318.1| A/G-specific adenine glycosylase [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332171796|gb|AEE21050.1| A/G-specific adenine glycosylase [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 354

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 123/350 (35%), Positives = 185/350 (52%), Gaps = 17/350 (4%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               ++IL W+D++ R  LPW+           +PY VW+SEIMLQQT VKTV PY++KF
Sbjct: 9   SSFANRILSWFDSHGRKDLPWQQ--------GKTPYSVWVSEIMLQQTQVKTVIPYYQKF 60

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           MQ++P I  L++A  +E+L  W GLGYY RARNL+K A +I  +Y+G FP  +  +  LP
Sbjct: 61  MQRFPDILTLANAPQDEVLHHWTGLGYYARARNLQKAAQVIRDQYDGKFPQDINDVIALP 120

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLY--HKTIKNYARKITSTS 182
           G+G  TA A++++A      ++D N++R+++RYF +          + +  YA  +T  S
Sbjct: 121 GVGRSTAGAVLSLACAQHHSILDGNVKRVLARYFAVDGWPGKKDVEQALWQYADSLTPNS 180

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
           R GD+ QAMMD+GA ICT +KP C  CP+Q+NCL F++G+   L     KK  P+RT  +
Sbjct: 181 RTGDYTQAMMDMGATICTRSKPKCDSCPLQQNCLAFAQGRQSELPGKKPKKDIPVRTTVM 240

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHT 302
            I     +++L+ +R  + L  G+     +    T D      +              HT
Sbjct: 241 LIP-MWQSQVLIYQRPPSGLWGGLWGFYEADSLDTLDATAQQLALGQYTRLT-LEPFRHT 298

Query: 303 FTHFTLTLFVWKTIVPQIVIIP----DSTWHDAQNLANAALPTVMKKALS 348
           F+HF L +      + Q            W+D     N  L    KK L+
Sbjct: 299 FSHFHLDIQPVILQLEQPSSSQVNEKQQIWYDLLKQPNVGLAAPTKKLLA 348


>gi|209963845|ref|YP_002296760.1| A/G-specific adenine glycosylase [Rhodospirillum centenum SW]
 gi|209957311|gb|ACI97947.1| A/G-specific adenine glycosylase [Rhodospirillum centenum SW]
          Length = 408

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 146/345 (42%), Positives = 198/345 (57%), Gaps = 8/345 (2%)

Query: 10  SKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWP 69
           +++L WYD + RVLPWR +P         PY+VW+SEIMLQQTTV TV PYF++F+++WP
Sbjct: 37  ARLLSWYDRHRRVLPWRAAPGERA----DPYRVWLSEIMLQQTTVATVGPYFQEFLRRWP 92

Query: 70  TIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDY 129
           T+  L++A  +++L AWAGLGYY RARNL +CA  + + + G FP     L+ LPGIGDY
Sbjct: 93  TVLDLAAADLDDVLRAWAGLGYYARARNLHRCAVAVARDHGGRFPDTEAELRHLPGIGDY 152

Query: 130 TASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQ 189
           TA+A+ AIAF+  A  VD N+ER+++R F + +P P     ++  A  +   +R GD  Q
Sbjct: 153 TAAAVAAIAFDRPAAAVDGNVERVLARVFRVEEPLPAAKPRLRALAGALVPEARAGDHTQ 212

Query: 190 AMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITND 249
           A+ DLGA ICT  +P C LCP Q +C   + G    L     K ++P R G  F+    D
Sbjct: 213 ALFDLGATICTPRRPRCILCPWQPDCAASAAGVQEDLPRKAAKAEKPTRRGTAFLLCDGD 272

Query: 250 NRILLRKRTNTRLLEGMDELPGSAWS---STKDGNIDTHSAPFTANWILCNTITHTFTHF 306
             +LLR+R  T LL GM E+P + W+      D        P      +  T+ HTFTHF
Sbjct: 273 GAVLLRRRPETGLLGGMMEVPSTDWTGTVPGADAVRAAAPLPGIGWRPVPGTVRHTFTHF 332

Query: 307 TLTLFVWKTIVPQIVII-PDSTWHDAQNLANAALPTVMKKALSAG 350
            L L V    VPQ     P + W     L   ALPTVM+K L   
Sbjct: 333 HLELEVLAGRVPQPAPSVPGAVWVPRAGLEAEALPTVMRKVLRHA 377


>gi|30064282|ref|NP_838453.1| adenine DNA glycosylase [Shigella flexneri 2a str. 2457T]
 gi|56480224|ref|NP_708732.2| adenine DNA glycosylase [Shigella flexneri 2a str. 301]
 gi|30042539|gb|AAP18263.1| adenine glycosylase [Shigella flexneri 2a str. 2457T]
 gi|56383775|gb|AAN44439.2| adenine glycosylase [Shigella flexneri 2a str. 301]
 gi|320181027|gb|EFW55948.1| A/G-specific adenine glycosylase [Shigella boydii ATCC 9905]
 gi|332753010|gb|EGJ83394.1| A/G-specific adenine glycosylase [Shigella flexneri 4343-70]
 gi|332753813|gb|EGJ84192.1| A/G-specific adenine glycosylase [Shigella flexneri K-671]
 gi|332754666|gb|EGJ85032.1| A/G-specific adenine glycosylase [Shigella flexneri 2747-71]
 gi|332765386|gb|EGJ95604.1| A/G-specific adenine glycosylase [Shigella flexneri 2930-71]
 gi|332999954|gb|EGK19537.1| A/G-specific adenine glycosylase [Shigella flexneri K-218]
 gi|333015103|gb|EGK34446.1| A/G-specific adenine glycosylase [Shigella flexneri K-304]
          Length = 350

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 172/359 (47%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM  +PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMAHFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAATNNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRHWLAQRQ-IAADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|227888517|ref|ZP_04006322.1| adenine DNA glycosylase [Escherichia coli 83972]
 gi|222034656|emb|CAP77398.1| A/G-specific adenine glycosylase [Escherichia coli LF82]
 gi|227834786|gb|EEJ45252.1| adenine DNA glycosylase [Escherichia coli 83972]
 gi|307554943|gb|ADN47718.1| adenine DNA glycosylase [Escherichia coli ABU 83972]
 gi|312947493|gb|ADR28320.1| adenine DNA glycosylase [Escherichia coli O83:H1 str. NRG 857C]
          Length = 350

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 173/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMVRFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVAALHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 VLPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQ-ISADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEDNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|157960936|ref|YP_001500970.1| A/G-specific adenine glycosylase [Shewanella pealeana ATCC 700345]
 gi|157845936|gb|ABV86435.1| A/G-specific adenine glycosylase [Shewanella pealeana ATCC 700345]
          Length = 354

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 107/353 (30%), Positives = 167/353 (47%), Gaps = 18/353 (5%)

Query: 7   IIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
              ++I+ WYD   R  LPW+           +PYKVWISEIMLQQT V TV PYF+KF+
Sbjct: 6   SFSTRIITWYDNFGRKQLPWQI--------AKTPYKVWISEIMLQQTQVATVIPYFEKFI 57

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
            ++P I  L+SA+ +E+L  W GLGYY RARNL K A  +  ++ G FP   + +  LPG
Sbjct: 58  ARFPDIDTLASAEQDEVLHYWTGLGYYARARNLHKAAQTMQSQFSGEFPTDFDDVLALPG 117

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTSR 183
           IG  TA A+++++      ++D N++R+++R+  I          + +      +T    
Sbjct: 118 IGRSTAGAVLSLSLGLNFPILDGNVKRVLARHGAIEGWPGKKPVEQQLWLLTENLTPAKD 177

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVF 243
              + QAMMD+GA +CT +KP C  CP+  +C     G+          KK      A  
Sbjct: 178 IQKYNQAMMDIGATVCTRSKPNCAQCPVAIDCKAQLSGRQSEFPGKK-PKKTIPEKSAWL 236

Query: 244 IAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTF 303
           + I  + ++ L KR    +  G+   P  +     D  I        +   L     HTF
Sbjct: 237 LVIEENQQVQLEKRPPAGIWGGLWCFPQFSQRQELDTYIKDKQLKVISELELTG-FRHTF 295

Query: 304 THFTLTLFVWKTIV-----PQIVIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
           +HF L +             QI+    + W++  +     L +  ++ L+  G
Sbjct: 296 SHFHLDVQPVLIRATGHSDNQIMEQTSTVWYNLTHPPKVGLASATERILADLG 348


>gi|170691499|ref|ZP_02882664.1| A/G-specific adenine glycosylase [Burkholderia graminis C4D1M]
 gi|170143704|gb|EDT11867.1| A/G-specific adenine glycosylase [Burkholderia graminis C4D1M]
          Length = 382

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 107/361 (29%), Positives = 179/361 (49%), Gaps = 23/361 (6%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
             S+++ W   + R  LPW+ +           Y++W+SEIMLQQT V TV PY+ KF+ 
Sbjct: 30  FSSRLVAWQRKHGRHDLPWQNT--------RDAYRIWLSEIMLQQTQVSTVIPYYAKFLA 81

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++P +  L++A  +++++ WAGLGYYTRARNL +CA ++V++Y G FP  V+ L +LPGI
Sbjct: 82  RFPDVAALAAAPVDDVMALWAGLGYYTRARNLHRCAQVVVQQYGGAFPASVDELAELPGI 141

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTSRP 184
           G  TA+AI + AF   A ++D N++R+++R F +            +   A  +  ++  
Sbjct: 142 GRSTAAAIASFAFGARATILDGNVKRVLARVFGVEGFPGEKKVENAMWTLAESLLPSNAS 201

Query: 185 GD----FVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG 240
            D    + Q +MDLGA +C   KP C  CP   +C+    G+   L     KK  P R  
Sbjct: 202 DDEVSAYTQGLMDLGATLCVRGKPDCLRCPFAADCVANVTGRQRELPTARPKKVVPTRRT 261

Query: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPF-TANWILCNTI 299
              + + + N ++L KR  + +  G+  LP +A  +               ++      +
Sbjct: 262 -WMLVLRDGNAVMLEKRPPSGIWGGLWSLPEAADEAALATRAREFGGGAGVSSLAPLAPL 320

Query: 300 THTFTHFTLTLFVWKTIVPQI------VIIPDSTWHDAQNLANAALPTVMKKALSAGGIK 353
           TH FTHF L +      + +       +   D+ W    +L +  +P  ++K L      
Sbjct: 321 THVFTHFKLDIEPRLAELERGVGALAALGDADTAWVALSDLDSFGVPAPVRKLLDGLQGS 380

Query: 354 V 354
           +
Sbjct: 381 L 381


>gi|258620714|ref|ZP_05715749.1| A/G-specific adenine glycosylase [Vibrio mimicus VM573]
 gi|258586912|gb|EEW11626.1| A/G-specific adenine glycosylase [Vibrio mimicus VM573]
          Length = 369

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 106/351 (30%), Positives = 176/351 (50%), Gaps = 17/351 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
               IL WYD   R  LPW+ +         + Y+VW+SEIMLQQT V TV PYF++F++
Sbjct: 20  FAQVILTWYDAYGRKNLPWQQN--------KNAYRVWLSEIMLQQTQVATVIPYFERFLE 71

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A  +E+L  W GLGYY RARNL K A ++V +Y G FP  +E +  LPG+
Sbjct: 72  RFPTVQALAAAPQDEVLHFWTGLGYYARARNLHKAAQMVVSEYGGEFPTDLEQMNALPGV 131

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++  +     ++D N++R ++R F +            + +YA   T +   
Sbjct: 132 GRSTAAAVLSSVYKKPHAILDGNVKRTLARCFAVEGWPGQKSVENQLWHYAEMHTPSVDV 191

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA+ICT +KP C LCP++  CL   +G          K  +P++    F+
Sbjct: 192 DKYNQAMMDMGAMICTRSKPKCSLCPVESFCLAKQQGNPQEYPGKKPKTDKPVKET-WFV 250

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSA-PFTANWILCNTITHTF 303
            + ++N + L +R  T +  G+   P S  ++ +              +        HTF
Sbjct: 251 MLYHNNAVWLEQRPQTGIWGGLYCFPQSEIANIQTTIDQRAIGDNAIKSQKTLIAFRHTF 310

Query: 304 THFTLTLFVWKTIVPQ----IVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ L +      + +    I+      W++        L   +K+ L + 
Sbjct: 311 SHYHLDITPILLELSRKPDIIMEGSKGLWYNLSQPDEIGLAAPVKQLLHSL 361


>gi|229519838|ref|ZP_04409272.1| A/G-specific adenine glycosylase [Vibrio cholerae TM 11079-80]
 gi|229343126|gb|EEO08110.1| A/G-specific adenine glycosylase [Vibrio cholerae TM 11079-80]
          Length = 378

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 102/351 (29%), Positives = 169/351 (48%), Gaps = 17/351 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
               IL WYD   R  LPW+ +         + Y+VW+SEIMLQQT V TV PYF++F++
Sbjct: 29  FAQAILTWYDAYGRKNLPWQQN--------KNAYRVWLSEIMLQQTQVATVIPYFERFLE 80

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A  +E+L  W GLGYY RARNL K A ++V +Y G FP  +E +  LPG+
Sbjct: 81  RFPTVHALAAAPQDEVLHFWTGLGYYARARNLHKAAQMVVSEYGGEFPTDLEQMNALPGV 140

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++  +     ++D N++R ++R F +            + +YA   T +   
Sbjct: 141 GRSTAAAVLSSVYKKPHAILDGNVKRTLARCFAVEGWPGQKSVENQLWHYAEMHTPSVDV 200

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA+IC  +KP C LCP++  CL   +G          K  +       F+
Sbjct: 201 DKYNQAMMDMGAMICIRSKPKCSLCPVESLCLAKQQGNPQEYPGKKPKTDK-PVKATWFV 259

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSA-PFTANWILCNTITHTF 303
            + + N + L +R  + +  G+   P S  ++ +              +        HTF
Sbjct: 260 MLYHGNAVWLEQRPQSGIWGGLYCFPQSEIANIQTTIDQRAIGDSTITSQKTLIAFRHTF 319

Query: 304 THFTLTLFVWKTIVPQIV----IIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ L +      + +            W++        L   +K+ L + 
Sbjct: 320 SHYHLDITPILLQLSRKPDIVMEGSKGLWYNLSQPDEIGLAAPVKQLLHSL 370


>gi|331005989|ref|ZP_08329332.1| A/G-specific adenine glycosylase [gamma proteobacterium IMCC1989]
 gi|330420165|gb|EGG94488.1| A/G-specific adenine glycosylase [gamma proteobacterium IMCC1989]
          Length = 348

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 115/354 (32%), Positives = 179/354 (50%), Gaps = 16/354 (4%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               +  L W+D + R  LPW+ +         + Y+VW+SEIMLQQT V TV PY+++F
Sbjct: 4   RNFSTDTLKWFDQHGRKHLPWQQN--------RTAYRVWVSEIMLQQTQVTTVIPYYERF 55

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M  +P++F L+ A  +++L+ WAGLGYY R RNL KCA  +V  ++GNFP  V+ L  L 
Sbjct: 56  MNSFPSVFDLARASQDDVLNHWAGLGYYARGRNLHKCAQAVVDLHQGNFPETVDGLVALS 115

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYH--KTIKNYARKITSTS 182
           GIG  TA AI++++    A ++D N++R+++RY  +          +T+  YA + T   
Sbjct: 116 GIGRSTAGAIISLSSGKRATILDGNVKRVLARYHGVEGWTGKVSVAETLWQYAEEHTPEQ 175

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
           R  DF QAMMDLGA +CT +KP C  CP++ NC  ++EGK   L     KK  P++T   
Sbjct: 176 RCDDFNQAMMDLGATLCTRSKPDCQRCPLKPNCYAYAEGKQAELPNKKPKKTIPIKTTQW 235

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHT 302
            +   + ++I L +R    +  G+   P  A         + H      N+       HT
Sbjct: 236 LVLRNSQDQIYLEQRPQQGIWGGLWSFPEIATDDDGQAISEAHHGK-VKNYSQTEPFRHT 294

Query: 303 FTHFTLTLFVWKTIVPQI----VIIPDSTWHDAQNLANAALPTVMKKALSAGGI 352
           F+H+ L +      + +            W     L    +P  ++K +    I
Sbjct: 295 FSHYHLDIQPTLIELSKPHRQVRSDEQGRWFALTELNTIGMPAPVEKLIKHLSI 348


>gi|261210029|ref|ZP_05924327.1| A/G-specific adenine glycosylase [Vibrio sp. RC341]
 gi|260840794|gb|EEX67336.1| A/G-specific adenine glycosylase [Vibrio sp. RC341]
          Length = 353

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 105/351 (29%), Positives = 170/351 (48%), Gaps = 17/351 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
               IL WYD   R  LPW+ +         + Y+VW+SEIMLQQT V TV PYF++F++
Sbjct: 4   FAQAILTWYDAYGRKNLPWQQN--------KNAYRVWLSEIMLQQTQVATVIPYFERFLE 55

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A  +E+L  W GLGYY RARNL K A  +V +Y G FP  +E +  LPG+
Sbjct: 56  RFPTVQALAAAPQDEVLHFWTGLGYYARARNLHKAAQTVVSEYGGEFPTDLEQMNALPGV 115

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++  +     ++D N++R ++R F +            + +YA   T +   
Sbjct: 116 GRSTAAAVLSSVYKKPHAILDGNVKRTLARCFAVEGWPGQKSVENQLWHYAEMHTPSVDV 175

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA+ICT +KP C LCP++  CL   +G          K  +       F+
Sbjct: 176 DKYNQAMMDMGAMICTRSKPKCSLCPVESFCLAKQQGNPQEYPGKKPKTDK-PIKATWFV 234

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSA-PFTANWILCNTITHTF 303
            + +DN + L +R  T +  G+   P S  ++ +              +        HTF
Sbjct: 235 MLYHDNAVWLEQRPQTGIWGGLYCFPQSEVANIQTTIDQRAIGDSTIKSQKTLIAFRHTF 294

Query: 304 THFTLTLFVWKTIVPQIV----IIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ L +      + +            W++        L   +K+ L + 
Sbjct: 295 SHYHLDITPILLQLSRKPDIVMEGSKGLWYNLSQPDEIGLAAPVKQLLHSL 345


>gi|229587885|ref|YP_002870004.1| A/G-specific adenine glycosylase [Pseudomonas fluorescens SBW25]
 gi|229359751|emb|CAY46601.1| A/G-specific adenine glycosylase [Pseudomonas fluorescens SBW25]
          Length = 355

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 124/355 (34%), Positives = 177/355 (49%), Gaps = 15/355 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                    +LDWYD + R  LPW+           +PY+VW+SEIMLQQT V TV  YF
Sbjct: 1   MRNEQFSEAVLDWYDRHGRHDLPWQQ--------GITPYRVWVSEIMLQQTQVSTVLNYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FM   PT+  L++A ++E+L  W GLGYYTRARNL+K A I+V +Y G FP  VE L 
Sbjct: 53  DRFMASLPTVEALAAAPEDEVLHLWTGLGYYTRARNLQKTAKIVVAEYGGEFPRDVEKLT 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
           +LPGIG  TA AI +++    A ++D N++R+++R+         P   K +   A + T
Sbjct: 113 ELPGIGLSTAGAIASLSMGLRAPILDGNVKRVLARFTAQEGYPGEPKVAKQLWATAERFT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              R   + QAMMD+GA +CT +KP C LCP++K C     G      I   +K  P + 
Sbjct: 173 PHDRVNAYTQAMMDMGATLCTRSKPSCLLCPLEKGCEAHMLGLETRYPIPKPRKTIPQKR 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +    +  ILL +R +T L  G+  LP        +   + H+        L   I
Sbjct: 233 TLMPLLANAEGAILLYRRPSTGLWGGLWSLPELDDLQDLEHLANQHALELGKPQELPGLI 292

Query: 300 THTFTHFTLTLFVWKTIVPQI---VIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
            HTF+HF L +  W   V +    V   D  W++        L   +KK L    
Sbjct: 293 -HTFSHFQLAIEPWLVQVEESAHHVAEADWLWYNLATPPRLGLAAPVKKLLKRAA 346


>gi|126440431|ref|YP_001057627.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei 668]
 gi|126454675|ref|YP_001064873.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei 1106a]
 gi|242317225|ref|ZP_04816241.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei 1106b]
 gi|126219924|gb|ABN83430.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei 668]
 gi|126228317|gb|ABN91857.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei 1106a]
 gi|242140464|gb|EES26866.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei 1106b]
          Length = 368

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 102/362 (28%), Positives = 171/362 (47%), Gaps = 25/362 (6%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
                 ++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+ +F
Sbjct: 18  SAFAPTLIAWQRKHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVVPYYVRF 69

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           ++++P +  L++A  +++++ WAGLGYY+RARNL +CA  +V+++ G FP   E L +LP
Sbjct: 70  LERYPDVAALAAAPIDDVMALWAGLGYYSRARNLHRCAQAVVERHGGAFPASPEALAELP 129

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITS-- 180
           GIG  TA+AI + AF   A ++D N++R+++R F +            +   A  +    
Sbjct: 130 GIGRSTAAAIASFAFGARATILDGNVKRVLARVFGVEGFPGDKRIENEMWALAEALLPDA 189

Query: 181 --TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
              +    + Q +MDLGA +C   KP C  CP   +C+    G+   L     KK  P R
Sbjct: 190 AEPTDVTAYTQGLMDLGATLCVRGKPECGRCPFAGDCVAQRSGRQRELPAARPKKAVPTR 249

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
                + + + + +LL++R    +  G+  LP +   +              A  +    
Sbjct: 250 RT-WMLVLRDGDAVLLQRRPPAGIWGGLWSLPEADGDAALARRAREFGG---AALVPLAP 305

Query: 299 ITHTFTHFTLTLFVWKTIV------PQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGI 352
           +THTFTHF L +      +             ++ W     L    +P  ++K L     
Sbjct: 306 LTHTFTHFRLEIEPRLAELDGAAGGAPPAADDETAWVLLDRLDAYGVPAPVRKLLDGLSG 365

Query: 353 KV 354
            +
Sbjct: 366 PL 367


>gi|254230235|ref|ZP_04923627.1| A/G-specific adenine glycosylase [Vibrio sp. Ex25]
 gi|262393219|ref|YP_003285073.1| A/G-specific adenine glycosylase [Vibrio sp. Ex25]
 gi|151937267|gb|EDN56133.1| A/G-specific adenine glycosylase [Vibrio sp. Ex25]
 gi|262336813|gb|ACY50608.1| A/G-specific adenine glycosylase [Vibrio sp. Ex25]
          Length = 358

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 105/358 (29%), Positives = 167/358 (46%), Gaps = 23/358 (6%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
             S IL+WYD   R  LPW+ +         + Y VW+SEIMLQQT V TV PY+++F++
Sbjct: 4   FASAILEWYDAYGRKDLPWQQN--------KTAYSVWLSEIMLQQTQVTTVIPYYQRFLE 55

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A+ +E+L  W GLGYY RARNL K A  +   Y G FP  +E +  LPGI
Sbjct: 56  RFPTVIDLANAEQDEVLHLWTGLGYYARARNLHKAAQEVASTYNGEFPLDIEKMNALPGI 115

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++  +     ++D N++R +SR F +            +   A   T  +  
Sbjct: 116 GRSTAAAVLSSVYKQPHAILDGNVKRTLSRCFAVEGWPGQKKVENQLWEIAETHTPQTDV 175

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGK---SHLLGINTIKKKRPMRTGA 241
             + QAMMD+GA++CT +KP C LCP+   C+   +G             K  +  R   
Sbjct: 176 DKYNQAMMDMGAMVCTRSKPKCSLCPVADLCVAKQQGNVLDYPGKKPKKDKPIKQTRFVM 235

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAW---SSTKDGNIDTHSAPF--TANWILC 296
           +     + + + L +R  T +  G+   P +      S  +  +D               
Sbjct: 236 LHHNTESGHEVWLEQRPQTGIWGGLFCFPQTEHVDVESDIELLLDQRGIQASNIKQQQTL 295

Query: 297 NTITHTFTHFTLTLFVWKTIVPQ----IVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            T  HTF+H+ L +      + +    I+      W++        L   +K  L A 
Sbjct: 296 ITFRHTFSHYHLDITPILIDLSKQPDVIMEGNKGLWYNLSKPEEVGLAAPVKLLLEAL 353


>gi|149376061|ref|ZP_01893827.1| A/G specific adenine glycosylase [Marinobacter algicola DG893]
 gi|149359698|gb|EDM48156.1| A/G specific adenine glycosylase [Marinobacter algicola DG893]
          Length = 354

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 121/351 (34%), Positives = 182/351 (51%), Gaps = 17/351 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
              K+L WYD N R  LPW            +PY+VW+SEIMLQQT V TV PYF+ FMQ
Sbjct: 5   FAQKLLAWYDENGRHDLPW--------HHDRNPYRVWVSEIMLQQTQVTTVIPYFEAFMQ 56

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++P +  L+SA  +++LS W+GLGYY RARNL+K A  +  ++ G FP  +E L+ LPGI
Sbjct: 57  RFPDVKALASAPVDDVLSHWSGLGYYARARNLQKAAQQVANEHGGEFPGNLEQLQALPGI 116

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYH--KTIKNYARKITSTSRP 184
           G  TA+AI+A AF   A ++D N++R+++RY  I            +   A + T  +R 
Sbjct: 117 GRSTAAAILAQAFQQRAAILDGNVKRVLARYHAIPGWPGKTDVLNQLWERAEEHTPDARI 176

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
            D+ QA+MDLGA++CT ++P C  CP+Q  C  ++  ++ L   +  KK +P +T  + I
Sbjct: 177 RDYTQAIMDLGAMVCTRSRPACDNCPLQNGCDAYANNETSLYPGSKPKKAKPEKTTWMVI 236

Query: 245 AITNDNRILLRKRTNTRLLEGMD---ELPGSAWSSTKDGNIDTHSAPFTANWILCNTITH 301
              +  RILL +R  + +  G+    EL  +          +           L +   H
Sbjct: 237 LEDHQGRILLERRPPSGIWGGLWSLPELDPAYGPEELPDACEQAFGFHCGEPELTSGFRH 296

Query: 302 TFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSA 349
           TF+H+ L +   +  V     I D     W          LP  ++  L+A
Sbjct: 297 TFSHYHLHIQPARLTVQSPAHINDRDSYKWVHRDQALTLGLPAPIRTLLTA 347


>gi|239993034|ref|ZP_04713558.1| A/G-specific adenine glycosylase [Alteromonas macleodii ATCC 27126]
          Length = 355

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 113/355 (31%), Positives = 175/355 (49%), Gaps = 21/355 (5%)

Query: 7   IIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
               ++L W+D + R  LPW+           +PYKVW+SEIMLQQT V TV PYFK+FM
Sbjct: 9   SFAERVLAWFDKHGRKHLPWQQDV--------TPYKVWVSEIMLQQTQVTTVIPYFKRFM 60

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
             +PT+  L+ A  +++L  W GLGYY RARNL K A+++V  Y G FP+ +E +  LPG
Sbjct: 61  ASFPTVHDLAKASQDDVLHHWTGLGYYARARNLHKAANMLVDNYNGEFPYTLEEVMDLPG 120

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTS- 182
           IG  TA AI++++ N    ++D N++R+++RY+ I            +   A K T T+ 
Sbjct: 121 IGRSTAGAILSLSRNMRFPILDGNVKRVLARYYAIGGWPGQKKVENQLWEVAEKNTPTNS 180

Query: 183 ---RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              R  ++ Q MMDLGA+ICT +KP C  CP+Q +C+ +++G          KK  P ++
Sbjct: 181 EGGRCANYTQVMMDLGAMICTRSKPKCDECPLQADCIAYAQGAQADYPGKKPKKALPEKS 240

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +A   ++++ L +R +T L  G+      +        +            L    
Sbjct: 241 TYMMVA-QFNSQVYLEQRPSTGLWGGLYGFIEVSSIEEGIEQLAKRGINVDETRTLEG-F 298

Query: 300 THTFTHFTLTLFVWKTIVP----QIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            HTF+HF L +     +V     + V      W          L     K +   
Sbjct: 299 RHTFSHFHLDITPVVAVVNSAPTKRVAETAFRWFSLNEPIEVGLAAPTTKIIQQL 353


>gi|303253155|ref|ZP_07339304.1| A/G-specific adenine glycosylase [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307248798|ref|ZP_07530811.1| A/G-specific adenine glycosylase [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307257828|ref|ZP_07539585.1| A/G-specific adenine glycosylase [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|302647837|gb|EFL78044.1| A/G-specific adenine glycosylase [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|306854725|gb|EFM86915.1| A/G-specific adenine glycosylase [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306863734|gb|EFM95660.1| A/G-specific adenine glycosylase [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
          Length = 381

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 108/374 (28%), Positives = 167/374 (44%), Gaps = 35/374 (9%)

Query: 4   PEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFK 62
           P       +L W+    R  LPW+ +         + Y VW+SE+MLQQT V TV PYF+
Sbjct: 14  PAQPFAKAVLAWFAQYGRKHLPWQQN--------KTLYGVWLSEVMLQQTQVATVIPYFE 65

Query: 63  KFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKK 122
           +F++++PT+  L+ A  +E+L  W GLGYY RARNL K A  I  ++ G FP   + +  
Sbjct: 66  RFIERFPTVTDLADAYIDEVLHLWTGLGYYARARNLHKAAQQIRDQFNGEFPTDFDDVLA 125

Query: 123 LPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITS 180
           L G+G  TA AI++   N    ++D N++R++SR F +           T+      +T 
Sbjct: 126 LSGVGRSTAGAILSSVLNAPHPILDGNVKRVLSRAFAVEGWSGEKSVENTLWQLTASVTP 185

Query: 181 TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG 240
             +  DF QAMMDLGA++CT +KP C LCP+   C                KK  P R  
Sbjct: 186 NRQVADFNQAMMDLGAMVCTRSKPKCSLCPLVDLCEANRLEAWDKFPAKKPKKVLPERQA 245

Query: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTIT 300
             F+ I + ++ILL +R    L  G+   P    +     ++   +   +          
Sbjct: 246 -YFLIIKSGSKILLEQREAKGLWGGLYVFPQFENTEELKRSLSERNLQVS---QQLIAFR 301

Query: 301 HTFTHFTLTLFVWKTIVPQIVIIPDS--------------------TWHDAQNLANAALP 340
           HTF+HF L +      +       +                      W+D Q  +   L 
Sbjct: 302 HTFSHFHLDITPILVDLDLQKNPQNQPLVVQENCGNYRLSVSSTANYWYDLQLPSEIGLA 361

Query: 341 TVMKKALSAGGIKV 354
           T +K+ L    + +
Sbjct: 362 TPVKRILDELSLTL 375


>gi|254511371|ref|ZP_05123438.1| A/G-specific adenine glycosylase [Rhodobacteraceae bacterium KLH11]
 gi|221535082|gb|EEE38070.1| A/G-specific adenine glycosylase [Rhodobacteraceae bacterium KLH11]
          Length = 343

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 148/343 (43%), Positives = 196/343 (57%), Gaps = 7/343 (2%)

Query: 8   IQSKILDWYDTNHRVLPWRTSPKTEKSSL-PSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
           +   +L WYD + R +PWR  P    + + P PY+VW+SE+MLQQTTV  V  YF +F  
Sbjct: 1   MSDALLAWYDRHAREMPWRIGPADRAAGVLPDPYRVWLSEVMLQQTTVAAVRDYFVRFTS 60

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           +WPT+  L++A DE+++  WAGLGYY RARNL KCA I+   + G FP   + L +LPGI
Sbjct: 61  RWPTVDALAAAADEQVMGEWAGLGYYARARNLLKCARIVTSDHGGQFPDSYDALLQLPGI 120

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGD 186
           G YTA+AI AIAF+    V+D N+ER+++R +DI  P P     +K+ A  +T  SRPGD
Sbjct: 121 GPYTAAAIAAIAFDRPETVLDGNVERVMARLYDIHDPLPGSKPALKSKAAALTPQSRPGD 180

Query: 187 FVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAI 246
           + QA+MDLGA ICT   P C +CP+ + C   + G    L   T KK +P R G ++IA 
Sbjct: 181 YAQAVMDLGATICTPKSPACGICPLCQPCRARAAGTQADLPAKTPKKPKPTRHGHIYIAQ 240

Query: 247 TNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILC-NTITHTFTH 305
             D  +LL +R    LL GM   PGS WS T        + PF A W      + HTFTH
Sbjct: 241 RKDGALLLERRPEKGLLGGMLGWPGSDWSETP-----AENPPFPAQWREIPGEVRHTFTH 295

Query: 306 FTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALS 348
           F L L +W   +P        T  D        LPTVM+KA  
Sbjct: 296 FHLILRLWTAELPHREAPTGLTIMDKHQFRPGDLPTVMRKAFD 338


>gi|121590724|ref|ZP_01678056.1| A/G-specific adenine glycosylase [Vibrio cholerae 2740-80]
 gi|153828386|ref|ZP_01981053.1| A/G-specific adenine glycosylase [Vibrio cholerae 623-39]
 gi|254291162|ref|ZP_04961958.1| A/G-specific adenine glycosylase [Vibrio cholerae AM-19226]
 gi|121547455|gb|EAX57564.1| A/G-specific adenine glycosylase [Vibrio cholerae 2740-80]
 gi|148876095|gb|EDL74230.1| A/G-specific adenine glycosylase [Vibrio cholerae 623-39]
 gi|150422856|gb|EDN14807.1| A/G-specific adenine glycosylase [Vibrio cholerae AM-19226]
          Length = 353

 Score =  247 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 104/351 (29%), Positives = 170/351 (48%), Gaps = 17/351 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
               IL WYD   R  LPW+ +         + Y+VW+SEIMLQQT V TV PYF++F++
Sbjct: 4   FAQAILTWYDAYGRKNLPWQQN--------KNAYRVWLSEIMLQQTQVATVIPYFERFLE 55

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A  +E+L  W GLGYY RARNL K A ++V +Y G FP  +E +  LPG+
Sbjct: 56  RFPTVQALAAAPQDEVLHFWTGLGYYARARNLHKAAQMVVSEYGGEFPTDLEQMNALPGV 115

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++  +     ++D N++R ++R F +            + +YA   T     
Sbjct: 116 GRSTAAAVLSSVYKKPHAILDGNVKRTLARCFAVEGWPGQKSVENQLWHYAEMHTPKVDV 175

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA+ICT +KP C LCP++  CL   +G          K  +       F+
Sbjct: 176 DKYNQAMMDMGAMICTRSKPKCSLCPVESFCLAKQQGNPQEYPGKKPKTDK-PVKATWFV 234

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSA-PFTANWILCNTITHTF 303
            + +DN + L +R  + +  G+   P S  ++ +              +        HTF
Sbjct: 235 MLYHDNAVWLEQRPQSGIWGGLYCFPQSEIANIQTTIDQRAIGDSTITSQKTLIAFRHTF 294

Query: 304 THFTLTLFVWKTIVPQIV----IIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ L +      + +            W++        L   +K+ L + 
Sbjct: 295 SHYHLDITPILLQLSRKPDIVMEGSKGLWYNLSQPDEIGLAAPVKQLLHSL 345


>gi|138894142|ref|YP_001124595.1| A/G-specific adenine DNA glycosylase [Geobacillus
           thermodenitrificans NG80-2]
 gi|134265655|gb|ABO65850.1| A/G-specific adenine DNA glycosylase [Geobacillus
           thermodenitrificans NG80-2]
          Length = 368

 Score =  247 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 112/351 (31%), Positives = 171/351 (48%), Gaps = 16/351 (4%)

Query: 4   PEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKK 63
           P    Q  +LDW+    R LPWR            PYKVW+SE+MLQQT V+TV PYF+K
Sbjct: 11  PAREFQRDLLDWFARERRDLPWRQD--------RDPYKVWVSEVMLQQTRVETVIPYFEK 62

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           F++++PT+  L+ A ++E+L AW GLGYY+R RNL      + ++Y G  P   +   KL
Sbjct: 63  FIRQFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKERYGGKVPDNPDEFSKL 122

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPL--YHKTIKNYARKITST 181
            G+G YT  A++++A+      VD N+ R++SR F +          K  +   R+I + 
Sbjct: 123 KGVGPYTVGAVLSLAYGVPEPAVDGNVMRVLSRLFLVTDDIAKASTRKRFEQIVREIMAY 182

Query: 182 SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGA 241
            +PG F +A+++LGAL+CT  +P C LCP+Q +C  F+EG    L + T K        A
Sbjct: 183 EQPGAFNEALIELGALVCTPRRPSCLLCPVQAHCRAFAEGVPEELPVKTKKTAVKQVPLA 242

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAW-----SSTKDGNIDTHSAPFTANWILC 296
           V +    + RIL+RKR +T LL  + E P             +                 
Sbjct: 243 VAVLTDQEGRILIRKRDHTGLLANLWEFPSCEMKGEGEKENLERAFLNEQGLDVKLGEPI 302

Query: 297 NTITHTFTHFTLTLFVWKTIVPQIVIIPD-STWHDAQNLANAALPTVMKKA 346
            +  H F+H    L V+   +     + +       + L   A P   ++ 
Sbjct: 303 VSFDHVFSHLVWKLTVFYGRLLDGERLEEPYRLVSERELETYAFPVSHQRV 353


>gi|254226319|ref|ZP_04919910.1| A/G-specific adenine glycosylase [Vibrio cholerae V51]
 gi|125621181|gb|EAZ49524.1| A/G-specific adenine glycosylase [Vibrio cholerae V51]
          Length = 353

 Score =  247 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 104/351 (29%), Positives = 171/351 (48%), Gaps = 17/351 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
               IL WYD   R  LPW+ +         + Y+VW+SEIMLQQT V TV PYF++F++
Sbjct: 4   FAQAILTWYDAYGRKNLPWQQN--------KNAYRVWLSEIMLQQTQVATVIPYFERFLE 55

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A  +E+L  W GLGYY RARNL K A ++V +Y G FP  +E +  LPG+
Sbjct: 56  RFPTVQALAAAPQDEVLHFWTGLGYYARARNLHKAAQMVVSEYGGEFPTDLEQMNALPGV 115

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++  +     ++D N++R ++R F +            + +YA   T     
Sbjct: 116 GRSTAAAVLSSVYKKPHAILDGNVKRTLARCFAVEGWPGQKSVENQLWHYAEMHTPKVDV 175

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA+ICT +KP C LCP++  CL   +G          K ++       F+
Sbjct: 176 DKYNQAMMDMGAMICTRSKPKCSLCPVESFCLAKQQGNPQEYPGKKPKTEK-PVKATWFV 234

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSA-PFTANWILCNTITHTF 303
            + +DN + L +R  + +  G+   P S  ++ +              +        HTF
Sbjct: 235 MLYHDNAVWLEQRPQSGIWGGLYCFPQSEIANIQTTIDQRAIGDSTITSQKTLIAFRHTF 294

Query: 304 THFTLTLFVWKTIVPQIV----IIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ L +      + +            W++        L   +K+ L + 
Sbjct: 295 SHYHLDITPILLQLSRKPDIVMEGSKGLWYNLSQPDEIGLAAPVKQLLHSL 345


>gi|197284227|ref|YP_002150099.1| adenine DNA glycosylase [Proteus mirabilis HI4320]
 gi|194681714|emb|CAR40854.1| A/G-specific adenine glycosylase [Proteus mirabilis HI4320]
          Length = 346

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 106/355 (29%), Positives = 165/355 (46%), Gaps = 16/355 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                    +LDWY    R  LPW+           +PY VW+SE+MLQQT V TV PYF
Sbjct: 2   MDAQQFSQVVLDWYHKYGRKTLPWQQ--------EKTPYHVWLSEVMLQQTQVATVIPYF 53

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++F+ ++P +  L+ A  +E+L  W GLGYY RARNL K A  IV K++G FP   E + 
Sbjct: 54  ERFIARFPNVSALAKAPLDEVLHLWTGLGYYARARNLHKAAQHIVDKHQGQFPDTFEDVC 113

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            +   + ++T
Sbjct: 114 ALPGVGRSTAGAILSLSLKKPYPILDGNVKRVLARCYAVEGWPGKKEVENKLWEISEQVT 173

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
            T     F QAMMDLGA++CT  KP C LCP+   C+ ++             KK     
Sbjct: 174 PTKGVEYFNQAMMDLGAMVCTRTKPKCELCPLNTGCIAYAHHSWADYPGKK-PKKAIPEK 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
              F+ +  DN + L KR    +  G+   P        +  +  H         L  + 
Sbjct: 233 TTYFLILQYDNLVWLDKRPPAGIWGGLFSFPQFETKMLLEQWLAEHGLENNKTEQLI-SF 291

Query: 300 THTFTHFTLTLFVWKTIVP---QIVIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
            HTF+HF L +      +     ++      W++ Q  A+  L   ++  L    
Sbjct: 292 RHTFSHFHLDIVPICVKLSTFTSLMEAQQGLWYNLQTPASVGLAAPVENLLRQLA 346


>gi|297580591|ref|ZP_06942517.1| A/G-specific adenine glycosylase [Vibrio cholerae RC385]
 gi|297535007|gb|EFH73842.1| A/G-specific adenine glycosylase [Vibrio cholerae RC385]
          Length = 353

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 104/351 (29%), Positives = 171/351 (48%), Gaps = 17/351 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
               IL WYD   R  LPW+ +         + Y+VW+SEIMLQQT V TV PYF++F++
Sbjct: 4   FAQAILTWYDAYGRKNLPWQQN--------KNAYRVWLSEIMLQQTQVATVIPYFERFLE 55

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A  +E+L  W GLGYY RARNL K A  +V +Y G FP  +E++  LPG+
Sbjct: 56  RFPTVQALAAAPQDEVLHFWTGLGYYARARNLHKAAQTVVNQYGGEFPTDLELMNALPGV 115

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++  +     ++D N++R ++R F +            + +YA   T     
Sbjct: 116 GRSTAAAVLSSVYKKPHAILDGNVKRTLARCFAVEGWPGQKSVENQLWHYAEMHTPKVDV 175

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA+ICT +KP C LCP++  CL   +G          K ++       F+
Sbjct: 176 DKYNQAMMDMGAMICTRSKPKCSLCPVESFCLAKQQGNPQEYPGKKPKTEK-PVKATWFV 234

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSA-PFTANWILCNTITHTF 303
            + +DN + L +R  + +  G+   P S  ++ +              +        HTF
Sbjct: 235 MLYHDNAVWLEQRPQSGIWGGLYCFPQSEIANIQTTIDQRAIGDSTITSQKTLIAFRHTF 294

Query: 304 THFTLTLFVWKTIVPQIV----IIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ L +      + +            W++        L   +K+ L + 
Sbjct: 295 SHYHLDITPILLQLSRKPDIVMEGSKGLWYNLSQPDEIGLAAPVKQLLHSL 345


>gi|327483305|gb|AEA77712.1| A/G-specific adenine glycosylase [Vibrio cholerae LMA3894-4]
          Length = 353

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 104/351 (29%), Positives = 170/351 (48%), Gaps = 17/351 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
               IL WYD   R  LPW+ +         + Y+VW+SEIMLQQT V TV PYF++F++
Sbjct: 4   FAQAILTWYDAYGRKNLPWQQN--------KNAYRVWLSEIMLQQTQVATVIPYFERFLE 55

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A  +E+L  W GLGYY RARNL K A ++V +Y G FP  +E +  LPG+
Sbjct: 56  RFPTVQALAAAPQDEVLHFWTGLGYYARARNLHKAAQMVVSEYGGEFPTDLEQMNALPGV 115

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++  +     ++D N++R ++R F +            + +YA   T     
Sbjct: 116 GRSTAAAVLSSVYKKPHAILDGNVKRTLARCFAVEGWPGQKSVENQLWHYAEMHTPKVDV 175

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA+ICT +KP C LCP++  CL   +G          K  +       F+
Sbjct: 176 DKYNQAMMDMGAMICTRSKPKCSLCPVESFCLAKQQGNPQEYPSKKPKTDK-PVKATWFV 234

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSA-PFTANWILCNTITHTF 303
            + +DN + L +R  + +  G+   P S  ++ +              +        HTF
Sbjct: 235 MLYHDNAVWLEQRPQSGIWGGLYCFPQSEIANIQTTIDQRAIGDSTITSQKTLIAFRHTF 294

Query: 304 THFTLTLFVWKTIVPQIV----IIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ L +      + +            W++        L   +K+ L + 
Sbjct: 295 SHYHLDITPILLQLSRKPDIVMEGSKGLWYNLSQPDEIGLAAPVKQLLHSL 345


>gi|153826576|ref|ZP_01979243.1| A/G-specific adenine glycosylase [Vibrio cholerae MZO-2]
 gi|149739668|gb|EDM53882.1| A/G-specific adenine glycosylase [Vibrio cholerae MZO-2]
          Length = 353

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 106/351 (30%), Positives = 172/351 (49%), Gaps = 17/351 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
               IL WYD   R  LPW+ +         + Y+VW+SEIMLQQT V TV PYF++F++
Sbjct: 4   FAQAILTWYDAYGRKNLPWQQN--------KNAYRVWLSEIMLQQTQVATVIPYFERFLE 55

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A  +E+L  W GLGYY RARNL K A ++V +Y G FP  +E +  LPG+
Sbjct: 56  RFPTVQALAAAPQDEVLHFWTGLGYYARARNLHKAAQMVVSEYGGKFPTDLEQMNALPGV 115

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++  F     ++D N++R ++R F +            + +YA   T     
Sbjct: 116 GRSTAAAVLSSVFKKPHAILDGNVKRTLARCFAVEGWPGQKSVENQLWHYAEMHTPKVDV 175

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA+ICT +KP C LCP++  CL   +G          K  +       F+
Sbjct: 176 DKYNQAMMDMGAMICTRSKPKCSLCPVESFCLAKQQGNPQEYPGKKPKTDK-PVKATWFV 234

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSA-PFTANWILCNTITHTF 303
            + +DN + L +R  + +  G+   P S  ++ +              +        HTF
Sbjct: 235 MLYHDNAVWLEQRPQSGIWGGLYCFPQSEIANIQTTIDQRAIGDSTITSQKTLIAFRHTF 294

Query: 304 THFTLTLFVWKTIVPQ----IVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ L +      + +    I+      W++        L   +K+ L + 
Sbjct: 295 SHYHLDITPILLQLSRKPDIIMEGSKGLWYNLSQPDEIGLAAPVKQLLHSL 345


>gi|89100161|ref|ZP_01173029.1| YfhQ [Bacillus sp. NRRL B-14911]
 gi|89085127|gb|EAR64260.1| YfhQ [Bacillus sp. NRRL B-14911]
          Length = 365

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 121/355 (34%), Positives = 177/355 (49%), Gaps = 18/355 (5%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
           +   +  ++ W++   R LPWR            PYKVW+SEIMLQQT V TV PYF +F
Sbjct: 14  KETFRQDLIGWFEQEQRTLPWRQD--------QDPYKVWVSEIMLQQTRVDTVIPYFNRF 65

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           ++++PTI  L+ A+++++L AW GLGYY+RARNL+     + + Y G  P   + +  L 
Sbjct: 66  IEQFPTIEALAEAEEDKVLKAWEGLGYYSRARNLQAAVREVHEHYGGRVPDNPKEISSLK 125

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTS 182
           G+G YTA AI++IA+      VD N+ R++SR   I +    P   K  +   R++ S  
Sbjct: 126 GVGPYTAGAILSIAYGIPEPAVDGNVMRVLSRILSIWEDIAKPATRKIFEEAVRELISHE 185

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
            P  F QA+M+LGALICT   P C LCP++++C  F EGK   L I T  KK+     A 
Sbjct: 186 NPSFFNQALMELGALICTPTSPSCLLCPVREHCHAFYEGKQSELPIKTKNKKQKDVQIAA 245

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANW-------IL 295
            +    + R L+RKR    LL  + E P +  S       D  +      +        +
Sbjct: 246 VVLRDREGRYLIRKRPEKGLLANLWEFPNTEISLAFLHEKDQLAELIKEQYGAIIETAEM 305

Query: 296 CNTITHTFTHFTLTLFVWKTIVPQIVII-PDSTWHDAQNLANAALPTVMKKALSA 349
              I H FTH T  + V+K  +  +     D      + L   A P   +K L  
Sbjct: 306 TGQIDHVFTHLTWHIHVYKGTLLSLEEERSDLKLVTEEELKEFAFPVSHQKMLKH 360


>gi|262164096|ref|ZP_06031835.1| A/G-specific adenine glycosylase [Vibrio mimicus VM223]
 gi|262027624|gb|EEY46290.1| A/G-specific adenine glycosylase [Vibrio mimicus VM223]
          Length = 353

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 105/351 (29%), Positives = 174/351 (49%), Gaps = 17/351 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
               IL WYD   R  LPW+ +         + Y+VW+SEIMLQQT V TV PYF++F++
Sbjct: 4   FAQAILTWYDAYGRKNLPWQQN--------KNAYRVWLSEIMLQQTQVATVLPYFERFLE 55

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A  +E+L  W GLGYY RARNL K A  +V +Y G FP  +E++  LPG+
Sbjct: 56  RFPTVQALAAAPQDEVLHFWTGLGYYARARNLHKAAQTVVSEYGGEFPTDLELMNALPGV 115

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++  +     ++D N++R ++R F +            + +YA   T +   
Sbjct: 116 GRSTAAAVLSSVYKKPHAILDGNVKRTLARCFAVEGWPGQKSVENQLWHYAEMHTPSVDV 175

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA+ICT +KP C LCP++  CL   +G          K  +P++    F+
Sbjct: 176 DKYNQAMMDMGAMICTRSKPKCSLCPVESFCLAKQQGNPQDYPGKKPKTDKPVKET-WFV 234

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSA-PFTANWILCNTITHTF 303
            + +D+ + L +R  T +  G+   P S  ++ +              +        HTF
Sbjct: 235 MLYHDDAVWLEQRPQTGIWGGLYCFPQSEIANIQTTIDQRAIGDSTITSQKTLIAFRHTF 294

Query: 304 THFTLTLFVWKTIVPQIV----IIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ L +      + +            W++        L   +K+ L + 
Sbjct: 295 SHYHLDITPILLELSRKPDIVMEGSKGLWYNLSQPDEIGLAAPVKQLLHSL 345


>gi|296331948|ref|ZP_06874413.1| A/G-specific adenine glycosylase or DNA-(apurinic or apyrimidinic
           site) lyase [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305673560|ref|YP_003865232.1| A/G-specific adenine glycosylase or DNA-(apurinic or apyrimidinic
           site) lyase [Bacillus subtilis subsp. spizizenii str.
           W23]
 gi|296151026|gb|EFG91910.1| A/G-specific adenine glycosylase or DNA-(apurinic or apyrimidinic
           site) lyase [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305411804|gb|ADM36923.1| A/G-specific adenine glycosylase or DNA-(apurinic or apyrimidinic
           site) lyase [Bacillus subtilis subsp. spizizenii str.
           W23]
          Length = 369

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 115/356 (32%), Positives = 175/356 (49%), Gaps = 18/356 (5%)

Query: 1   MPQPE-HIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           + Q +    +  ++ W++   RVLPWR            PYKVW+SE+MLQQT V+TV P
Sbjct: 8   LKQKDIQRFRDDLISWFEREQRVLPWRED--------QDPYKVWVSEVMLQQTRVETVIP 59

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF +F++++PT+  L+ A +E++L AW GLGYY+R RNL+     + ++Y G  P   + 
Sbjct: 60  YFLRFVEQFPTVEALADADEEKVLKAWEGLGYYSRVRNLQSAVKEVKQEYGGIVPPDEKD 119

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARK 177
              L G+G YT  A+++IA+N     VD N+ R++SR   I      P      ++  R 
Sbjct: 120 FGSLKGVGPYTKGAVLSIAYNKPIPAVDGNVMRVMSRILSIWDDIAKPKTRTIFEDAVRA 179

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
             S  +P +F Q +M+LGALICT   P C LCP+QK+C  F EG    L + + KKK  +
Sbjct: 180 FISKEKPSEFNQGLMELGALICTPKSPSCLLCPVQKHCSAFEEGTERELPVKSKKKKPGI 239

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANW---- 293
           +T A  +    D R+ + KR +  LL  + E P            +  +A          
Sbjct: 240 KTMAAIVLTDEDGRVFIHKRPSKGLLANLWEFPNLETQKGIKTEREQLTAFLENECGIQA 299

Query: 294 ---ILCNTITHTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKA 346
               L   + H FTH    + V+   V Q+    +      + L   A P   +K 
Sbjct: 300 DISDLQGVVEHVFTHLVWNISVFFGKVKQVSDTSELKKVTKEELEQFAFPVSHQKI 355


>gi|161506339|ref|YP_001573451.1| adenine DNA glycosylase [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|160867686|gb|ABX24309.1| hypothetical protein SARI_04536 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 350

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 113/359 (31%), Positives = 175/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+ +         +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQIN--------KTPYKVWLSEVMLQQTQVTTVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++F+ ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP     + 
Sbjct: 53  ERFLARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGEFPQTFAEIA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPGIG  TA AI+++A      ++D N++R+++R + +           T+   + ++T
Sbjct: 113 ALPGIGRSTAGAILSLALGKHYPILDGNVKRVLARCYAVSGWPGKKEVENTLWTLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT +KP C LCP+Q  C+  +            K+  P RT
Sbjct: 173 PARGVERFNQAMMDLGAMVCTRSKPKCTLCPLQNGCIAATNESWSRYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G  F+ + ++  ILL +R  + L  G+   P  A        +         N    N  
Sbjct: 233 G-YFLLLQHNQEILLAQRPPSGLWGGLYCFPQFASEDELREWLAQRHVNAD-NLTQLNAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V  +    D   + W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSLDACMDEGSALWYNLAQPPSVGLAVPVERLLQQLRTGAP 349


>gi|333000467|gb|EGK20048.1| A/G-specific adenine glycosylase [Shigella flexneri K-272]
 gi|333015306|gb|EGK34648.1| A/G-specific adenine glycosylase [Shigella flexneri K-227]
          Length = 350

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 172/359 (47%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM  +PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMAHFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTHSKPKCSLCPLQNGCIAATNNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRHWLAQRQ-IAADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|307253413|ref|ZP_07535284.1| A/G-specific adenine glycosylase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306859092|gb|EFM91134.1| A/G-specific adenine glycosylase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
          Length = 381

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 107/374 (28%), Positives = 166/374 (44%), Gaps = 35/374 (9%)

Query: 4   PEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFK 62
           P       +L W+    R  LPW+ +         + Y VW+SE+MLQQT V TV PYF+
Sbjct: 14  PAQPFAKAVLAWFAQYGRKHLPWQQN--------KTLYGVWLSEVMLQQTQVATVIPYFE 65

Query: 63  KFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKK 122
           +F++++PT+  L+ A  +E+L  W GLGYY RARNL K A  I  ++   FP   + +  
Sbjct: 66  RFIERFPTVTDLADAHIDEVLHLWTGLGYYARARNLHKAAQQIRDQFNDEFPTDFDDVLA 125

Query: 123 LPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITS 180
           L G+G  TA AI++   N    ++D N++R++SR F +           T+      +T 
Sbjct: 126 LSGVGRSTAGAILSSVLNAPHPILDGNVKRVLSRAFAVEGWSGEKSVENTLWQLTASVTP 185

Query: 181 TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG 240
             +  DF QAMMDLGA++CT +KP C LCP+   C                KK  P R  
Sbjct: 186 NRQVADFNQAMMDLGAMVCTRSKPKCSLCPLVDLCEANRLEAWDKFPAKKPKKVLPERQA 245

Query: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTIT 300
             F+ I + ++ILL +R    L  G+   P    +     ++   +   +          
Sbjct: 246 -YFLIIKSGSKILLEQREAKGLWGGLYVFPQFENTEELKRSLSERNLQVS---QQLIAFR 301

Query: 301 HTFTHFTLTLFVWKTIVPQIVIIPDS--------------------TWHDAQNLANAALP 340
           HTF+HF L +      +       +                      W+D Q  +   L 
Sbjct: 302 HTFSHFHLDITPILVDLDLQKNPQNQPLVVQENCGNYRLSVSSTANYWYDLQLPSEIGLA 361

Query: 341 TVMKKALSAGGIKV 354
           T +K+ L    + +
Sbjct: 362 TPVKRILDELSLTL 375


>gi|149912476|ref|ZP_01901010.1| A/G-specific adenine glycosylase [Roseobacter sp. AzwK-3b]
 gi|149812882|gb|EDM72708.1| A/G-specific adenine glycosylase [Roseobacter sp. AzwK-3b]
          Length = 352

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 140/343 (40%), Positives = 184/343 (53%), Gaps = 6/343 (1%)

Query: 10  SKILDWYDTNHRVLPWRTSPKTE-KSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKW 68
           + +L WYD + R LPWR +P      + P PY+VW+SE+MLQQTTV  V  YF++F   W
Sbjct: 8   ADLLAWYDAHARDLPWRVAPAARLAGTRPDPYRVWLSEVMLQQTTVAAVRAYFERFTALW 67

Query: 69  PTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGD 128
           PT+  L++A D +++  WAGLGYY RARNL KCA ++ + + G FP   E L  LPGIG 
Sbjct: 68  PTVEALAAAPDAQVMGEWAGLGYYARARNLLKCARVVAEDHGGRFPETREALMALPGIGP 127

Query: 129 YTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFV 188
           YT +AI AIAF+   VVVD N+ER+++R  DI  P P     +   A  +T   RPG   
Sbjct: 128 YTGAAIAAIAFDAPEVVVDGNVERVMARVHDIRTPLPAAKPELVRAAAALTPKRRPGCHA 187

Query: 189 QAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITN 248
           QA+MDLGA +CT   P C +CP    C     G    L   T KK +P+R G  ++A   
Sbjct: 188 QAVMDLGATVCTPRAPACGICPWWGACAARKAGVQAELPHKTPKKPKPLRFGIAYVARRA 247

Query: 249 DNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN-TITHTFTHFT 307
           D   LL  R +  LL GM   PGS W+ +        + P  A+W        HTFTHF 
Sbjct: 248 DGAWLLETRPDKGLLGGMLGWPGSDWTES----APIPAPPIEADWTELGEEARHTFTHFH 303

Query: 308 LTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           L L +    VPQ        +  A     + LPTVM+K     
Sbjct: 304 LRLAIKVAHVPQNAAPLRGAFTPATAFRPSDLPTVMRKVFDLA 346


>gi|325922809|ref|ZP_08184537.1| A/G-specific DNA-adenine glycosylase [Xanthomonas gardneri ATCC
           19865]
 gi|325546696|gb|EGD17822.1| A/G-specific DNA-adenine glycosylase [Xanthomonas gardneri ATCC
           19865]
          Length = 357

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 112/356 (31%), Positives = 168/356 (47%), Gaps = 18/356 (5%)

Query: 5   EHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKK 63
                 ++L W+D + R  LPW+           +PY+VW+SEIMLQQT V  V PYF K
Sbjct: 10  ADAFVHRLLHWFDGHGRHDLPWQHP--------RAPYRVWLSEIMLQQTQVAVVIPYFHK 61

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           F+  +PT+  L++A ++ +++ WAGLGYY RARNL   A   V  ++G+ P   + L  L
Sbjct: 62  FVASFPTLADLAAADNDTVMAHWAGLGYYARARNLHAAAKQCVALHDGDLPRDFDALLAL 121

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA-----PLYHKTIKNYARKI 178
           PGIG  TA AI++ A++    ++D N++R+++R+  I               +       
Sbjct: 122 PGIGRSTAGAILSQAWSDRFAIMDGNVKRVMTRFHGIAGYPGLPVIEKQLWQLATAHVAH 181

Query: 179 TSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
               R  D+ QA MD GA +CT  KP C LCP+Q +C+   +G    L      K+ P R
Sbjct: 182 VPAGRLADYTQAQMDFGATLCTRAKPACVLCPLQDDCVARRDGLVEALPTPKPGKQLPER 241

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
                +    DN+ILL++R  T +   +  LP +   S        H             
Sbjct: 242 EATALLLENADNQILLQRRPPTGIWASLWTLPQAETDSGMRAWFANHIQGDYERADEMPL 301

Query: 299 ITHTFTHFTLTLFVWKTIV----PQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           I HTF+H+ L L   +         +    D  W    +LA   LP  ++K L A 
Sbjct: 302 IVHTFSHYRLHLQPLRIRKVALRTAVRDNDDLRWVARADLAALGLPAPIRKLLDAL 357


>gi|227357870|ref|ZP_03842218.1| A/G-specific adenine glycosylase [Proteus mirabilis ATCC 29906]
 gi|227161980|gb|EEI46998.1| A/G-specific adenine glycosylase [Proteus mirabilis ATCC 29906]
          Length = 346

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 107/355 (30%), Positives = 166/355 (46%), Gaps = 16/355 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                    +LDWY    R  LPW+           +PY VW+SE+MLQQT V TV PYF
Sbjct: 2   MEAQQFSQVVLDWYHKYGRKTLPWQQ--------EKTPYHVWLSEVMLQQTQVATVIPYF 53

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++F+ ++P +  L+ A  +E+L  W GLGYY RARNL K A  IV K++G FP   E + 
Sbjct: 54  ERFIARFPNVSALAKAPLDEVLHLWTGLGYYARARNLHKAAQHIVDKHQGQFPDTFEDVC 113

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            +   + ++T
Sbjct: 114 ALPGVGRSTAGAILSLSLKKPYPILDGNVKRVLARCYAVEGWSGKKEVENKLWEISEQVT 173

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
            T     F QAMMDLGA++CT  KP C LCP+   C+ ++            KK  P   
Sbjct: 174 PTKGVEYFNQAMMDLGAMVCTRTKPKCELCPLNTGCIAYAHHSWADYPGKKPKKAIPE-K 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
              F+ +  DN + L KR    +  G+   P        +  +  H         L  + 
Sbjct: 233 TTYFLILQYDNLVWLDKRPPAGIWGGLFAFPQFETKMLLEQWLAEHGLENNKTEQLI-SF 291

Query: 300 THTFTHFTLTLFVWKTIVP---QIVIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
            HTF+HF L +      +     ++      W++ Q  A+  L   ++  L    
Sbjct: 292 RHTFSHFHLDIVPICVKLSTFTSLMEAQQGLWYNLQTPASVGLAAPVENLLRQLA 346


>gi|152980113|ref|YP_001354812.1| A/G-specific adenine glycosylase [Janthinobacterium sp. Marseille]
 gi|151280190|gb|ABR88600.1| A/G-specific adenine glycosylase [Janthinobacterium sp. Marseille]
          Length = 384

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 114/351 (32%), Positives = 184/351 (52%), Gaps = 20/351 (5%)

Query: 8   IQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
             + ++ W   + R  LPW+ +           Y+VW+SEIMLQQT V  V PY+ +F++
Sbjct: 31  FSADVISWQKKHGRHALPWQNT--------RDAYRVWLSEIMLQQTQVAAVIPYYLRFLE 82

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
            +PT+  L++A  EE+++ W+GLGYY+RARNL KCA  IV +Y G FP   E+L++LPGI
Sbjct: 83  TFPTVASLAAAPSEEVMAHWSGLGYYSRARNLHKCAQTIVAEYGGVFPSDPELLEQLPGI 142

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTSRP 184
           G  TA+AI A ++   A ++D N++R+ +R F + +          +   A  +   +  
Sbjct: 143 GRSTAAAISAFSYGTRAAILDGNVKRVFARVFGVERYPGEKAVENELWLRAVALLPENGV 202

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + Q +MDLGA +CT N P C  CP+   C+ ++ G+++ L I   KK  P +   + +
Sbjct: 203 EAYTQGLMDLGATLCTRNSPSCQRCPLAHRCVAYASGRTNELPIRKPKKAVPEKQTTMLL 262

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTK---DGNIDTHSAPF--TANWILCNTI 299
            +  D  +LL +R +  +  G+  LP  A  S     D  +    A F   A+    +  
Sbjct: 263 IVDKDE-VLLEQRPDKGIWGGLLSLPEIAAESADAQFDAVMAQAVARFGVAASQERLSMF 321

Query: 300 THTFTHFTLTLFVWKTIVPQIVI---IPDSTWHDAQNLANAALPTVMKKAL 347
           TH FTHF L +  +   + + +         W+    +A+A LP  +KK L
Sbjct: 322 THVFTHFKLHITPYHIALARRIERAGQDQYVWYPLAKMADAPLPAPVKKLL 372


>gi|77456548|ref|YP_346053.1| A/G-specific DNA-adenine glycosylase [Pseudomonas fluorescens
           Pf0-1]
 gi|77380551|gb|ABA72064.1| A/G-specific adenine glycosylase [Pseudomonas fluorescens Pf0-1]
          Length = 355

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 122/355 (34%), Positives = 177/355 (49%), Gaps = 15/355 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  + +L+W+D + R  LPW+ +         +PY+VW+SEIMLQQT V TV  YF
Sbjct: 1   MRAEQFSTAVLEWFDRHGRHDLPWQQN--------INPYRVWVSEIMLQQTQVSTVLNYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FM   PT+  L++A ++E+L  W GLGYYTRARNL+K A I+V +Y G FP  VE L 
Sbjct: 53  DRFMAALPTVEALAAAPEDEVLHLWTGLGYYTRARNLQKTAKIVVSQYGGEFPRDVEKLT 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
           +LPGIG  TA AI +I+    A ++D N++R+++R+         P   K +   A + T
Sbjct: 113 ELPGIGLSTAGAIGSISMGLRAPILDGNVKRVLARFTAQEGYPGEPKVAKQLWANAERFT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              R   + QAMMDLGA +CT +KP C LCP++K C     G      I   +K  P + 
Sbjct: 173 PQDRVNAYTQAMMDLGATLCTRSKPSCLLCPLEKGCEAHMLGLETRYPIPKPRKAIPQKR 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +    D  ILL +R ++ L  G+  LP              HS           ++
Sbjct: 233 TLMPLLANEDGAILLYRRPSSGLWGGLWSLPELDDLDDLQHLAAQHSLELGEQ-QALPSL 291

Query: 300 THTFTHFTLTLFVWKTIVPQI---VIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
            HTF+HF L++  W   V +    V   D  W++        L   +K  L    
Sbjct: 292 VHTFSHFQLSIEPWLVQVQEAGGHVAEADWLWYNLATPPRLGLAAPVKTLLERAA 346


>gi|85703948|ref|ZP_01035051.1| A/G-specific adenine glycosylase [Roseovarius sp. 217]
 gi|85671268|gb|EAQ26126.1| A/G-specific adenine glycosylase [Roseovarius sp. 217]
          Length = 353

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 144/349 (41%), Positives = 199/349 (57%), Gaps = 9/349 (2%)

Query: 9   QSKILDWYDTNHRVLPWRTSPKTEKSSL-PSPYKVWISEIMLQQTTVKTVEPYFKKFMQK 67
              +L WYDT+ R LPWR SP    + + P PY++W+SE+MLQQTTV  V  YF +F+  
Sbjct: 7   AQTLLAWYDTHARDLPWRVSPTARSAGICPDPYRIWLSEVMLQQTTVAAVREYFIRFITL 66

Query: 68  WPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIG 127
           WPT+  L++A+D +++  WAGLGYY RARNL KCA  +V  ++G+FP  VE L+ LPGIG
Sbjct: 67  WPTVADLAAAQDGQVMGEWAGLGYYARARNLLKCARAVVTDHQGHFPATVEELRALPGIG 126

Query: 128 DYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDF 187
            YTA+AI AIA++  AVVVD N+ER+++R +DI  P P   + +   A ++T  +RPGD+
Sbjct: 127 PYTAAAIAAIAYDRPAVVVDGNVERVMARLYDIHTPLPTAKRELTEAAARLTPQTRPGDY 186

Query: 188 VQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAIT 247
            QA+MDLGA +CT   P C +CP    C     G +  L     K+ +P+R G  ++A  
Sbjct: 187 AQAVMDLGATVCTPKSPACGICPWVTACAARKAGTAPDLPKKLPKEAKPVRLGYAYVAQR 246

Query: 248 NDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN-TITHTFTHF 306
            D   LL +R    LL GM   P S W+          + P  A+WI  +    HTFTHF
Sbjct: 247 QDGAWLLERRPEKGLLGGMLGWPSSDWNDA-----PPPAPPIEADWIQVDAEARHTFTHF 301

Query: 307 TLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKA--LSAGGIK 353
            L L V    +P         +  A       LPTVM+K   L+   +K
Sbjct: 302 HLRLTVLVARLPHDAQPNRGDFLTATAFRPTELPTVMRKVFDLAHAALK 350


>gi|261822646|ref|YP_003260752.1| adenine DNA glycosylase [Pectobacterium wasabiae WPP163]
 gi|261606659|gb|ACX89145.1| A/G-specific adenine glycosylase [Pectobacterium wasabiae WPP163]
          Length = 368

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 102/362 (28%), Positives = 169/362 (46%), Gaps = 21/362 (5%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                   ++LDWY    R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 2   MQAQQFAHQVLDWYQRYGRKTLPWQ--------LEKTPYKVWLSEVMLQQTQVTTVIPYF 53

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++P +  L++A  +E+L  W GLGYY RARNL K A  IV ++ G+FP   + + 
Sbjct: 54  QRFMARFPNVNALAAAPLDEVLHLWTGLGYYARARNLHKAAQTIVSRHGGDFPTTFDEVA 113

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA A+++++      ++D N++R+++R + +            +   +  +T
Sbjct: 114 ALPGVGRSTAGAVLSLSLGQHFPILDGNVKRVLARCYAVDGWPGKKEVEKKLWARSEDVT 173

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT ++P C LCP+   C+ ++            K+  P +T
Sbjct: 174 PAEGVSQFNQAMMDLGAMVCTRSRPKCELCPLNTGCIAYANHSWAQYPGKKPKQTLPEKT 233

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D+++ L++R    L  G+   P  +     +  +            L    
Sbjct: 234 GWFLLM-QQDSQVWLQQRPTVGLWGGLFCFPQFSERQELELWLQQRGLNPDGLQQLV-AF 291

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD--------STWHDAQNLANAALPTVMKKALSAGG 351
            HTF+HF L +      V Q     +          W++     +  L   +++ L    
Sbjct: 292 RHTFSHFHLDIVPLWLNVSQDDRSQNRSCMDDGAGLWYNLAQPPSVGLAAPVERLLRELA 351

Query: 352 IK 353
             
Sbjct: 352 HP 353


>gi|237807732|ref|YP_002892172.1| A/G-specific adenine glycosylase [Tolumonas auensis DSM 9187]
 gi|237499993|gb|ACQ92586.1| A/G-specific adenine glycosylase [Tolumonas auensis DSM 9187]
          Length = 363

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 100/355 (28%), Positives = 171/355 (48%), Gaps = 16/355 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           +   +     ++L WYD   R  LPW+ +         +PY+VW+SEIMLQQT V TV P
Sbjct: 12  LSLNQATFSQRLLTWYDIAGRKTLPWQQN--------KTPYRVWVSEIMLQQTQVSTVIP 63

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           Y+++FM+++P +  L+ A  +E+L  W GLGYY RARNL K A +I  K+ G+FP   + 
Sbjct: 64  YYERFMERFPDVIALADAPQDEVLHLWTGLGYYARARNLHKAAQVIRDKHNGSFPETFDE 123

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARK 177
           +  LPGIG  TA AI++++      ++D N++R+++R+  +            + ++A K
Sbjct: 124 VADLPGIGRSTAGAILSLSLKQHHAILDGNVKRVLTRWLALEGWPGQKQIENELWDWAIK 183

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T       + QA+MDLGA +C+  KP C +CP+  +C  + +G           KK+  
Sbjct: 184 LTPAEGVEQYNQAIMDLGASLCSRTKPQCRICPMNDDCGGYLQGTPTAYPTPKPNKKKIP 243

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
                 + +     + L++R    +  G+   P  +  +     +         N     
Sbjct: 244 VRQTCLLIMQYRQSVWLQQRPAQGIWGGLFSFPEFSSVADAQHWLQRI-GYADTNIRSLP 302

Query: 298 TITHTFTHFTLTLFVWKTIVPQI----VIIPDSTWHDAQNLANAALPTVMKKALS 348
              HTF+HF L +      + Q     +   +  W++    ++  L  V  K L+
Sbjct: 303 EFRHTFSHFHLDITPLLVNLSQPAHSIMEQSNELWYNLNQPSSVGLSAVTLKLLT 357


>gi|46143247|ref|ZP_00135609.2| COG1194: A/G-specific DNA glycosylase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126209203|ref|YP_001054428.1| A/G-specific adenine glycosylase [Actinobacillus pleuropneumoniae
           L20]
 gi|126097995|gb|ABN74823.1| A/G-specific adenine glycosylase [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
          Length = 381

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 108/374 (28%), Positives = 167/374 (44%), Gaps = 35/374 (9%)

Query: 4   PEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFK 62
           P       +L W+    R  LPW+ +         + Y VW+SE+MLQQT V TV PYF+
Sbjct: 14  PAQPFAKAVLAWFAQYGRKHLPWQQN--------KTLYGVWLSEVMLQQTQVATVIPYFE 65

Query: 63  KFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKK 122
           +F++++PT+  L+ A  +E+L  W GLGYY RARNL K A  I  ++ G FP   + +  
Sbjct: 66  RFIERFPTVTDLADAHIDEVLHLWTGLGYYARARNLHKAAQQIRDQFNGEFPTDFDDVLA 125

Query: 123 LPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITS 180
           L G+G  TA AI++   N    ++D N++R++SR F +            +      +T 
Sbjct: 126 LSGVGRSTAGAILSSVLNAPHPILDGNVKRVLSRAFAVEGWSGEKSVENKLWQLTASVTP 185

Query: 181 TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG 240
            S+  DF QAMMDLGA++CT +KP C LCP+   C                KK  P R  
Sbjct: 186 NSQVADFNQAMMDLGAMVCTRSKPKCSLCPLANLCEANRLEAWDKFPAKKPKKVLPERQA 245

Query: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTIT 300
             F+ I + ++ILL +R    L  G+   P    +     ++   +   +          
Sbjct: 246 -YFLIIKSGSKILLEQREAKGLWGGLYVFPQFENTEELKRSLSERNLQVS---QQLIAFR 301

Query: 301 HTFTHFTLTLFVWKTIVPQIVIIPDS--------------------TWHDAQNLANAALP 340
           HTF+HF L +      +       +                      W+D Q  +   L 
Sbjct: 302 HTFSHFHLDITPILVDLDLQKNPQNQPLVVQENCGNYRLSVSSTANYWYDLQLPSEIGLA 361

Query: 341 TVMKKALSAGGIKV 354
           T +K+ L    + +
Sbjct: 362 TPVKRILDELSLTL 375


>gi|26987028|ref|NP_742453.1| A/G-specific adenine glycosylase [Pseudomonas putida KT2440]
 gi|24981647|gb|AAN65917.1|AE016219_10 A/G specific adenine glycosylase [Pseudomonas putida KT2440]
          Length = 355

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 123/358 (34%), Positives = 181/358 (50%), Gaps = 15/358 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  S +LDWYD + R  LPW+           +PY+VW+SEIMLQQT V TV  YF
Sbjct: 1   MSPEQFSSAVLDWYDEHGRHDLPWQQ--------GITPYRVWVSEIMLQQTQVSTVLNYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FMQ  PT+  L+ A ++E+L  W GLGYYTRARNL+K A ++V+++ G FP  VE L 
Sbjct: 53  DRFMQALPTVQALAEAPEDEVLHLWTGLGYYTRARNLQKAAKVVVEQHGGEFPRSVEQLT 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
           +LPGIG  TA AI +I+    A ++D N++R+++RY         P     +   A + T
Sbjct: 113 ELPGIGRSTAGAIASISMGIRAPILDGNVKRVLARYTAQAGYPGEPKVANQLWATAERFT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              R   + QAMMD+GA +CT +KP C +CP+Q+ C     G+         +K  P R 
Sbjct: 173 PQQRANHYTQAMMDMGATLCTRSKPSCLICPLQRGCEAHLHGEETRYPEPKPRKALPQRR 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +   ++  ILL +R ++ L  G+  LP     +  D     H         +   +
Sbjct: 233 TLMPLLANHEGAILLYRRPSSGLWGGLWSLPELDDIAQLDDLAYQHGLRLAGRHAMDG-L 291

Query: 300 THTFTHFTLTLFVWKTIVP---QIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
           THTF+HF L +  W   V    + V   D  W++        L   +KK L     ++
Sbjct: 292 THTFSHFQLAIEPWLVHVDPVGEHVAEADWLWYNLATPPRLGLAAPVKKLLERAADEL 349


>gi|167551997|ref|ZP_02345750.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205323304|gb|EDZ11143.1| A/G-specific adenine glycosylase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
          Length = 350

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 112/359 (31%), Positives = 173/359 (48%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+ +         +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQIN--------KTPYKVWLSEVMLQQTQVTTVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM  +PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP     + 
Sbjct: 53  ERFMAHFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGEFPQTFAEIA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPG+G  TA AI+++A      ++D N++R+++R + +           T+   + ++T
Sbjct: 113 ALPGVGRSTAGAILSLALGKHYPILDGNVKRVLARCYAVSGWPGKKEVENTLWTLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT +KP C LCP+Q  C+  +            K+  P RT
Sbjct: 173 PARGVERFNQAMMDLGAMVCTRSKPKCTLCPLQNGCIAAAHESWSRYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G  F+ + ++  I L +R  + L  G+   P  A        +         N    N  
Sbjct: 233 G-YFLLLQHNQEIFLAQRPPSGLWGGLYCFPQFASEDELREWLAQRHVNAD-NLTQLNAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V  +    D   + W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSLDACMDEGSALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|165977176|ref|YP_001652769.1| A/G-specific adenine glycosylase [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|307251036|ref|ZP_07532960.1| A/G-specific adenine glycosylase [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|165877277|gb|ABY70325.1| A/G-specific adenine glycosylase [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|306856866|gb|EFM88998.1| A/G-specific adenine glycosylase [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
          Length = 381

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 108/374 (28%), Positives = 167/374 (44%), Gaps = 35/374 (9%)

Query: 4   PEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFK 62
           P       +L W+    R  LPW+ +         + Y VW+SE+MLQQT V TV PYF+
Sbjct: 14  PAQPFAKAVLAWFAQYGRKHLPWQQN--------KTLYGVWLSEVMLQQTQVATVIPYFE 65

Query: 63  KFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKK 122
           +F++++PT+  L+ A  +E+L  W GLGYY RARNL K A  I  ++ G FP   + +  
Sbjct: 66  RFIERFPTVTDLADAHIDEVLHLWTGLGYYARARNLHKAAQQIRDQFNGEFPTDFDDVLA 125

Query: 123 LPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITS 180
           L G+G  TA AI++   N    ++D N++R++SR F +            +      +T 
Sbjct: 126 LSGVGRSTAGAILSSVLNAPHPILDGNVKRVLSRAFAVEGWSGEKSVENKLWQLTASVTP 185

Query: 181 TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG 240
            S+  DF QAMMDLGA++CT +KP C LCP+   C                KK  P R  
Sbjct: 186 NSQVADFNQAMMDLGAMVCTRSKPKCSLCPLANLCEANRLEAWDKFPAKKPKKVLPERQA 245

Query: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTIT 300
             F+ I + ++ILL +R    L  G+   P    +     ++   +   +          
Sbjct: 246 -YFLIIKSGSKILLEQREAKGLWGGLYVFPQFENTEELKRSLSERNLQVS---QQLIAFR 301

Query: 301 HTFTHFTLTLFVWKTIVPQIVIIPDS--------------------TWHDAQNLANAALP 340
           HTF+HF L +      +       +                      W+D Q  +   L 
Sbjct: 302 HTFSHFHLDITPILVDLDLQKNPQNQPLVVQENCGNYRLSVSSTANYWYDLQLPSEIGLA 361

Query: 341 TVMKKALSAGGIKV 354
           T +K+ L    + +
Sbjct: 362 TPVKRILDELSLTL 375


>gi|313496650|gb|ADR58016.1| MutY [Pseudomonas putida BIRD-1]
          Length = 355

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 123/358 (34%), Positives = 180/358 (50%), Gaps = 15/358 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  S +LDWYD + R  LPW+           +PY+VW+SEIMLQQT V TV  YF
Sbjct: 1   MSPEQFSSAVLDWYDEHGRHDLPWQQ--------GITPYRVWVSEIMLQQTQVSTVLNYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FMQ  PT+  L+ A ++E+L  W GLGYYTRARNL+K A ++V+++ G FP  VE L 
Sbjct: 53  DRFMQALPTVQALAEAPEDEVLHLWTGLGYYTRARNLQKAAKVVVEQHGGEFPRSVEQLT 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
           +LPGIG  TA AI +I+    A ++D N++R+++RY         P     +   A + T
Sbjct: 113 ELPGIGRSTAGAIASISMGIRAPILDGNVKRVLARYTAQAGYPGEPKVANQLWATAERFT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              R   + QAMMD+GA +CT +KP C +CP+Q  C     G+         +K  P R 
Sbjct: 173 PQQRANHYTQAMMDMGATLCTRSKPSCLICPLQHGCEAHLHGEETRYPEPKPRKALPQRR 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +   ++  ILL +R ++ L  G+  LP     +  D     H         +   +
Sbjct: 233 TLMPLLANHEGAILLYRRPSSGLWGGLWSLPELDDIAQLDDLAYQHGLRLAGRHAMDG-L 291

Query: 300 THTFTHFTLTLFVWKTIVP---QIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
           THTF+HF L +  W   V    + V   D  W++        L   +KK L     ++
Sbjct: 292 THTFSHFQLAIEPWLVHVDPVGEHVAEADWLWYNLATPPRLGLAAPVKKLLERAADEL 349


>gi|307296244|ref|ZP_07576071.1| HhH-GPD family protein [Sphingobium chlorophenolicum L-1]
 gi|306878046|gb|EFN09269.1| HhH-GPD family protein [Sphingobium chlorophenolicum L-1]
          Length = 356

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 139/345 (40%), Positives = 185/345 (53%), Gaps = 10/345 (2%)

Query: 8   IQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQK 67
           I S +L  YD + R LPWR  P    +    PY+VW+SE+MLQQTTV  V PYF KF Q+
Sbjct: 10  IASDLLAHYDVHARRLPWRAPPGANAA---DPYRVWLSEVMLQQTTVAAVGPYFAKFTQR 66

Query: 68  WPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIG 127
           WP +  L++ +D E+++AWAGLGYY RARNL  CA  +   + G FP   + L+ LPG+G
Sbjct: 67  WPDVTALAAEEDAEVMAAWAGLGYYARARNLLACARAVAGDHGGVFPDTEDGLRALPGVG 126

Query: 128 DYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDF 187
            YTA+A+ AIAF   AVVVD N+ER+++R F I  P P     I+     IT  +R GDF
Sbjct: 127 AYTAAAVAAIAFGRRAVVVDANVERVVARLFAIATPLPAARPEIRAATDAITPDARAGDF 186

Query: 188 VQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAIT 247
            QAMMDLGA ICT   P C +CP++++C            +   KK RP R G  +    
Sbjct: 187 AQAMMDLGATICTPRNPACGICPLRQDCAAVLTADPAAFPVKAAKKARPHRLGHGWWIER 246

Query: 248 NDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILC-NTITHTFTHF 306
            D  + L +R    +L GM  LP S W+   D      + P  A W      + H FTHF
Sbjct: 247 PDGHVWLVRRPGKGMLGGMRALPTSEWNGAPDA-----TPPLPAPWRRLAEPVRHVFTHF 301

Query: 307 TLTLFVWKTIV-PQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +L L V    V P +    +  W     +  A LPT+  +A    
Sbjct: 302 SLALTVHHAHVGPDVTPPGEGEWWPVAEIGKAGLPTLFARAAEMA 346


>gi|332994862|gb|AEF04917.1| A/G-specific adenine glycosylase [Alteromonas sp. SN2]
          Length = 353

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 110/353 (31%), Positives = 178/353 (50%), Gaps = 17/353 (4%)

Query: 5   EHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKK 63
            +    ++L WYD + R  LPW+           +PYKVW+SEIMLQQT V TV PYF++
Sbjct: 7   PNTFAERVLAWYDIHGRKHLPWQQD--------ITPYKVWVSEIMLQQTQVTTVIPYFER 58

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           FMQ +P++  L++A  +++L  W GLGYY RARNL K A  IV+ + G FP  ++ +  L
Sbjct: 59  FMQSFPSVVELANAAQDDVLHHWTGLGYYARARNLHKAAKQIVEDHGGTFPDNIDDVIAL 118

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITST 181
           PGIG  TA A+++I+ N    ++D N++R+++RY+ I            +   A K T  
Sbjct: 119 PGIGRSTAGAVLSISRNQRHPILDGNVKRVLARYYAIGGWPGQKAVENALWEVAEKNTPE 178

Query: 182 SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGA 241
            R  ++ Q MMDLGA++CT +KP C  CP+Q +CL +++G          KK  P R+  
Sbjct: 179 KRSANYTQVMMDLGAMVCTRSKPKCDECPLQHDCLAYAQGAQTEFPGKKPKKAIPERSTL 238

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITH 301
           + + +    ++ L +R ++ L  G+     +    + +  +        +++       H
Sbjct: 239 LIVPL-FQQQVYLEQRPSSGLWGGLYGFIEAQDIESAEAELA-KRGIEASSFETQTAFRH 296

Query: 302 TFTHFTLTLFVWKTIVP----QIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           TF+HF L +     +V     + V    + W          L    KK +   
Sbjct: 297 TFSHFHLDITPVFAVVNSVPRKQVAEQKAQWFMFNEPIEVGLAAPTKKIIQQL 349


>gi|262191062|ref|ZP_06049269.1| A/G-specific adenine glycosylase [Vibrio cholerae CT 5369-93]
 gi|262033038|gb|EEY51569.1| A/G-specific adenine glycosylase [Vibrio cholerae CT 5369-93]
          Length = 353

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 104/351 (29%), Positives = 170/351 (48%), Gaps = 17/351 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
               IL WYD   R  LPW+ +         + Y+VW+SEIMLQQT V TV PYF++F++
Sbjct: 4   FAQAILTWYDAYGRKNLPWQQN--------KNAYRVWLSEIMLQQTQVATVIPYFERFLE 55

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A  +E+L  W GLGYY RARNL K A ++V +Y G FP  +E +  LPG+
Sbjct: 56  RFPTVHALAAAPQDEVLHFWTGLGYYARARNLHKAAQMVVSEYGGEFPTDLEQMNALPGV 115

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++  +     ++D N++R ++R F +            + +YA   T     
Sbjct: 116 GRSTAAAVLSSVYKKPHAILDGNVKRTLARCFAVEGWPGQKSVENQLWHYAEMHTPKVDV 175

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA+ICT +KP C LCP++  CL   +G          K  +       F+
Sbjct: 176 DKYNQAMMDMGAMICTRSKPKCSLCPVESFCLAKQQGNPQEYPGKKPKTDK-PVKATWFV 234

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSA-PFTANWILCNTITHTF 303
            + +DN + L +R  + +  G+   P S  ++ +              +        HTF
Sbjct: 235 MLYHDNAVWLEQRPQSGIWGGLYCFPQSEIANIQTTIDQRAIGDSTITSQKTLIAFRHTF 294

Query: 304 THFTLTLFVWKTIVPQIV----IIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ L +      + +            W++        L   +K+ L + 
Sbjct: 295 SHYHLDITPILLQLSRKPDIVMEGSKGLWYNLSQPDEIGLAAPVKQLLHSL 345


>gi|84687975|ref|ZP_01015839.1| A/G-specific adenine glycosylase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84664007|gb|EAQ10507.1| A/G-specific adenine glycosylase [Rhodobacterales bacterium
           HTCC2654]
          Length = 349

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 144/346 (41%), Positives = 198/346 (57%), Gaps = 9/346 (2%)

Query: 7   IIQSKILDWYDTNHRVLPWRTSPKTEKSSL-PSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
           ++  ++LDWYD + R +PWR  P    + + P PY VW+SE+MLQQTTV  V  YF +FM
Sbjct: 6   VMAGELLDWYDRHARDMPWRVGPADRAAGIAPDPYAVWMSEVMLQQTTVAAVRDYFTRFM 65

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
             WPT+  L++A+D  ++  WAGLGYY RARNL KCA ++ ++ +G FP  ++ LK LPG
Sbjct: 66  ALWPTVHDLANAEDARVMGEWAGLGYYARARNLLKCARVVSRELDGAFPDTLDGLKALPG 125

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPG 185
           IG YTA+AI AIAF+    VVD N+ER+++R F I  P P     +++ A  +T  +RPG
Sbjct: 126 IGPYTAAAIAAIAFDRSETVVDGNVERVMARLFCIEDPMPGSKPALRDAAATLTPKARPG 185

Query: 186 DFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIA 245
           D+ QA+MDLGA ICT   P C +CP + +C   ++G    L     KK +P+R G  +IA
Sbjct: 186 DYAQAVMDLGATICTPKSPACGICPWRDDCAGRAKGVQAALPAREAKKPKPIRHGIAYIA 245

Query: 246 ITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILC-NTITHTFT 304
              D   L+  R +  LL GM   PG  W     G+      P  A+W      + HTFT
Sbjct: 246 RRTDGAWLVETRPDKGLLGGMLGWPGGDW-----GDEAEDLPPIAADWADLPGDVRHTFT 300

Query: 305 HFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           HF L L V    +PQ        +     LA + LPTVM+KA    
Sbjct: 301 HFHLILRVRTATLPQDAAPERGHFEPR--LAPSDLPTVMRKAFDLA 344


>gi|295702588|ref|YP_003595663.1| A/G-specific adenine glycosylase [Bacillus megaterium DSM 319]
 gi|294800247|gb|ADF37313.1| A/G-specific adenine glycosylase [Bacillus megaterium DSM 319]
          Length = 364

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 114/354 (32%), Positives = 168/354 (47%), Gaps = 18/354 (5%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               Q  ++ W++   R+LPWR            PYKVW+SEIMLQQT V TV PYF  F
Sbjct: 13  IRAFQDDLISWFEQEQRILPWRQD--------QDPYKVWVSEIMLQQTRVDTVIPYFNNF 64

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           + K+PTI  L+ A ++++L AW GLGYY+RARNL+     + ++Y G  P+    + KL 
Sbjct: 65  ISKFPTIKDLAYANEDDVLKAWEGLGYYSRARNLQTAVREVHEQYGGEVPNTPAEISKLK 124

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTS 182
           G+G YT  AI++IA+      VD N+ R++SR   +      P   K  ++   +I S  
Sbjct: 125 GVGPYTTGAILSIAYGVPQPAVDGNVMRVLSRILSVWDDIAKPKTRKLFEDIVHEIISKD 184

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
            P  F Q MM+LGA++CT   P C LCP++++C  F EG  + L + + KK       A 
Sbjct: 185 NPSYFNQGMMELGAIVCTPTSPSCLLCPVREHCRAFEEGVQNELPVKSKKKAPRALQLAA 244

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSA-------WSSTKDGNIDTHSAPFTANWIL 295
            +    D   L+ KR +  LL  + E P                  I             
Sbjct: 245 AVIREEDGNYLIHKRPSKGLLANLWEFPNIEVDLSIAPDHQQLQAFIQNEYGADIKINAP 304

Query: 296 CNTITHTFTHFTLTLFVWKTI-VPQIVIIPDSTWHDAQNLANAALPTVMKKALS 348
             TI H F+H    + V++   V  I  + +      ++L   A P   +K L 
Sbjct: 305 FTTIQHVFSHIVWNVTVYEAELVSDISALKNLKVVSEKDLEQYAFPVSHQKILK 358


>gi|167031329|ref|YP_001666560.1| A/G-specific adenine glycosylase [Pseudomonas putida GB-1]
 gi|166857817|gb|ABY96224.1| A/G-specific adenine glycosylase [Pseudomonas putida GB-1]
          Length = 355

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 121/358 (33%), Positives = 181/358 (50%), Gaps = 15/358 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  S +LDWYD + R  LPW+           +PY+VW+SEIMLQQT V TV  YF
Sbjct: 1   MSPEQFSSAVLDWYDEHGRHDLPWQQ--------GITPYRVWVSEIMLQQTQVSTVLNYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FMQ  PT+  L+ A ++E+L  W GLGYYTRARNL+K A I+V+++ G FP  VE L 
Sbjct: 53  DRFMQALPTVQALAEAPEDEVLHLWTGLGYYTRARNLQKAAKIVVEQHGGEFPRSVEQLT 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
           +LPGIG  TA AI +I+    A ++D N++R+++RY         P     +   A + T
Sbjct: 113 ELPGIGRSTAGAIASISMGIRAPILDGNVKRVLARYSAQAGYPGEPKVANQLWATAERFT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              R   + QAMMD+GA +CT +KP C +CP+Q+ C     G+         +K  P R 
Sbjct: 173 PQLRANHYTQAMMDMGATLCTRSKPSCLICPLQRGCEAHLHGEETRYPEPKPRKALPQRR 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +    +  ILL +R ++ L  G+  +P     +  +     H      +  +   +
Sbjct: 233 TLMPLLTNPEGAILLYRRPSSGLWGGLWSMPELDDIAQLEDLAYQHGLRLAGSHAMDG-L 291

Query: 300 THTFTHFTLTLFVWKTIVP---QIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
           THTF+HF L +  W   V    + +   D  W++        L   +KK L     ++
Sbjct: 292 THTFSHFQLAIEPWLVRVDPVGEHMAEADWLWYNLATPPRLGLAAPVKKLLERAADEL 349


>gi|307262233|ref|ZP_07543883.1| A/G-specific adenine glycosylase [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|306868107|gb|EFM99933.1| A/G-specific adenine glycosylase [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
          Length = 381

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 109/374 (29%), Positives = 167/374 (44%), Gaps = 35/374 (9%)

Query: 4   PEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFK 62
           P       +L W+    R  LPW+ +         + Y VW+SE+MLQQT V TV PYF+
Sbjct: 14  PAQPFAKAVLAWFAQYGRKHLPWQQN--------KTLYGVWLSEVMLQQTQVATVIPYFE 65

Query: 63  KFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKK 122
           +F++++PT+  L+ A  +E+L  W GLGYY RARNL K A  I  ++ G FP   + +  
Sbjct: 66  RFIERFPTVTDLADAHIDEVLHLWTGLGYYARARNLHKAAQQIRDQFNGEFPTDFDDVLA 125

Query: 123 LPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITS 180
           L G+G  TA AI++   N    ++D N++R++SR F +            +      +T 
Sbjct: 126 LSGVGRSTAGAILSSVLNAPHPILDGNVKRVLSRAFAVEGWSGEKSVENKLWQLTASVTP 185

Query: 181 TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG 240
            S+  DF QAMMDLGA++CT +KP C LCP+   C            +   KK  P R  
Sbjct: 186 NSQVADFNQAMMDLGAMVCTRSKPKCSLCPLANLCEANRLEAWDKFPVKKPKKILPERQA 245

Query: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTIT 300
             F+ I   N+ILL +R    L  G+   P    +     ++   +   +          
Sbjct: 246 -YFLIIKAGNKILLEQREAKGLWGGLYVFPQFENTEELKRSLSERNLQVS---QQLIAFR 301

Query: 301 HTFTHFTLTLFVWKTIVPQIVIIPDS--------------------TWHDAQNLANAALP 340
           HTF+HF L +      +       +                      W+D Q  +   L 
Sbjct: 302 HTFSHFHLDITPILVDLDLQKNPQNQPLVVQENCGNYRLSVSSTANYWYDLQLPSEIGLA 361

Query: 341 TVMKKALSAGGIKV 354
           T +K+ L    + +
Sbjct: 362 TPVKRILDELSLTL 375


>gi|304410084|ref|ZP_07391703.1| A/G-specific adenine glycosylase [Shewanella baltica OS183]
 gi|307302204|ref|ZP_07581962.1| A/G-specific adenine glycosylase [Shewanella baltica BA175]
 gi|304351493|gb|EFM15892.1| A/G-specific adenine glycosylase [Shewanella baltica OS183]
 gi|306914242|gb|EFN44663.1| A/G-specific adenine glycosylase [Shewanella baltica BA175]
          Length = 363

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 107/364 (29%), Positives = 167/364 (45%), Gaps = 24/364 (6%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M        ++I+ WYD + R  LPW+           +PY VW+SEIMLQQT V TV P
Sbjct: 1   MKSTAS-FATRIVSWYDNHGRKTLPWQQD--------KTPYSVWVSEIMLQQTQVATVIP 51

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           Y+ KFM ++P +  L++A D+E+L  W GLGYY RARNL K A +I   Y+G FP   E 
Sbjct: 52  YYLKFMARFPDVLALANAPDDEVLHHWTGLGYYARARNLHKAAKMIRDNYQGLFPTDFEQ 111

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARK 177
           +  LPGIG  TA A+++++      ++D N++R+++R+  I            +      
Sbjct: 112 VLALPGIGRSTAGAVLSLSLGQHHPILDGNVKRVLARHGAIAGWPGQKTVEAQLWQLTDT 171

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
            T       + QAMMD+GA ICT +KP C  CP+  +C     G+          KK   
Sbjct: 172 YTPQQDIQKYNQAMMDIGASICTRSKPNCAACPVAIDCKAQLIGRQTDFPGKK-PKKAIP 230

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
              A  + +  DN++ L KR    +  G+   P  A  +  + ++               
Sbjct: 231 TKAAWMLVLMQDNQVFLAKRPPAGIWGGLWCFPEFATQAALETHL-EEQGFAAQPLEWLT 289

Query: 298 TITHTFTHFTLTLFVWKTIVPQ----------IVIIPDSTWHDAQNLANAALPTVMKKAL 347
              HTF+HF L +      +            ++    S W++  + +   L    ++ L
Sbjct: 290 GFRHTFSHFHLDIQPMMLNLDNTHGNKESVGAVMEQNQSLWYNISHPSKVGLAAATERVL 349

Query: 348 SAGG 351
           +  G
Sbjct: 350 ANLG 353


>gi|254196996|ref|ZP_04903420.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei S13]
 gi|169653739|gb|EDS86432.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei S13]
          Length = 368

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 102/362 (28%), Positives = 170/362 (46%), Gaps = 25/362 (6%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
                 ++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+ +F
Sbjct: 18  SAFAPTLIAWQRKHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVVPYYVRF 69

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           ++++P +  L++A  +++++ WAGLGYY+RARNL +CA  +V+++ G FP   E L +LP
Sbjct: 70  LERYPDVAALAAAPIDDVMALWAGLGYYSRARNLHRCAQAVVERHGGAFPASPEALAELP 129

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITS-- 180
           GIG  TA+AI + AF   A ++D N++R+++R F +            +   A  +    
Sbjct: 130 GIGRSTAAAIASFAFGARATILDGNVKRVLARVFGVEGFPGDKRIENEMWALAEALLPDA 189

Query: 181 --TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
              +    + Q +MDLGA +C   KP C  CP    C+    G+   L     KK  P R
Sbjct: 190 AEPTDVTAYTQGLMDLGATLCVRGKPECGRCPFAGECVAQRSGRQRELPAARPKKAVPTR 249

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
                + + + + +LL++R    +  G+  LP +   +              A  +    
Sbjct: 250 RT-WMLVLRDGDAVLLQRRPPAGIWGGLWSLPEADGDAALARRAREFGG---AALVPLAP 305

Query: 299 ITHTFTHFTLTLFVWKTIV------PQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGI 352
           +THTFTHF L +      +             ++ W     L    +P  ++K L     
Sbjct: 306 LTHTFTHFRLEIEPRLAELDGAAGGAPPAADGETAWVLLDRLDAYGVPAPVRKLLDGLSG 365

Query: 353 KV 354
            +
Sbjct: 366 PL 367


>gi|53724079|ref|YP_104599.1| A/G-specific adenine glycosylase [Burkholderia mallei ATCC 23344]
 gi|67643433|ref|ZP_00442179.1| A/G-specific adenine glycosylase [Burkholderia mallei GB8 horse 4]
 gi|121599895|ref|YP_991434.1| A/G-specific adenine glycosylase [Burkholderia mallei SAVP1]
 gi|124383886|ref|YP_001027490.1| A/G-specific adenine glycosylase [Burkholderia mallei NCTC 10229]
 gi|126448107|ref|YP_001082456.1| A/G-specific adenine glycosylase [Burkholderia mallei NCTC 10247]
 gi|167001040|ref|ZP_02266841.1| A/G-specific adenine glycosylase [Burkholderia mallei PRL-20]
 gi|167917496|ref|ZP_02504587.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei BCC215]
 gi|237810777|ref|YP_002895228.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei
           MSHR346]
 gi|254174839|ref|ZP_04881500.1| A/G-specific adenine glycosylase [Burkholderia mallei ATCC 10399]
 gi|254187794|ref|ZP_04894306.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei Pasteur
           52237]
 gi|254201688|ref|ZP_04908052.1| A/G-specific adenine glycosylase [Burkholderia mallei FMH]
 gi|254207020|ref|ZP_04913371.1| A/G-specific adenine glycosylase [Burkholderia mallei JHU]
 gi|254296088|ref|ZP_04963545.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei 406e]
 gi|254357499|ref|ZP_04973773.1| A/G-specific adenine glycosylase [Burkholderia mallei 2002721280]
 gi|52427502|gb|AAU48095.1| A/G-specific adenine glycosylase [Burkholderia mallei ATCC 23344]
 gi|121228705|gb|ABM51223.1| A/G-specific adenine glycosylase [Burkholderia mallei SAVP1]
 gi|124291906|gb|ABN01175.1| A/G-specific adenine glycosylase [Burkholderia mallei NCTC 10229]
 gi|126240977|gb|ABO04070.1| A/G-specific adenine glycosylase [Burkholderia mallei NCTC 10247]
 gi|147747582|gb|EDK54658.1| A/G-specific adenine glycosylase [Burkholderia mallei FMH]
 gi|147752562|gb|EDK59628.1| A/G-specific adenine glycosylase [Burkholderia mallei JHU]
 gi|148026563|gb|EDK84648.1| A/G-specific adenine glycosylase [Burkholderia mallei 2002721280]
 gi|157805955|gb|EDO83125.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei 406e]
 gi|157935474|gb|EDO91144.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei Pasteur
           52237]
 gi|160695884|gb|EDP85854.1| A/G-specific adenine glycosylase [Burkholderia mallei ATCC 10399]
 gi|237504608|gb|ACQ96926.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei
           MSHR346]
 gi|238524785|gb|EEP88216.1| A/G-specific adenine glycosylase [Burkholderia mallei GB8 horse 4]
 gi|243063111|gb|EES45297.1| A/G-specific adenine glycosylase [Burkholderia mallei PRL-20]
          Length = 368

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 102/362 (28%), Positives = 170/362 (46%), Gaps = 25/362 (6%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
                 ++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+ +F
Sbjct: 18  SAFAPTLIAWQRKHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVVPYYVRF 69

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           ++++P +  L++A  +++++ WAGLGYY+RARNL +CA  +V+++ G FP   E L +LP
Sbjct: 70  LERYPDVAALAAAPIDDVMALWAGLGYYSRARNLHRCAQAVVERHGGAFPASPEALAELP 129

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITS-- 180
           GIG  TA+AI + AF   A ++D N++R+++R F +            +   A  +    
Sbjct: 130 GIGRSTAAAIASFAFGARATILDGNVKRVLARVFGVEGFPGDKRIENEMWALAEALLPDA 189

Query: 181 --TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
              +    + Q +MDLGA +C   KP C  CP    C+    G+   L     KK  P R
Sbjct: 190 AEPTDVTAYTQGLMDLGATLCVRGKPECGRCPFAGECVAQRSGRQRELPAARPKKAVPTR 249

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
                + + + + +LL++R    +  G+  LP +   +              A  +    
Sbjct: 250 RT-WMLVLRDGDAVLLQRRPPAGIWGGLWSLPEADGDAALARRAREFGG---AALVPLAP 305

Query: 299 ITHTFTHFTLTLFVWKTIV------PQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGI 352
           +THTFTHF L +      +             ++ W     L    +P  ++K L     
Sbjct: 306 LTHTFTHFRLEIEPRLAELDGAAGGAPPAADDETAWVLLDRLDAYGVPAPVRKLLDGLSG 365

Query: 353 KV 354
            +
Sbjct: 366 PL 367


>gi|53718166|ref|YP_107152.1| putative A/G-specific adenine glycosylase [Burkholderia
           pseudomallei K96243]
 gi|134279844|ref|ZP_01766556.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei 305]
 gi|217420176|ref|ZP_03451682.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei 576]
 gi|254181861|ref|ZP_04888458.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei 1655]
 gi|52208580|emb|CAH34516.1| putative A/G-specific adenine glycosylase [Burkholderia
           pseudomallei K96243]
 gi|134249044|gb|EBA49126.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei 305]
 gi|184212399|gb|EDU09442.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei 1655]
 gi|217397480|gb|EEC37496.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei 576]
          Length = 368

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 102/362 (28%), Positives = 170/362 (46%), Gaps = 25/362 (6%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
                 ++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+ +F
Sbjct: 18  SAFAPTLIAWQRKHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVVPYYVRF 69

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           ++++P +  L++A  +++++ WAGLGYY+RARNL +CA  +V+++ G FP   E L +LP
Sbjct: 70  LERYPDVAALAAAPIDDVMALWAGLGYYSRARNLHRCAQAVVERHGGAFPASPEALAELP 129

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITS-- 180
           GIG  TA+AI + AF   A ++D N++R+++R F +            +   A  +    
Sbjct: 130 GIGRSTAAAIASFAFGARATILDGNVKRVLARVFGVEGFPGDKRIENEMWALAEALLPDA 189

Query: 181 --TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
              +    + Q +MDLGA +C   KP C  CP    C+    G+   L     KK  P R
Sbjct: 190 AEPTDVTAYTQGLMDLGATLCVRGKPECGRCPFAGECVAQRSGRQRELPAARPKKAVPTR 249

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
                + + + + +LL++R    +  G+  LP +   +              A  +    
Sbjct: 250 RT-WMLVLRDGDAVLLQRRPPAGIWGGLWSLPEADGDAALARRAREFGG---AALVPLAP 305

Query: 299 ITHTFTHFTLTLFVWKTIV------PQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGI 352
           +THTFTHF L +      +             ++ W     L    +P  ++K L     
Sbjct: 306 LTHTFTHFRLEIEPRLAELDGAAGGAPPAADDETAWVLLDRLDAYGVPAPVRKLLDGLSG 365

Query: 353 KV 354
            +
Sbjct: 366 PL 367


>gi|262403922|ref|ZP_06080479.1| A/G-specific adenine glycosylase [Vibrio sp. RC586]
 gi|262349884|gb|EEY99020.1| A/G-specific adenine glycosylase [Vibrio sp. RC586]
          Length = 353

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 104/351 (29%), Positives = 170/351 (48%), Gaps = 17/351 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
               IL WYD   R  LPW+ +         + Y+VW+SEIMLQQT V TV PYF++F+ 
Sbjct: 4   FAQAILTWYDAYGRKNLPWQQN--------KNAYRVWLSEIMLQQTQVATVIPYFERFLA 55

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A  +E+L  W GLGYY RARNL K A ++V +Y G FP  +E +  LPG+
Sbjct: 56  RFPTVHALAAAPQDEVLHFWTGLGYYARARNLHKAAQMVVSEYGGEFPTDLEQMNALPGV 115

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++  +     ++D N++R ++R F +            + +YA   T +   
Sbjct: 116 GRSTAAAVLSSVYKKPHAILDGNVKRTLARCFAVEGWPGQKSVENQLWHYAEMHTPSVDV 175

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA+ICT +KP C LCP++  CL   +G          K  +       F+
Sbjct: 176 DKYNQAMMDMGAMICTRSKPKCSLCPVESFCLAKQQGNPQEYPGKKPKTDK-PVKATWFV 234

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSA-PFTANWILCNTITHTF 303
            + +DN + L +R  + +  G+   P S  ++ +              +        HTF
Sbjct: 235 MLYHDNAVWLEQRPQSGIWGGLYCFPQSEIANIQTTIDQRAIGDSTITSQKTLIAFRHTF 294

Query: 304 THFTLTLFVWKTIVPQIV----IIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ L +      + +            W++        L   +K+ L + 
Sbjct: 295 SHYHLDITPILLQLSRKPDIVMEGSKGLWYNLSQPDEIGLAAPVKQLLHSL 345


>gi|289624101|ref|ZP_06457055.1| A/G-specific adenine glycosylase [Pseudomonas syringae pv. aesculi
           str. NCPPB3681]
 gi|289649381|ref|ZP_06480724.1| A/G-specific adenine glycosylase [Pseudomonas syringae pv. aesculi
           str. 2250]
 gi|330868919|gb|EGH03628.1| A/G-specific adenine glycosylase [Pseudomonas syringae pv. aesculi
           str. 0893_23]
          Length = 355

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 125/355 (35%), Positives = 180/355 (50%), Gaps = 15/355 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  S +LDWYD + R  LPW+           +PY+VW+SEIMLQQT V TV  YF
Sbjct: 1   MQPEQFSSAVLDWYDRHGRHDLPWQQD--------ITPYRVWVSEIMLQQTQVSTVLSYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FM+  PT+  L+ A ++E+L  W GLGYYTRARNL+K A I+V  ++G FP  VE L 
Sbjct: 53  DRFMEALPTVQALAEAPEDEVLHLWTGLGYYTRARNLQKTAKIVVADHDGEFPRDVEKLI 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPGIG  TA AI +++    A ++D N++R+++R+         P   K +   A + T
Sbjct: 113 LLPGIGLSTAGAIASLSMGLRAPILDGNVKRVLARFTAQEGYPGEPKVAKQLWATAERFT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             SR  ++ QAMMDLGA +CT +KP C LCP++++C     G      I   +K  P + 
Sbjct: 173 PHSRVNNYTQAMMDLGATLCTRSKPSCLLCPLERSCEAHMLGLETRYPIPKPRKTVPQKR 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +    D  ILL +R ++ L  G+  LP              H+     +  L   I
Sbjct: 233 TLMPMLANEDGAILLYRRPSSGLWGGLWSLPELDDFDDLQHLATQHALQLGEHHELPGLI 292

Query: 300 THTFTHFTLTLFVWKTIVPQI---VIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
            HTF+HF L++  W   V +    V   D  W++        L   +KK L    
Sbjct: 293 -HTFSHFQLSIEPWLVKVQESADHVAESDWLWYNLATPPRLGLAAPVKKLLKRAA 346


>gi|153802591|ref|ZP_01957177.1| A/G-specific adenine glycosylase [Vibrio cholerae MZO-3]
 gi|124121854|gb|EAY40597.1| A/G-specific adenine glycosylase [Vibrio cholerae MZO-3]
          Length = 353

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 104/351 (29%), Positives = 169/351 (48%), Gaps = 17/351 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
               IL WYD   R  LPW+ +         + Y+VW+SEIMLQQT V TV PYF++F++
Sbjct: 4   FAQAILTWYDAYGRKNLPWQQN--------KNAYRVWLSEIMLQQTQVATVIPYFERFLE 55

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A  +E+L  W GLGYY RARNL K A  +V +Y G FP  +E +  LPG+
Sbjct: 56  RFPTVHALAAAPQDEVLHFWTGLGYYARARNLHKAAQTVVNEYGGEFPTDLEQMNALPGV 115

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++  +     ++D N++R ++R F +            + +YA   T     
Sbjct: 116 GRSTAAAVLSSVYKKPHAILDGNVKRTLARCFAVEGWPGQKSVENQLWHYAEMHTPKVDV 175

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA+ICT +KP C LCP++  CL   +G          K  +       F+
Sbjct: 176 DKYNQAMMDMGAMICTRSKPKCSLCPVESFCLAKQQGNPQEYPGKKPKTDK-PVKATWFV 234

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSA-PFTANWILCNTITHTF 303
            + +DN + L +R  + +  G+   P S  ++ +              +        HTF
Sbjct: 235 MLYHDNAVWLEQRPQSGIWGGLYCFPQSEIANIQTTIDQRAIGDSTITSQKTLIAFRHTF 294

Query: 304 THFTLTLFVWKTIVPQIV----IIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ L +      + +            W++        L   +K+ L + 
Sbjct: 295 SHYHLDITPILLQLSRKPDIVMEGSKGLWYNLSQPDEIGLAAPVKQLLHSL 345


>gi|289164189|ref|YP_003454327.1| A/G-specific adenine glycosylase [Legionella longbeachae NSW150]
 gi|288857362|emb|CBJ11190.1| putative A/G-specific adenine glycosylase [Legionella longbeachae
           NSW150]
          Length = 357

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 114/349 (32%), Positives = 178/349 (51%), Gaps = 14/349 (4%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
                 +L W+D + R  LPW+           +PY+VW+SEIMLQQT V+TV PYF++F
Sbjct: 8   EQFSKPLLLWFDLHGRKNLPWQHP--------RTPYRVWVSEIMLQQTQVQTVIPYFERF 59

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           MQ++P I  L+ A+++++LS W+GLGYY+RARNL + A +I++ ++G FP+  ++L +LP
Sbjct: 60  MQRFPNISDLAHAQEDDVLSLWSGLGYYSRARNLHQTAKLILQHHQGIFPNDSKLLNELP 119

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTS 182
           GIG  T++AI++ AFN  A ++D N++R+++R+F I          K +   A       
Sbjct: 120 GIGPSTSAAILSQAFNKPAAILDGNVKRVLTRFFRITGYPEQSQVKKKLWELADLCMPQE 179

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
              D+ QA+MDLGA  C +  P C  CP+  NCL F   + HL     IKK  P++   +
Sbjct: 180 NCADYTQAIMDLGATCCITKNPHCSSCPLHINCLAFKHKEQHLFPTKKIKKSIPIQYQQL 239

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHT 302
            +       I L KR +  L  G+  LP  +        I  +      +        H 
Sbjct: 240 LVLHNEQGYIYLEKRPSPGLWGGLWCLPNISTDKCPLDFIRVNYDLSGEHPQPLLAFKHR 299

Query: 303 FTHFTLTLFVWKTIVP---QIVIIPDSTWHDAQNLANAALPTVMKKALS 348
           F+HF L +           + +      W   + L +  L    +K LS
Sbjct: 300 FSHFHLEINALSIKTTFFGRQLSENQGQWFAKEQLNSLGLAQPTRKILS 348


>gi|167901250|ref|ZP_02488455.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei NCTC
           13177]
          Length = 368

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 102/362 (28%), Positives = 170/362 (46%), Gaps = 25/362 (6%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
                 ++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+ +F
Sbjct: 18  SAFAPTLIAWQRKHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVVPYYVRF 69

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           ++++P +  L++A  +++++ WAGLGYY+RARNL +CA  +V+++ G FP   E L +LP
Sbjct: 70  LERYPDVAALAAAPIDDVMALWAGLGYYSRARNLHRCAQAVVERHGGAFPASPEALAELP 129

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITS-- 180
           GIG  TA+AI + AF   A ++D N++R+++R F +            +   A  +    
Sbjct: 130 GIGRSTAAAIASFAFGVRATILDGNVKRVLARVFGVEGFPGDKRIENEMWALAEALLPDA 189

Query: 181 --TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
              +    + Q +MDLGA +C   KP C  CP    C+    G+   L     KK  P R
Sbjct: 190 AEPTDVTAYTQGLMDLGATLCVRGKPECGRCPFAGECVAQRSGRQRELPAARPKKAVPTR 249

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
                + + + + +LL++R    +  G+  LP +   +              A  +    
Sbjct: 250 RT-WMLVLRDGDAVLLQRRPPAGIWGGLWSLPEADGDAALARRAREFGG---AALVPLAP 305

Query: 299 ITHTFTHFTLTLFVWKTIV------PQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGI 352
           +THTFTHF L +      +             ++ W     L    +P  ++K L     
Sbjct: 306 LTHTFTHFRLEIEPRLAELDGAAGGAPPAADDETAWVLLDRLDAYGVPAPVRKLLDGLSG 365

Query: 353 KV 354
            +
Sbjct: 366 PL 367


>gi|153001566|ref|YP_001367247.1| A/G-specific adenine glycosylase [Shewanella baltica OS185]
 gi|151366184|gb|ABS09184.1| A/G-specific adenine glycosylase [Shewanella baltica OS185]
          Length = 363

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 107/364 (29%), Positives = 167/364 (45%), Gaps = 24/364 (6%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M        ++I+ WYD + R  LPW+           +PY VW+SEIMLQQT V TV P
Sbjct: 1   MKSTAS-FATRIVSWYDNHGRKTLPWQQD--------KTPYSVWVSEIMLQQTQVATVIP 51

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           Y+ KFM ++P +  L++A D+E+L  W GLGYY RARNL K A +I   Y+G FP   E 
Sbjct: 52  YYLKFMARFPDVLALANAPDDEVLHHWTGLGYYARARNLHKAAKMIRDDYQGLFPTDFEQ 111

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARK 177
           +  LPGIG  TA A+++++      ++D N++R+++R+  I            +      
Sbjct: 112 VLALPGIGRSTAGAVLSLSLGQHHPILDGNVKRVLARHGAIAGWPGQKTVEAQLWQLTDT 171

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
            T       + QAMMD+GA ICT +KP C  CP+  +C     G+          KK   
Sbjct: 172 YTPQQDIQKYNQAMMDIGASICTRSKPNCAACPVAIDCKAQLIGRQTDFPG-KKPKKTIP 230

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
              A  + +  DN++ L KR    +  G+   P  A  +  + ++               
Sbjct: 231 TKAAWMLVLMQDNQVFLAKRPPAGIWGGLWCFPEFATQAALETHL-EEQGFAGQQLEWLT 289

Query: 298 TITHTFTHFTLTLFVWKTIVPQ----------IVIIPDSTWHDAQNLANAALPTVMKKAL 347
              HTF+HF L +      +            ++    S W++  + +   L    ++ L
Sbjct: 290 GFRHTFSHFHLDIQPMMLNLDNTQGNKESVGAVMEQNQSLWYNISHPSKVGLAAATERVL 349

Query: 348 SAGG 351
           +  G
Sbjct: 350 ANLG 353


>gi|300921304|ref|ZP_07137673.1| A/G-specific adenine glycosylase [Escherichia coli MS 115-1]
 gi|300411766|gb|EFJ95076.1| A/G-specific adenine glycosylase [Escherichia coli MS 115-1]
          Length = 350

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 110/359 (30%), Positives = 172/359 (47%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKV +SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVGLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 ALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWSLYPGKKPKQTLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPQFADEESLRHWLAQRQ-IAADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|188991143|ref|YP_001903153.1| A/G-specific adenine glycosylase [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167732903|emb|CAP51099.1| A/G-specific adenine glycosylase [Xanthomonas campestris pv.
           campestris]
          Length = 430

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 115/364 (31%), Positives = 168/364 (46%), Gaps = 22/364 (6%)

Query: 1   MPQPE----HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVK 55
           MP P          ++L W+D + R  LPW+           +PY+VW+SEIMLQQT V 
Sbjct: 75  MPVPATLTTDAFVDRLLHWFDGHGRHDLPWQHP--------RAPYRVWLSEIMLQQTQVA 126

Query: 56  TVEPYFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPH 115
            V PYF+KF+  +PT+  L++A ++ +++ WAGLGYY RARNL   A   V  + G  P 
Sbjct: 127 VVIPYFQKFVASFPTLADLAAADNDTVMAHWAGLGYYARARNLHAAAKQCVALHAGELPR 186

Query: 116 KVEILKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA-----PLYHKT 170
             + L  LPGIG  TA AI++ A+N    ++D N++R+++R   I               
Sbjct: 187 DFDALLALPGIGRSTAGAILSQAWNDRFPIMDGNVKRVLTRIHGIAGYPGLPVVEKQLWQ 246

Query: 171 IKNYARKITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINT 230
           +           R  D+ QA MD GA +CT  +P C +CP+Q+NC+   EG    L    
Sbjct: 247 LAANHVAHVPAGRLADYTQAQMDFGATLCTRARPACMVCPLQENCVARREGLVEALPTPK 306

Query: 231 IKKKRPMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFT 290
             K+ P R     +     N ILL++R  T +   +  LP +   S        H     
Sbjct: 307 PGKQLPEREATALLLENAHNEILLQRRPPTGIWASLWTLPQAETDSDLREWFAAHIDGDY 366

Query: 291 ANWILCNTITHTFTHFTLTLFVWKTIVPQ----IVIIPDSTWHDAQNLANAALPTVMKKA 346
                   I HTF+H+ L L   +         +    D  W    +LA   LP  ++K 
Sbjct: 367 DRADEMPMIVHTFSHYRLHLQPLRLRKVALRQVLRDNDDLRWVARADLATLGLPAPIRKL 426

Query: 347 LSAG 350
           L A 
Sbjct: 427 LDAL 430


>gi|254516063|ref|ZP_05128123.1| A/G-specific adenine glycosylase [gamma proteobacterium NOR5-3]
 gi|219675785|gb|EED32151.1| A/G-specific adenine glycosylase [gamma proteobacterium NOR5-3]
          Length = 359

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 107/351 (30%), Positives = 170/351 (48%), Gaps = 15/351 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
             +++L WYD + R  LPW+           +PY VW+SEIMLQQT V TV PY+++F+ 
Sbjct: 4   FATRLLAWYDDHGRHNLPWQRDA--------TPYHVWLSEIMLQQTQVATVIPYYERFIA 55

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
            +P I  L+SA+ +++L  W+GLGYY RARNL K A  IV+ + G FP  V+ L+ LPG+
Sbjct: 56  SFPDIHALASAETDQVLHHWSGLGYYARARNLHKAAKTIVRDFAGEFPADVDALQALPGV 115

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTSRP 184
           G  TA AI++ A    A ++D N++R+++R+  +            + + A + T  SR 
Sbjct: 116 GRSTAGAILSTALGGRAAILDGNVKRVLARFHAVEGWPGKTAVAAALWDLAEQHTPQSRV 175

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QA+MDLGA +CT +KP C  CP+ K C      +         KK    R     I
Sbjct: 176 AHYTQAIMDLGATLCTRSKPDCQRCPLAKGCAALELERQGDFPGKKPKKTISTRHTHFVI 235

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFT 304
           A T D   LL +R ++ +  G+   P    +++     +               + H+F+
Sbjct: 236 AHTPDGDFLLERRPSSGIWGGLWCFPEVEDAASAARYCEETLFAEIEAVTELPALRHSFS 295

Query: 305 HFTLTLFVWKTIVPQ----IVIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
           H+ L +      + +    I       +  A+      L   +K+   A  
Sbjct: 296 HYHLEISPLLLTLSRTPTMISEQDQLRFWPAEESPEVGLAAPVKRLWQAAA 346


>gi|270263069|ref|ZP_06191339.1| hypothetical protein SOD_d00840 [Serratia odorifera 4Rx13]
 gi|270042757|gb|EFA15851.1| hypothetical protein SOD_d00840 [Serratia odorifera 4Rx13]
          Length = 410

 Score =  245 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 104/361 (28%), Positives = 161/361 (44%), Gaps = 16/361 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           +          +LDWY    R  LPW+           + Y+VW+SE+MLQQT V TV P
Sbjct: 44  LMMQAQQFAQVVLDWYQRYGRKTLPWQ--------LDKTAYQVWLSEVMLQQTQVATVIP 95

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF++FM ++P +  L+ A  +E+L  W GLGYY RARNL K A  IV ++ G FP   E 
Sbjct: 96  YFQRFMARFPNVRALADAPLDEVLHLWTGLGYYARARNLHKAAQTIVAQHGGEFPTTFEE 155

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLY--HKTIKNYARK 177
           +  LPGIG  TA A++++A      ++D N++R+++R + +            +   +  
Sbjct: 156 IAALPGIGRSTAGAVLSLALGQHYPILDGNVKRVLARCYAVEGWPGKKDVENRLWRISED 215

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T     G F QAMMDLGA++CT +KP C LCP+   C+ ++            K+  P 
Sbjct: 216 VTPAKGVGQFNQAMMDLGAMVCTRSKPKCELCPLNTGCIAYANHSWAKYPGKKPKQTLPE 275

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
              A F+ + +  R  L +R    L  G+   P  +     +  +               
Sbjct: 276 -KTAYFLLLQSGERAWLEQRPAVGLWGGLFCFPQFSEREEMELWLQQRGLK-GNRLEQLT 333

Query: 298 TITHTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIKV 354
              HTF+HF L +      +       D     W++        L   + + L       
Sbjct: 334 AFRHTFSHFHLDIVPMWLEMNDAGGSMDEGVGLWYNLAQPPAVGLAAPVDRLLQQLAKHS 393

Query: 355 P 355
           P
Sbjct: 394 P 394


>gi|270157418|ref|ZP_06186075.1| A/G-specific adenine glycosylase [Legionella longbeachae D-4968]
 gi|269989443|gb|EEZ95697.1| A/G-specific adenine glycosylase [Legionella longbeachae D-4968]
          Length = 357

 Score =  245 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 114/349 (32%), Positives = 178/349 (51%), Gaps = 14/349 (4%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
                 +L W+D + R  LPW+           +PY+VW+SEIMLQQT V+TV PYF++F
Sbjct: 8   EQFSKPLLLWFDLHGRKNLPWQHP--------RTPYRVWVSEIMLQQTQVQTVIPYFERF 59

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           MQ++P I  L+ A+++++LS W+GLGYY+RARNL + A +I++ ++G FP+  ++L +LP
Sbjct: 60  MQRFPNISDLAHAQEDDVLSLWSGLGYYSRARNLHQTAKLILQHHQGIFPNDSKLLNELP 119

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTS 182
           GIG  T++AI++ AFN  A ++D N++R+++R+F I          K +   A       
Sbjct: 120 GIGPSTSAAILSQAFNKPAAILDGNVKRVLTRFFRITGYPEQSQVKKKLWELADLCMPQE 179

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
              D+ QA+MDLGA  C +  P C  CP+  NCL F   + HL     IKK  P++   +
Sbjct: 180 NCADYTQAIMDLGATCCITKNPHCSSCPLHINCLAFKHKEQHLFPTKKIKKSIPIQYQQL 239

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHT 302
            +       I L KR +  L  G+  LP  +        I  +      +        H 
Sbjct: 240 LVLHNEQGYIYLEKRPSPGLWGGLWCLPNISTDKCPLDFIRVNYDLSGEHPQPLLAFKHR 299

Query: 303 FTHFTLTLFVWKTIVP---QIVIIPDSTWHDAQNLANAALPTVMKKALS 348
           F+HF L +           + +      W   + L +  L    +K LS
Sbjct: 300 FSHFHLEINALSIKTTFFGRQLSENQGQWFAKEQLNSLGLAQPTRKILS 348


>gi|212638201|ref|YP_002314721.1| A/G-specific adenine glycosylase [Anoxybacillus flavithermus WK1]
 gi|212559681|gb|ACJ32736.1| A/G-specific adenine glycosylase [Anoxybacillus flavithermus WK1]
          Length = 373

 Score =  245 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 114/353 (32%), Positives = 170/353 (48%), Gaps = 16/353 (4%)

Query: 2   PQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  Q  ++DW+ T  R LPWR            PYK+W+SE+MLQQT V TV PYF
Sbjct: 24  HFHIEQFQHDLIDWFRTEQRDLPWRKD--------KDPYKIWVSEVMLQQTRVDTVIPYF 75

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +F++K+PT+  L+ AK+EE+L AW GLGYY+R RNL      + +KY G  P   E   
Sbjct: 76  YQFIEKFPTLDALADAKEEEVLKAWEGLGYYSRVRNLHAAVKEVKEKYGGRVPASKEQFS 135

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPL--YHKTIKNYARKIT 179
            L G+G YT  A+++IA+      VD N+ R++SR F I          K  +     I 
Sbjct: 136 SLKGVGPYTTGAVLSIAYGIPEPAVDGNVMRVLSRIFYITDDIARASTRKKFEQIVSCII 195

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
           S   P DF QA+M+LGAL+CT   P C LCP+Q++C  F+EG    L + T  K      
Sbjct: 196 SHDDPSDFNQALMELGALVCTPKNPSCFLCPVQRHCRAFAEGVEAELPVKTKGKAPKHVA 255

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDG-----NIDTHSAPFTANWI 294
               +    + +I + KR ++ LL  + + P   ++ T +       I         +  
Sbjct: 256 FRAIVLTNEEGKIRIEKRPSSGLLANLWQFPNDEYAPTSNEQAFIKEISERYHVVLRSIQ 315

Query: 295 LCNTITHTFTHFTLTLFVWKTIVPQIVIIPDS-TWHDAQNLANAALPTVMKKA 346
              T  H F+H    +  +K    ++ +  ++  W     L   A P + +K 
Sbjct: 316 RIGTFEHVFSHIVWHIEAYKGNALELQMGDETNKWVTVDELNQYAFPVIYQKI 368


>gi|146309273|ref|YP_001189738.1| A/G-specific DNA-adenine glycosylase [Pseudomonas mendocina ymp]
 gi|145577474|gb|ABP87006.1| A/G-specific DNA-adenine glycosylase [Pseudomonas mendocina ymp]
          Length = 355

 Score =  245 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 123/357 (34%), Positives = 179/357 (50%), Gaps = 15/357 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  S +L WYD + R  LPW+ +         +PY+VW+SEIMLQQT V TV  YF
Sbjct: 1   MSPEQFNSAVLAWYDQHGRKDLPWQQN--------ITPYRVWVSEIMLQQTQVSTVLGYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FM   PT+  L+ A ++E+L  W GLGYYTRARNL+K A II++++ G FP  VE L 
Sbjct: 53  DRFMAALPTVKDLAEAPEDEVLHLWTGLGYYTRARNLQKSAQIIMREHGGEFPRSVEALA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
           +LPGIG  TA AI +++    A ++D N++R+++RY         P   K + + A ++T
Sbjct: 113 ELPGIGRSTAGAIASLSMGVRAPILDGNVKRVLARYVAQEGYPGEPKVAKQLWDIAERLT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              R G + QAMMDLGA +CT +KP C LCP++  C     G      +   +K  P + 
Sbjct: 173 PHERVGHYTQAMMDLGATLCTRSKPTCLLCPVRSGCQAHLLGLEIRYPVPKPRKTLPQKR 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + + +     ILL +R +T L  G+  LP       +  ++                +
Sbjct: 233 TLMPLLVNASGDILLYRRPSTGLWGGLWSLPELD-DLGQLADLGQQQQLELGERQELEGL 291

Query: 300 THTFTHFTLTLFVWKTIV---PQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIK 353
           THTF+HF L +  W   V   P  V   D  W++        L   +KK L      
Sbjct: 292 THTFSHFQLAIEPWLVRVTEQPSRVAEGDWLWYNLATPPRLGLAAPVKKLLKRAAQA 348


>gi|269137623|ref|YP_003294323.1| A/G-specific adenine glycosylase [Edwardsiella tarda EIB202]
 gi|267983283|gb|ACY83112.1| A/G-specific adenine glycosylase [Edwardsiella tarda EIB202]
 gi|304557688|gb|ADM40352.1| A/G-specific adenine glycosylase [Edwardsiella tarda FL6-60]
          Length = 362

 Score =  245 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 105/359 (29%), Positives = 167/359 (46%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                    +L WY    R  LPW+           +PY+VW+SE+MLQQT V TV PYF
Sbjct: 2   MQAQQFAHAVLAWYARFGRKTLPWQHP--------KTPYRVWLSEVMLQQTQVATVLPYF 53

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++F Q++P +  L++A  +E+L  W GLGYY RARNL K A +IV ++ G FP   E + 
Sbjct: 54  QRFTQRFPDVQALAAAPLDEVLHLWTGLGYYARARNLHKAAQLIVSQHHGEFPQDFEQVA 113

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPGIG  TA AI++++      ++D N++R+++R + I            +   + ++T
Sbjct: 114 ALPGIGRSTAGAILSLSLGQHHPILDGNVKRVLARCYAIPGWPGRKEVETRLWQLSGEVT 173

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGAL+CT ++P C LCP+   CL +++G          K+  P R 
Sbjct: 174 PADGVSQFNQAMMDLGALVCTRSRPKCELCPLNAGCLAYADGSWADFPGKKPKQTLPERQ 233

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
               + + +   + L++R  + L  G+   P     +     +                 
Sbjct: 234 A-YLLLLQHGETVWLQQRPASGLWGGLFCFPQYDSEAALRAQLYRL-GQDPDAAQTLTAF 291

Query: 300 THTFTHFTLTLFVW---KTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +       T     +   D  W++     +  L    ++ L     + P
Sbjct: 292 RHTFSHFHLDIIPVWSAYTTASACMDEGDGLWYNLAQPPSVGLAAPTERLLQQLRKQPP 350


>gi|291483307|dbj|BAI84382.1| hypothetical protein BSNT_01434 [Bacillus subtilis subsp. natto
           BEST195]
          Length = 369

 Score =  245 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 113/356 (31%), Positives = 174/356 (48%), Gaps = 18/356 (5%)

Query: 1   MPQPE-HIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           + Q +    +  ++ W++   RVLPWR            PYKVW+SE+MLQQT V+TV P
Sbjct: 8   LKQKDIQQFRDDLISWFEREQRVLPWRED--------QDPYKVWVSEVMLQQTRVETVIP 59

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF +F++++PT+  L+ A +E++L AW GLGYY+R RNL+     + ++Y G  P   + 
Sbjct: 60  YFLRFVEQFPTVEALADADEEKVLKAWEGLGYYSRVRNLQSAVKEVKQEYGGIVPPDEKD 119

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARK 177
              L G+G YT  A+++IA+N     VD N+ R++SR   I      P      ++  R 
Sbjct: 120 FGGLKGVGPYTKGAVLSIAYNKPIPAVDGNVMRVMSRILSIWDDIAKPKTRTIFEDAIRA 179

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
             S  +P +F Q +M+LGALICT   P C LCP+Q++C  F EG    L + + KKK  +
Sbjct: 180 FISKEKPSEFNQGLMELGALICTPKSPSCLLCPVQQHCSAFEEGTERELPVKSKKKKPGI 239

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANW---- 293
           +T A  +    D ++ + KR +  LL  + E P            +   A     +    
Sbjct: 240 KTMAAIVLTDEDGQVYIHKRPSKGLLANLWEFPNLETQKGIKTEREQLIAFLENEYGIQA 299

Query: 294 ---ILCNTITHTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKA 346
               L   + H FTH    + V+   V Q+           + L   A P   +K 
Sbjct: 300 DISDLQGVVEHVFTHLVWNISVFFGKVKQVSDTSKLKKVTKEELEQFAFPVSHQKI 355


>gi|300024385|ref|YP_003756996.1| A/G-specific adenine glycosylase [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526206|gb|ADJ24675.1| A/G-specific adenine glycosylase [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 370

 Score =  245 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 156/349 (44%), Positives = 207/349 (59%), Gaps = 12/349 (3%)

Query: 10  SKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWP 69
           + +L WY+   R LPWR  P+ +      PY+VW+SEIMLQQTTVK V PYF+KF+ +WP
Sbjct: 22  AALLRWYEAERRDLPWRYGPRKKA----DPYRVWLSEIMLQQTTVKAVIPYFQKFVARWP 77

Query: 70  TIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDY 129
            +  L++A+ EE+L  WAGLGYY+RARNLK CAD +V+ ++G FP     L++LPGIG Y
Sbjct: 78  NVAALAAAQLEEVLQQWAGLGYYSRARNLKACADAVVRDFDGVFPRTEVELRELPGIGPY 137

Query: 130 TASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQ 189
           TA+AI AIAF   A  VD NIER++SR F + +P P     I+N A  +T   R GDF Q
Sbjct: 138 TAAAIAAIAFGEKATPVDGNIERVVSRLFAVQQPLPAAKTEIRNLAATLTPARRAGDFAQ 197

Query: 190 AMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITND 249
           AMMDLGA ICT   P C +CP+Q +C   + G +  L I   K  RP R G  F+    D
Sbjct: 198 AMMDLGAEICTPKNPSCLVCPVQPDCAASARGIAETLPIKAQKLARPSRFGIAFLVQRED 257

Query: 250 NRILLRKRTNTRLLEGMDELPGSAW-SSTKDGNIDTHSAPFTANWILC-NTITHTFTHFT 307
             +LLR+R    LL GM E+P + W  ++        SAP T +W+     + H FTHF 
Sbjct: 258 GAVLLRQRPEAGLLGGMLEVPSTHWGDASPSKREALRSAPVTTSWMAVPGPVVHVFTHFR 317

Query: 308 LTLFVWKTIVPQI------VIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           L L V++ IVP               W   ++L   ALP+VMKK ++ G
Sbjct: 318 LELVVYRAIVPVDASFTLWAEQDRCRWVHRRDLHAQALPSVMKKVIAHG 366


>gi|16077929|ref|NP_388743.1| A/G-specific adenine glycosylase or DNA-(apurinic or apyrimidinic
           site) lyase [Bacillus subtilis subsp. subtilis str. 168]
 gi|221308699|ref|ZP_03590546.1| hypothetical protein Bsubs1_04783 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221313022|ref|ZP_03594827.1| hypothetical protein BsubsN3_04729 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221317948|ref|ZP_03599242.1| hypothetical protein BsubsJ_04673 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221322222|ref|ZP_03603516.1| hypothetical protein BsubsS_04774 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|321314584|ref|YP_004206871.1| A/G-specific adenine glycosylase or DNA-(apurinic or apyrimidinic
           site) lyase [Bacillus subtilis BSn5]
 gi|81637527|sp|O31584|YFHQ_BACSU RecName: Full=Probable A/G-specific adenine glycosylase YfhQ
 gi|2633186|emb|CAB12691.1| A/G-specific adenine glycosylase or DNA-(apurinic or apyrimidinic
           site) lyase [Bacillus subtilis subsp. subtilis str. 168]
 gi|2804547|dbj|BAA24483.1| YfhQ [Bacillus subtilis]
 gi|320020858|gb|ADV95844.1| A/G-specific adenine glycosylase or DNA-(apurinic or apyrimidinic
           site) lyase [Bacillus subtilis BSn5]
          Length = 369

 Score =  245 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 113/356 (31%), Positives = 174/356 (48%), Gaps = 18/356 (5%)

Query: 1   MPQPE-HIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           + Q +    +  ++ W++   RVLPWR            PYKVW+SE+MLQQT V+TV P
Sbjct: 8   LKQKDIQQFRDDLISWFEREQRVLPWRED--------QDPYKVWVSEVMLQQTRVETVIP 59

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF +F++++PT+  L+ A +E++L AW GLGYY+R RNL+     + ++Y G  P   + 
Sbjct: 60  YFLRFVEQFPTVEALADADEEKVLKAWEGLGYYSRVRNLQSAVKEVKQEYGGIVPPDEKD 119

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARK 177
              L G+G YT  A+++IA+N     VD N+ R++SR   I      P      ++  R 
Sbjct: 120 FGGLKGVGPYTKGAVLSIAYNKPIPAVDGNVMRVMSRILSIWDDIAKPKTRTIFEDAIRA 179

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
             S  +P +F Q +M+LGALICT   P C LCP+Q++C  F EG    L + + KKK  +
Sbjct: 180 FISKEKPSEFNQGLMELGALICTPKSPSCLLCPVQQHCSAFEEGTERELPVKSKKKKPGI 239

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANW---- 293
           +T A  +    D ++ + KR +  LL  + E P            +   A     +    
Sbjct: 240 KTMAAIVLTDEDGQVYIHKRPSKGLLANLWEFPNLETQKGIKTEREQLIAFLENEYGIQA 299

Query: 294 ---ILCNTITHTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKA 346
               L   + H FTH    + V+   V Q+           + L   A P   +K 
Sbjct: 300 DISDLQGVVEHVFTHLVWNISVFFGKVKQVSDTSKLKKVTKEELEQFAFPVSHQKI 355


>gi|330954804|gb|EGH55064.1| A/G-specific adenine glycosylase [Pseudomonas syringae Cit 7]
          Length = 355

 Score =  245 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 124/355 (34%), Positives = 178/355 (50%), Gaps = 15/355 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  S +LDWYD + R  LPW+           +PY+VW+SEIMLQQT V TV  YF
Sbjct: 1   MQPEQFSSAVLDWYDRHGRHDLPWQQD--------ITPYRVWVSEIMLQQTQVSTVLNYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FM+  PT+  L+ A ++E+L  W GLGYYTRARNL+K A I+V  + G FP  VE L 
Sbjct: 53  DRFMEALPTVQALADAPEDEVLHLWTGLGYYTRARNLQKTAKIVVADHGGEFPRDVEKLI 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPGIG  TA AI +++    A ++D N++R+++R+         P   K +   A + T
Sbjct: 113 LLPGIGLSTAGAIASLSMGIRAPILDGNVKRVLARFTAQEGYPGEPKVAKQLWATAERFT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              R  ++ QAMMDLGA +CT +KP C LCP++++C     G      I   +K  P + 
Sbjct: 173 PHRRVNNYTQAMMDLGATLCTRSKPSCLLCPLERSCEAHMLGLETRYPIPKPRKTVPQKR 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +    D  ILL +R ++ L  G+  LP              H+     +  L   I
Sbjct: 233 TLMPMLANEDGAILLYRRPSSGLWGGLWSLPELDDFDDLQHLATQHALQLGEHHELPGLI 292

Query: 300 THTFTHFTLTLFVWKTIVPQI---VIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
            HTF+HF L++  W   V +    V   D  W++        L   +KK L    
Sbjct: 293 -HTFSHFQLSIEPWLVKVQESTDHVAEADWLWYNLATPPRLGLAAPVKKLLKRAA 346


>gi|257483728|ref|ZP_05637769.1| A/G-specific adenine glycosylase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|298489308|ref|ZP_07007323.1| A/G-specific adenine glycosylase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298156159|gb|EFH97264.1| A/G-specific adenine glycosylase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330987174|gb|EGH85277.1| A/G-specific adenine glycosylase [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 355

 Score =  245 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 125/355 (35%), Positives = 180/355 (50%), Gaps = 15/355 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  S +LDWYD + R  LPW+           +PY+VW+SEIMLQQT V TV  YF
Sbjct: 1   MQPEQFSSAVLDWYDRHGRHDLPWQQD--------ITPYRVWVSEIMLQQTQVSTVLNYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FM+  PT+  L+ A ++E+L  W GLGYYTRARNL+K A I+V  ++G FP  VE L 
Sbjct: 53  DRFMEALPTVQALAEAPEDEVLHLWTGLGYYTRARNLQKTAKIVVADHDGEFPRDVEKLI 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPGIG  TA AI +++    A ++D N++R+++R+         P   K +   A + T
Sbjct: 113 LLPGIGLSTAGAIASLSMGLRAPILDGNVKRVLARFTAQEGYPGEPKVAKQLWATAERFT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             SR  ++ QAMMDLGA +CT +KP C LCP++++C     G      I   +K  P + 
Sbjct: 173 PHSRVNNYTQAMMDLGATLCTRSKPSCLLCPLERSCEAHMLGLETRYPIPKPRKTVPQKR 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +    D  ILL +R ++ L  G+  LP              H+     +  L   I
Sbjct: 233 TLMPMLANEDGAILLYRRPSSGLWGGLWSLPELDDFDDLQHLATQHALQLGEHHELPGLI 292

Query: 300 THTFTHFTLTLFVWKTIVPQI---VIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
            HTF+HF L++  W   V +    V   D  W++        L   +KK L    
Sbjct: 293 -HTFSHFQLSIEPWLVKVQESADHVAEADWLWYNLATPPRLGLAAPVKKLLKRAA 346


>gi|213971190|ref|ZP_03399308.1| A/G-specific adenine glycosylase [Pseudomonas syringae pv. tomato
           T1]
 gi|301382318|ref|ZP_07230736.1| A/G-specific adenine glycosylase [Pseudomonas syringae pv. tomato
           Max13]
 gi|302058511|ref|ZP_07250052.1| A/G-specific adenine glycosylase [Pseudomonas syringae pv. tomato
           K40]
 gi|302132178|ref|ZP_07258168.1| A/G-specific adenine glycosylase [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213924059|gb|EEB57636.1| A/G-specific adenine glycosylase [Pseudomonas syringae pv. tomato
           T1]
          Length = 355

 Score =  245 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 124/355 (34%), Positives = 178/355 (50%), Gaps = 15/355 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  S +LDWYD + R  LPW+           +PY+VW+SEIMLQQT V TV  YF
Sbjct: 1   MQPEQFSSAVLDWYDRHGRHDLPWQQ--------GITPYRVWVSEIMLQQTQVSTVLNYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FM+  PT+  L+ A ++E+L  W GLGYYTRARNL+K A I+V  ++G FP  VE L 
Sbjct: 53  DRFMEALPTVQALAEAPEDEVLHLWTGLGYYTRARNLQKTARIVVADHDGEFPRDVEKLI 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPGIG  TA AI +++    A ++D N++R+++R+         P   K +   A + T
Sbjct: 113 LLPGIGLSTAGAIASLSMGLRAPILDGNVKRVLARFTAQEGYPGEPKVAKQLWATAERFT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             SR   + QAMMDLGA +CT +KP C LCP+++ C     G      I   +K  P + 
Sbjct: 173 PHSRVNHYTQAMMDLGATLCTRSKPSCLLCPLERACEAHMLGLETRYPIPKPRKTVPQKR 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +    D  ILL +R ++ L  G+  LP              H+     +  L   +
Sbjct: 233 TLMPMFANEDGAILLYRRPSSGLWGGLWSLPELDDFDDLQHLATQHALQLGEHHELPG-L 291

Query: 300 THTFTHFTLTLFVWKTIVPQI---VIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
            HTF+HF L++  W   V +    V   D  W++        L   +KK L    
Sbjct: 292 VHTFSHFQLSIEPWLVKVQESADHVAEADWLWYNLATPPRLGLAAPVKKLLKRAA 346


>gi|28872454|ref|NP_795073.1| A/G-specific adenine glycosylase [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|28855709|gb|AAO58768.1| A/G-specific adenine glycosylase [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|331017083|gb|EGH97139.1| A/G-specific adenine glycosylase [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 355

 Score =  245 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 124/355 (34%), Positives = 179/355 (50%), Gaps = 15/355 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  S +LDWYD + R  LPW+           +PY+VW+SEIMLQQT V TV  YF
Sbjct: 1   MQPEQFSSAVLDWYDRHGRHDLPWQQ--------GITPYRVWVSEIMLQQTQVSTVLNYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FM+  PT+  L+ A ++E+L  W GLGYYTRARNL+K A I+V  ++G FP  VE L 
Sbjct: 53  DRFMEALPTVQALAEAPEDEVLHLWTGLGYYTRARNLQKTARIVVADHDGEFPRDVEKLI 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPGIG  TA AI +++    A ++D N++R+++R+         P   K +   A + T
Sbjct: 113 LLPGIGLSTAGAIASLSMGLRAPILDGNVKRVLARFTAQEGYPGEPKVAKQLWATAERFT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             SR  ++ QAMMDLGA +CT +KP C LCP+++ C     G      I   +K  P + 
Sbjct: 173 PHSRVNNYTQAMMDLGATLCTRSKPSCLLCPLERACEAHMLGLETRYPIPKPRKTVPQKR 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +    D  ILL +R ++ L  G+  LP              H+     +  L   +
Sbjct: 233 TLMPMLANEDGAILLYRRPSSGLWGGLWSLPELDDFDDLQHLATQHALQLGEHHELPG-L 291

Query: 300 THTFTHFTLTLFVWKTIVPQI---VIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
            HTF+HF L++  W   V +    V   D  W++        L   +KK L    
Sbjct: 292 VHTFSHFQLSIEPWLVKVQESADHVAEADWLWYNLATPPRLGLAAPVKKLLKRAA 346


>gi|66048125|ref|YP_237966.1| A/G-specific adenine glycosylase MutY [Pseudomonas syringae pv.
           syringae B728a]
 gi|63258832|gb|AAY39928.1| A/G-specific adenine glycosylase MutY [Pseudomonas syringae pv.
           syringae B728a]
          Length = 355

 Score =  245 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 125/355 (35%), Positives = 180/355 (50%), Gaps = 15/355 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  S +LDWYD + R  LPW+           +PY+VW+SEIMLQQT V TV  YF
Sbjct: 1   MQPEQFSSAVLDWYDRHGRHDLPWQQD--------ITPYRVWVSEIMLQQTQVSTVLSYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FM+  PT+  L+ A ++E+L  W GLGYYTRARNL+K A I+V ++ G FP  VE L 
Sbjct: 53  DRFMEALPTVQALAEAPEDEVLHLWTGLGYYTRARNLQKTAKIVVAEHGGEFPRDVEKLI 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPGIG  TA AI +++    A ++D N++R+++R+         P   K +   A + T
Sbjct: 113 LLPGIGLSTAGAIASLSMGIRAPILDGNVKRVLARFTAQEGYPGEPKVAKQLWATAERFT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             SR  ++ QAMMDLGA +CT +KP C LCP++++C     G      I   +K  P + 
Sbjct: 173 PHSRVNNYTQAMMDLGATLCTRSKPSCLLCPLERSCEAHMLGLETRYPIPKPRKTVPQKR 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +    D  ILL +R ++ L  G+  LP              H+     +  L   I
Sbjct: 233 TLMPMLANEDGAILLYRRPSSGLWGGLWSLPELDDFDDLQHLATQHALQLGEHHELPGLI 292

Query: 300 THTFTHFTLTLFVWKTIVPQI---VIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
            HTF+HF L++  W   V +    V   D  W++        L   +KK L    
Sbjct: 293 -HTFSHFQLSIEPWLVKVRESADHVAEADWLWYNLATPPRLGLAAPVKKLLKRAA 346


>gi|293394474|ref|ZP_06638770.1| A/G-specific adenine glycosylase [Serratia odorifera DSM 4582]
 gi|291422939|gb|EFE96172.1| A/G-specific adenine glycosylase [Serratia odorifera DSM 4582]
          Length = 361

 Score =  245 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 108/361 (29%), Positives = 168/361 (46%), Gaps = 16/361 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M          +LDWY    R  LPW+           +PY+VW+SE+MLQQT V TV P
Sbjct: 1   MMMQAQQFSHVVLDWYQRYGRKTLPWQ--------LDKTPYQVWLSEVMLQQTQVATVIP 52

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF++FM ++P +  L+ A  +E+L  W GLGYY RARNL K A  IV ++ G FP   E 
Sbjct: 53  YFQRFMARFPNVRQLAEAPLDEVLHLWTGLGYYARARNLHKAAQTIVAQHGGEFPTTFEQ 112

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARK 177
           +  LPGIG  TA AI++++      ++D N++R+++R + +            +   +R 
Sbjct: 113 IAALPGIGRSTAGAILSLSLGQHYPILDGNVKRVLARCYAVEGWPGKKEVENRLWQISRD 172

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T  +  G F QAMMDLGA++CT +KP C LCP+   C+ ++            K+  P 
Sbjct: 173 VTPANGVGQFNQAMMDLGAMVCTRSKPKCELCPLNAGCIAYANHSWAKYPGKKPKQTLPE 232

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
              A F+ +  D  + L +R    L  G+   P  +     +  +               
Sbjct: 233 -KSAHFLLLQRDQSVWLEQRPAVGLWGGLFCFPQFSERQALELWLQQRGLKDD-RLQQLT 290

Query: 298 TITHTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
              HTF+HF L +      V Q    +      W++     +  L   +++ L     + 
Sbjct: 291 AFRHTFSHFHLDIVPMWLPVQQVGGAMDEGSGLWYNLAQPPSVGLAAPVERLLLQLAKQP 350

Query: 355 P 355
           P
Sbjct: 351 P 351


>gi|120598134|ref|YP_962708.1| A/G-specific adenine glycosylase [Shewanella sp. W3-18-1]
 gi|120558227|gb|ABM24154.1| A/G-specific DNA-adenine glycosylase [Shewanella sp. W3-18-1]
          Length = 362

 Score =  245 bits (625), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 108/363 (29%), Positives = 171/363 (47%), Gaps = 23/363 (6%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M        ++I+ WYD + R  LPW+           +PY+VW+SEIMLQQT V TV P
Sbjct: 1   MKSTAS-FATRIVSWYDNHGRKTLPWQQD--------KTPYRVWVSEIMLQQTQVATVIP 51

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           Y+ KFM ++P +  L++A D+E+L  W GLGYY RARNL K A +I   Y+G FP   E 
Sbjct: 52  YYLKFMARFPDVLALANAPDDEVLHHWNGLGYYARARNLHKAAKMIRDDYQGLFPTDFEQ 111

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARK 177
           +  LPGIG  TA A+++++      ++D N++R+++R+  I          + +      
Sbjct: 112 VLALPGIGRSTAGAVLSLSLGQHHPILDGNVKRVLARHGAIAGWPGQKTVEEQLWQLTDT 171

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T       + QAMMD+GA ICT +KP C +CP+  +C     G+          KK   
Sbjct: 172 LTPQQDIQKYNQAMMDIGASICTRSKPNCAVCPVAIDCKAQLIGRQTDFPG-KKPKKTIP 230

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
              A  + +  DN++ L KR    +  G+   P  A     + ++               
Sbjct: 231 TKAAWMLVLMQDNQVFLAKRPPAGIWGGLWCFPEFATQDALETHL-EEQGFDAQQLEWLT 289

Query: 298 TITHTFTHFTLTLFVWKTIVPQ---------IVIIPDSTWHDAQNLANAALPTVMKKALS 348
              HTF+HF L +      + Q         ++    S W++  + +   L    ++ L+
Sbjct: 290 GFRHTFSHFHLDIQPMMLNLDQTQNNSQMMGVMEQNQSLWYNISHPSKVGLAAATERVLA 349

Query: 349 AGG 351
             G
Sbjct: 350 NLG 352


>gi|71737884|ref|YP_277020.1| A/G-specific adenine glycosylase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71558437|gb|AAZ37648.1| A/G-specific adenine glycosylase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|320326484|gb|EFW82536.1| A/G-specific adenine glycosylase [Pseudomonas syringae pv. glycinea
           str. B076]
 gi|320331777|gb|EFW87715.1| A/G-specific adenine glycosylase [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330872625|gb|EGH06774.1| A/G-specific adenine glycosylase [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 355

 Score =  245 bits (625), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 124/355 (34%), Positives = 180/355 (50%), Gaps = 15/355 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  S +LDWYD + R  LPW+           +PY+VW+SEIMLQQT V TV  YF
Sbjct: 1   MQPEQFSSAVLDWYDRHGRHDLPWQQD--------ITPYRVWVSEIMLQQTQVSTVLNYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FM+  PT+  L+ A ++E+L  W GLGYYTRARNL+K A I+V  ++G FP  VE L 
Sbjct: 53  DRFMEALPTVQALAEAPEDEVLHLWTGLGYYTRARNLQKTAKIVVADHDGEFPRDVEKLI 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPGIG  TA AI +++    A ++D N++R+++R+         P   K +   A + T
Sbjct: 113 LLPGIGLSTAGAIASLSMGLRAPILDGNVKRVLARFTAQEGYPGEPKVAKQLWATAERFT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             SR  ++ QAMMDLGA +CT +KP C LCP++++C     G      I   +K  P + 
Sbjct: 173 PHSRVNNYTQAMMDLGATLCTRSKPSCLLCPLERSCEAHMLGLETRYPIPKPRKTVPQKR 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +    +  ILL +R ++ L  G+  LP              H+     +  L   I
Sbjct: 233 TLMPMLANEEGAILLYRRPSSGLWGGLWSLPELDDFDDLQHLATQHALQLGEHQELPGLI 292

Query: 300 THTFTHFTLTLFVWKTIVPQI---VIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
            HTF+HF L++  W   V +    V   D  W++        L   +KK L    
Sbjct: 293 -HTFSHFQLSIEPWLVKVQESADHVAEADWLWYNLATPPRLGLAAPVKKLLKRAA 346


>gi|92118693|ref|YP_578422.1| A/G-specific adenine glycosylase [Nitrobacter hamburgensis X14]
 gi|91801587|gb|ABE63962.1| A/G-specific DNA-adenine glycosylase [Nitrobacter hamburgensis X14]
          Length = 392

 Score =  245 bits (625), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 143/366 (39%), Positives = 188/366 (51%), Gaps = 32/366 (8%)

Query: 12  ILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPTI 71
           +L WYD + R LPWR  P         PY VW+SEIMLQQTTVK V PYF+KF+ +WP +
Sbjct: 29  LLAWYDLHRRRLPWRALPGKAV----DPYFVWLSEIMLQQTTVKAVGPYFEKFLARWPDV 84

Query: 72  FCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYTA 131
             ++ A  +++L  WAGLGYY+RARNL  CA  + + + G FP   E L  LPGIG YTA
Sbjct: 85  DAMARASLDDVLRMWAGLGYYSRARNLHACAVAVRRDHGGTFPDTEEGLHALPGIGPYTA 144

Query: 132 SAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFV--- 188
           +AI AIAF    + VD NIER++SR F + +  P     I+  A  +   SR GD     
Sbjct: 145 AAIAAIAFGRRTMPVDGNIERVVSRLFAVEEALPKAKPRIRELAATLLGPSRSGDVKTRA 204

Query: 189 -------------------QAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGIN 229
                              QA+MDLGA ICT  KP C LCP+  +C     G        
Sbjct: 205 GRDGKSRAGDGKSRAGDSAQALMDLGATICTPKKPACALCPLSDDCAARLRGDPETFPRK 264

Query: 230 TIKKKRPMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPF 289
             KK   +R GA F+ +T  + +L+R R    LL GM E+P S W + +D       AP 
Sbjct: 265 AKKKAGALRRGAAFV-VTRGDHLLVRTRPEKGLLGGMTEVPTSVWLAAQDDAAALKQAPS 323

Query: 290 TAN----WILCNTITHTFTHFTLTLFVWKTIVPQIVIIPDS-TWHDAQNLANAALPTVMK 344
             +         T+TH FTHF L L V+   +P     P    W     L + ALP +M+
Sbjct: 324 LGSASRWRRKAGTVTHVFTHFPLELTVYTATIPAGARAPKGMRWVPIATLKDEALPNLMR 383

Query: 345 KALSAG 350
           K ++ G
Sbjct: 384 KVIAHG 389


>gi|190151069|ref|YP_001969594.1| A/G-specific adenine glycosylase [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|307246669|ref|ZP_07528739.1| A/G-specific adenine glycosylase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307255653|ref|ZP_07537457.1| A/G-specific adenine glycosylase [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307260104|ref|ZP_07541815.1| A/G-specific adenine glycosylase [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|307264433|ref|ZP_07546019.1| A/G-specific adenine glycosylase [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|189916200|gb|ACE62452.1| A/G-specific adenine glycosylase [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|306852369|gb|EFM84604.1| A/G-specific adenine glycosylase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306861330|gb|EFM93320.1| A/G-specific adenine glycosylase [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306865838|gb|EFM97715.1| A/G-specific adenine glycosylase [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306870249|gb|EFN02007.1| A/G-specific adenine glycosylase [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 381

 Score =  245 bits (625), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 110/374 (29%), Positives = 167/374 (44%), Gaps = 35/374 (9%)

Query: 4   PEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFK 62
           P       +L W+    R  LPW+ +         + Y VW+SE+MLQQT V TV PYF+
Sbjct: 14  PAQPFAKAVLAWFAQYGRKHLPWQQN--------KTLYGVWLSEVMLQQTQVATVIPYFE 65

Query: 63  KFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKK 122
           +F++++PT+  L+ A  +E+L  W GLGYY RARNL K A  I  ++ G FP   + +  
Sbjct: 66  RFIERFPTVTDLADAHIDEVLHLWTGLGYYARARNLHKAAQQIRDQFNGEFPTDFDDVLA 125

Query: 123 LPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITS 180
           L G+G  TA AI++   N    ++D N++R++SR F +            +      +T 
Sbjct: 126 LSGVGRSTAGAILSSVLNAPHPILDGNVKRVLSRAFAVEGWSGEKSVENKLWQLTASVTP 185

Query: 181 TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG 240
            S+  DF QAMMDLGA++CT +KP C LCP+   C            +   KK  P R  
Sbjct: 186 NSQVADFNQAMMDLGAMVCTRSKPKCSLCPLANLCEANRLEAWDKFPVKKPKKILPERQA 245

Query: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTIT 300
             F+ I   N+ILL +R    L  G+   P      T   ++   +   +          
Sbjct: 246 -YFLIIKAGNKILLEQREAKGLWGGLYVFPQFEDLDTLKRSLAEQNLQIS---QQLIAFR 301

Query: 301 HTFTHFTLTLFVWKTIVPQIVIIPDS--------------------TWHDAQNLANAALP 340
           HTF+HF L +      +       +                      W+D Q  +   L 
Sbjct: 302 HTFSHFHLDITPILVELDLQKNAQNQPLVVQENCGNYRLSVSSTANYWYDLQLPSEIGLA 361

Query: 341 TVMKKALSAGGIKV 354
           T +K+ L    + +
Sbjct: 362 TPVKRILDELSLTL 375


>gi|126738671|ref|ZP_01754376.1| A/G-specific adenine glycosylase [Roseobacter sp. SK209-2-6]
 gi|126720470|gb|EBA17176.1| A/G-specific adenine glycosylase [Roseobacter sp. SK209-2-6]
          Length = 354

 Score =  245 bits (625), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 140/344 (40%), Positives = 196/344 (56%), Gaps = 8/344 (2%)

Query: 8   IQSKILDWYDTNHRVLPWRTSPKTE-KSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
           + + +L WYD + R +PWR  P        P PY+VW+SE+MLQQTTV  V  YF++F  
Sbjct: 11  MSNDLLSWYDKHARKMPWRVPPLDRLAGHEPDPYRVWLSEVMLQQTTVAAVIEYFQRFTA 70

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           +WP++  L++A+D ++++ WAGLGYY RARNL KCA ++ +   G FP     L KLPGI
Sbjct: 71  RWPSVVDLANAEDADVMAEWAGLGYYARARNLLKCARVVAQDLGGAFPDSYAELLKLPGI 130

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGD 186
           G YTA+AI +IAF+    V+D N+ER+++R  DI  P P   + ++ +A  +T ++RPGD
Sbjct: 131 GPYTAAAIASIAFDRAETVLDGNVERVMARLHDIHDPLPGSKELLRGHAATLTPSTRPGD 190

Query: 187 FVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAI 246
           + QA+MDLGA ICT   P C +CP ++ C     G +  L   T KK +P R G V++A 
Sbjct: 191 YAQAVMDLGATICTPKSPACGICPWREPCAARIAGTAAELPKKTPKKPKPTRQGMVYLAR 250

Query: 247 TNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILC-NTITHTFTH 305
           +     LL +R +  LL GM   PGS W  T        + PF A W      + HTFTH
Sbjct: 251 SPSGAWLLERRPDKGLLGGMLGWPGSDWGETPTP-----APPFEAEWQDIGGEVRHTFTH 305

Query: 306 FTLTLFVWKTIVPQIVIIPDST-WHDAQNLANAALPTVMKKALS 348
           F L L V    +P+     D+             LPTVM+KA  
Sbjct: 306 FHLILRVLHAELPEDHAPEDNQELLPRHAFRPGDLPTVMRKAFD 349


>gi|294497217|ref|YP_003560917.1| A/G-specific adenine glycosylase [Bacillus megaterium QM B1551]
 gi|294347154|gb|ADE67483.1| A/G-specific adenine glycosylase [Bacillus megaterium QM B1551]
          Length = 364

 Score =  245 bits (625), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 112/354 (31%), Positives = 168/354 (47%), Gaps = 18/354 (5%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               Q  ++ W++   R+LPWR            PYKVW+SEIMLQQT V TV PYF  F
Sbjct: 13  IRAFQDDLISWFEQEQRILPWRQD--------QDPYKVWVSEIMLQQTRVDTVIPYFNNF 64

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           + K+PTI  L+ A ++++L AW GLGYY+RARNL+     + ++Y G  P+    + KL 
Sbjct: 65  ISKFPTIKDLAYANEDDVLKAWEGLGYYSRARNLQTAVREVHEQYGGEVPNTPAEISKLK 124

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTS 182
           G+G YT  AI++IA+      VD N+ R++SR   +      P   K  ++   +I S  
Sbjct: 125 GVGPYTTGAILSIAYGVPQPAVDGNVMRVLSRILSVWDDIAKPKTRKLFEDIVHEIISKD 184

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
            P  F Q MM+LGA++CT   P C LCP++++C  F EG  + L + + KK       A 
Sbjct: 185 NPSYFNQGMMELGAIVCTPTSPSCLLCPVREHCRAFEEGVQNELPVKSKKKAPRALQLAA 244

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSA-------WSSTKDGNIDTHSAPFTANWIL 295
            +    +   L+ KR +  LL  + E P                  I             
Sbjct: 245 AVIRDEEGNYLIHKRPSKGLLANLWEFPNIEVDLSIAPDHQQLHAFIQNEYGADIKIHAP 304

Query: 296 CNTITHTFTHFTLTLFVWKTI-VPQIVIIPDSTWHDAQNLANAALPTVMKKALS 348
             TI H F+H    + V++   +  I  + +      ++L   A P   +K L 
Sbjct: 305 FTTIQHVFSHIVWNITVYEAELISDISALKNLKVVSEKDLEQYAFPVSHQKILK 358


>gi|332999714|gb|EGK19299.1| A/G-specific adenine glycosylase [Shigella flexneri VA-6]
          Length = 350

 Score =  245 bits (625), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 111/359 (30%), Positives = 172/359 (47%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  +++LDWYD   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSAQVLDWYDKYGRKTLPWQID--------KTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM  +PT+  L++A  +E+L  W GLGYY RARNL K A  +   + G FP   E + 
Sbjct: 53  ERFMAHFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            + + + ++T
Sbjct: 113 PLPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA+ICT +KP C LCP+Q  C+  +     L      K+  P RT
Sbjct: 173 PAVGVERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAATNNSWSLYPGKKPKQMLPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  +LL +R  + L  G+   P  A   +    +         N       
Sbjct: 233 GYFLLLQHEDE-VLLAQRPPSGLWGGLYCFPKFADEESLRHWLAQRQ-IAADNLTQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +      V      +   ++ W++     +  L   +++ L       P
Sbjct: 291 RHTFSHFHLDIVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAP 349


>gi|217972505|ref|YP_002357256.1| A/G-specific adenine glycosylase [Shewanella baltica OS223]
 gi|217497640|gb|ACK45833.1| A/G-specific adenine glycosylase [Shewanella baltica OS223]
          Length = 363

 Score =  245 bits (625), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 107/364 (29%), Positives = 167/364 (45%), Gaps = 24/364 (6%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M        ++I+ WYD + R  LPW+           +PY VW+SEIMLQQT V TV P
Sbjct: 1   MKSTAS-FATRIVSWYDNHGRKTLPWQQD--------KTPYSVWVSEIMLQQTQVATVIP 51

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           Y+ KFM ++P +  L++A D+E+L  W GLGYY RARNL K A +I   Y G FP   E 
Sbjct: 52  YYLKFMARFPDVLALANAPDDEVLHHWTGLGYYARARNLHKAAKMIRDDYHGIFPTDFEQ 111

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARK 177
           +  LPGIG  TA A+++++      ++D N++R+++R+  I            +      
Sbjct: 112 VLALPGIGRSTAGAVLSLSLGQHHPILDGNVKRVLARHGAIAGWPGQKTVEAQLWQLTDA 171

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T       + QAMMD+GA ICT +KP C  CP+  +C     G+          KK   
Sbjct: 172 VTPQQDIQKYNQAMMDIGASICTRSKPNCAACPVAIDCKAQLIGRQTDFPG-KKPKKTIP 230

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
              A  + +  DN++ L KR    +  G+   P  A  +  + ++               
Sbjct: 231 TKAAWMLVLMQDNQVFLAKRPPAGIWGGLWCFPEFATQAALETHL-EEQGIDAQQLEWLT 289

Query: 298 TITHTFTHFTLTLFVWKTIVPQ----------IVIIPDSTWHDAQNLANAALPTVMKKAL 347
              HTF+HF L +      +            ++    S W++  + +   L    ++ L
Sbjct: 290 GFRHTFSHFHLDIQPMMLNLDNTHGNKESVGAVMEQNQSLWYNISHPSKVGLAAATERVL 349

Query: 348 SAGG 351
           +  G
Sbjct: 350 ANLG 353


>gi|332139686|ref|YP_004425424.1| A/G-specific adenine glycosylase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327549708|gb|AEA96426.1| A/G-specific adenine glycosylase [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 355

 Score =  245 bits (625), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 110/355 (30%), Positives = 169/355 (47%), Gaps = 21/355 (5%)

Query: 7   IIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
               ++L W+D + R  LPW+           +PYKVW+SEIMLQQT V TV PYF++FM
Sbjct: 9   SFAERVLAWFDKHGRKHLPWQQEV--------TPYKVWVSEIMLQQTQVTTVIPYFERFM 60

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
             +PT+  L+ A  +++L  W GLGYY RARNL K A+ +V +Y G FP  +E +  LPG
Sbjct: 61  ASFPTVHDLAKASQDDVLHHWTGLGYYARARNLHKAANRLVDEYNGEFPFSLEEVIDLPG 120

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSR 183
           IG  TA AI++++ N    ++D N++R+++RY+ I            +   A K T T+ 
Sbjct: 121 IGRSTAGAILSLSRNMRFAILDGNVKRVLARYYAISGWPGQKKVENQLWEVAEKNTPTNP 180

Query: 184 ----PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                 ++ Q MMDLGA+ICT +KP C  CP+Q +C+ +++G          KK  P + 
Sbjct: 181 EGGRCANYTQVMMDLGAIICTRSKPKCDECPLQADCIAYAQGAQTDYPGKKPKKALPEKA 240

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +A   ++++ L +R +T L  G+      +                        T 
Sbjct: 241 TFMMVA-QFNSQVYLEQRPSTGLWGGLYGFIEVSSIEEGIEQFKKRGVNVEET-KTLETF 298

Query: 300 THTFTHFTLTLFVWKTIVPQIV----IIPDSTWHDAQNLANAALPTVMKKALSAG 350
            HTF+HF L +     +V              W          L     K +   
Sbjct: 299 RHTFSHFHLDITPVVAVVNSPPTKRVADTAFRWFSLGEPIEVGLAAPTTKIIKQL 353


>gi|322834248|ref|YP_004214275.1| A/G-specific adenine glycosylase [Rahnella sp. Y9602]
 gi|321169449|gb|ADW75148.1| A/G-specific adenine glycosylase [Rahnella sp. Y9602]
          Length = 358

 Score =  245 bits (624), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 105/357 (29%), Positives = 168/357 (47%), Gaps = 16/357 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                    +LDWY    R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 8   MEAKSFSPLVLDWYQRYGRKTLPWQI--------AKTPYKVWLSEVMLQQTQVATVIPYF 59

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM+++PT+  L++A  +E+L  W GLGYY RARNL K A  IV ++ G FP   + + 
Sbjct: 60  ERFMERFPTVSDLAAAPLDEVLHLWTGLGYYARARNLHKAAQTIVSQHSGVFPTTFDEIL 119

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPGIG  TA A++++A N    ++D N++R+++R + +            +   +  +T
Sbjct: 120 ALPGIGRSTAGAVLSLALNQHYPILDGNVKRVLARCYAVDGWPGEKKTENKLWAISEDVT 179

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT +KP C LCP++  C  ++            K   P   
Sbjct: 180 PAEGVAQFNQAMMDLGAMVCTRSKPKCELCPVKSGCEAYAHHSWAKYPGKKPKTTLPE-K 238

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
            A  + I  ++++ L +R +  L  G+   P  +        +  +     A        
Sbjct: 239 TAFMLMIQQEDKVWLEQRPSVGLWGGLFCFPQYSTEDELTLGLQKYGVTQNA-LQQQTAF 297

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIK 353
            HTF+HF L +      +       D     W++     +  L   +++ L     +
Sbjct: 298 RHTFSHFHLDIVPMWLNLRSPAGCMDEGAGLWYNLAQPQSVGLAAPVERLLMQLAKQ 354


>gi|302187481|ref|ZP_07264154.1| A/G-specific adenine glycosylase [Pseudomonas syringae pv. syringae
           642]
          Length = 355

 Score =  245 bits (624), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 123/355 (34%), Positives = 178/355 (50%), Gaps = 15/355 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  S +LDWYD + R  LPW+           +PY+VW+SEIMLQQT V TV  YF
Sbjct: 1   MQPEQFSSAVLDWYDRHGRHDLPWQQD--------ITPYRVWVSEIMLQQTQVSTVLSYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FM+  PT+  L+ A ++E+L  W GLGYYTRARNL+K A I+V  + G FP  VE L 
Sbjct: 53  DRFMEALPTVQALAEAPEDEVLHLWTGLGYYTRARNLQKTAKIVVADHGGEFPRDVEKLI 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPGIG  TA AI +++    A ++D N++R+++R+         P   K +   A + T
Sbjct: 113 LLPGIGLSTAGAIASLSMGLRAPILDGNVKRVLARFTAQEGYPGEPKVAKQLWATAERFT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             SR  ++ QAMMDLGA +CT +KP C LCP++++C     G      I   +K  P + 
Sbjct: 173 PYSRVNNYTQAMMDLGATLCTRSKPSCLLCPLERSCEAHMLGLETRYPIPKPRKAVPQKR 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +    D  ILL +R ++ L  G+  LP              H+     +      +
Sbjct: 233 TLMPMLANEDGAILLYRRPSSGLWGGLWSLPELDDFDDLQHLATQHALHLGEHHE-LPEL 291

Query: 300 THTFTHFTLTLFVWKTIVPQI---VIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
            HTF+HF L++  W   V +    V   D  W++        L   +KK L    
Sbjct: 292 IHTFSHFQLSIEPWLVKVRESADHVAEADWLWYNLATPPRLGLAAPVKKLLKRAA 346


>gi|115378869|ref|ZP_01466007.1| A/G-specific adenine glycosylase [Stigmatella aurantiaca DW4/3-1]
 gi|310820058|ref|YP_003952416.1| a/g-specific adenine glycosylase [Stigmatella aurantiaca DW4/3-1]
 gi|115364108|gb|EAU63205.1| A/G-specific adenine glycosylase [Stigmatella aurantiaca DW4/3-1]
 gi|309393130|gb|ADO70589.1| A/G-specific adenine glycosylase [Stigmatella aurantiaca DW4/3-1]
          Length = 371

 Score =  245 bits (624), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 112/355 (31%), Positives = 171/355 (48%), Gaps = 20/355 (5%)

Query: 7   IIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
            I++ +L WY    R LPWR +          PY +W+SE+MLQQT V TV PY+++F+ 
Sbjct: 15  AIRAPLLAWYGREKRDLPWRRT--------SDPYAIWLSEVMLQQTQVSTVIPYWERFLA 66

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++P++  L++A  +++L+AW GLGYY+RARNL + A  +V  + G FP   + L  LPG 
Sbjct: 67  RFPSVRALAAAPLDDVLAAWRGLGYYSRARNLHRAAQEVVANFGGRFPPTAKDLLTLPGF 126

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTSRP 184
           G YTA A+ +IAF   A +VD N+ R++SR F +            +   A  +    RP
Sbjct: 127 GRYTAGAVASIAFGEEAPLVDGNVARVLSRLFAVEGMPGDKAREARLWTLAGALVKGERP 186

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
           GDF QA+M+ GA +C   +PLC LCP++  CL +  G+   L    ++      T A+ +
Sbjct: 187 GDFNQALMEHGATVCRPERPLCLLCPVRGACLAYQTGRVSELPPPKVRAPPKRLTLALAV 246

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWIL-----CNTI 299
               D  +  R+     L  G+ ELP                   +    L       T+
Sbjct: 247 WPQGDTLLFARRA-EKGLFGGLWELPAVEVEPGTPDEEAAQRLSESLEVPLTAMGALGTV 305

Query: 300 THTFTHFTLTLFVWKTIVP----QIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
               TH  LTL + +   P    +     +  W      A   + T M++AL A 
Sbjct: 306 KRQLTHRALTLHLLRVTGPRRPSRAKAFHELRWCTPAQAAELGMSTAMQRALDAA 360


>gi|148545561|ref|YP_001265663.1| A/G-specific adenine glycosylase [Pseudomonas putida F1]
 gi|148509619|gb|ABQ76479.1| A/G-specific DNA-adenine glycosylase [Pseudomonas putida F1]
          Length = 355

 Score =  245 bits (624), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 122/358 (34%), Positives = 181/358 (50%), Gaps = 15/358 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  S +LDWYD + R  LPW+           +PY+VW+SEIMLQQT V TV  YF
Sbjct: 1   MSPEQFSSAVLDWYDEHGRHDLPWQQ--------GITPYRVWVSEIMLQQTQVSTVLNYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FMQ  PT+  L+ A ++E+L  W GLGYYTRARNL+K A ++V+++ G FP  VE L 
Sbjct: 53  DRFMQALPTVQALAEAPEDEVLHLWTGLGYYTRARNLQKAAKVVVEQHGGEFPRSVEQLT 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
           +LPGIG  TA AI +I+    A ++D N++R+++RY         P     +   A ++T
Sbjct: 113 ELPGIGRSTAGAIASISMGIRAPILDGNVKRVLARYTAQAGYPGEPKVANQLWATAERLT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              R   + QAMMD+GA +CT +KP C +CP+Q+ C     G+         +K  P R 
Sbjct: 173 PQQRANHYTQAMMDMGATLCTRSKPSCLICPLQRGCEAHLHGEETRYPEPKPRKALPQRR 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +   ++  ILL +R ++ L  G+  LP     +  D     H         +   +
Sbjct: 233 TLMPLLANHEGAILLYRRPSSGLWGGLWSLPELDDIAQLDDLAYQHGLRLAGRHAMDG-L 291

Query: 300 THTFTHFTLTLFVWKTIVPQIVII---PDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
           THTF+HF L +  W   V  +       D  W++        L   +KK L     ++
Sbjct: 292 THTFSHFQLAIEPWLVRVDPVGEHVVEADWLWYNLATPPRLGLAAPVKKLLERATDEL 349


>gi|147675529|ref|YP_001215977.1| A/G-specific adenine glycosylase [Vibrio cholerae O395]
 gi|262167154|ref|ZP_06034868.1| A/G-specific adenine glycosylase [Vibrio cholerae RC27]
 gi|146317412|gb|ABQ21951.1| A/G-specific adenine glycosylase [Vibrio cholerae O395]
 gi|227012305|gb|ACP08515.1| A/G-specific adenine glycosylase [Vibrio cholerae O395]
 gi|262024454|gb|EEY43141.1| A/G-specific adenine glycosylase [Vibrio cholerae RC27]
          Length = 353

 Score =  245 bits (624), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 103/351 (29%), Positives = 169/351 (48%), Gaps = 17/351 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
               IL WYD   R  LPW+ +         + Y+VW+SEIMLQQT V TV PYF++F++
Sbjct: 4   FAQAILTWYDAYGRKNLPWQQN--------KNAYRVWLSEIMLQQTQVATVIPYFERFLE 55

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A  +E+L  W GLGYY RARNL K A ++V +Y G FP  +E +  LPG+
Sbjct: 56  RFPTVHALAAAPQDEVLHFWTGLGYYARARNLHKAAKMVVSEYSGEFPTDLEQMNALPGV 115

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++  +     ++D N++R ++R F +            + +YA   T     
Sbjct: 116 GRSTAAAVLSSVYKKPHAILDGNVKRTLARCFAVEGWPGQKSVENQLWHYAEMHTPKVDV 175

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA+IC  +KP C LCP++  CL   +G          K  +       F+
Sbjct: 176 DKYNQAMMDMGAMICIRSKPKCSLCPVESFCLAKQQGNPQEYPGKKPKTDK-PVKATWFV 234

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSA-PFTANWILCNTITHTF 303
            + +DN + L +R  + +  G+   P S  ++ +              +        HTF
Sbjct: 235 MLYHDNAVWLEQRPQSGIWGGLYCFPQSEIANIQTTIDQRAIGDSTITSQKTLIAFRHTF 294

Query: 304 THFTLTLFVWKTIVPQIV----IIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ L +      + +            W++        L   +K+ L + 
Sbjct: 295 SHYHLDITPILLQLSRKPDIVMEGSKGLWYNLSQPDEIGLAAPVKQLLHSL 345


>gi|188534966|ref|YP_001908763.1| adenine DNA glycosylase [Erwinia tasmaniensis Et1/99]
 gi|188030008|emb|CAO97892.1| A/G-specific adenine glycosylase [Erwinia tasmaniensis Et1/99]
          Length = 361

 Score =  245 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 107/347 (30%), Positives = 166/347 (47%), Gaps = 16/347 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                   ++LDWY    R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSQQVLDWYQRYGRKTLPWQ--------LEKTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++P +  L++A  +E+L  W GLGYY RARNL K A  +V+K+ G FP     + 
Sbjct: 53  ERFMARFPDVSDLAAAPLDEVLHLWTGLGYYARARNLHKAAKTVVEKHGGVFPQTFAEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPG+G  TA AI+++A      ++D N++R+++R + +          K +   + ++T
Sbjct: 113 DLPGVGRSTAGAILSLALGKHFPILDGNVKRVLARCYAVAGWPGRKEVEKRLWQISEEVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMD+GA++CT +KP C +CP+   C+ ++ G          KK  P RT
Sbjct: 173 PADGVSRFNQAMMDIGAIVCTRSKPKCEICPVNSGCMAYAHGSWAQYPGKKPKKTIPERT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G + +       + L +R    L  G+   P  A  S     +        +     N  
Sbjct: 233 GWLLLM-QQGQDVWLEQRPPVGLWGGLFCFPQYATESDLRAALRA-RGVDDSKLQQMNAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVM 343
            HTF+HF L +      +P   +  D     W++        L   +
Sbjct: 291 RHTFSHFHLDIVPVWLDLPSARLAMDDGAGLWYNLAQPPAVGLAAPV 337


>gi|126175241|ref|YP_001051390.1| A/G-specific adenine glycosylase [Shewanella baltica OS155]
 gi|125998446|gb|ABN62521.1| A/G-specific DNA-adenine glycosylase [Shewanella baltica OS155]
          Length = 363

 Score =  245 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 107/364 (29%), Positives = 167/364 (45%), Gaps = 24/364 (6%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M        ++I+ WYD + R  LPW+           +PY VW+SEIMLQQT V TV P
Sbjct: 1   MKSTAS-FATRIVSWYDNHGRKTLPWQQD--------KTPYSVWVSEIMLQQTQVATVIP 51

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           Y+ KFM ++P +  L++A D+E+L  W GLGYY RARNL K A +I   Y+G FP   E 
Sbjct: 52  YYLKFMARFPDVLALANAPDDEVLHHWTGLGYYARARNLHKAAKMIRDDYQGLFPTDFEQ 111

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARK 177
           +  LPGIG  TA A+++++      ++D N++R+++R+  I            +      
Sbjct: 112 VLALPGIGRSTAGAVLSLSLGQHHPILDGNVKRVLARHGAIAGWPGQKTVEAQLWQLTDT 171

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
            T       + QAMMD+GA ICT +KP C  CP+  +C     G+          KK   
Sbjct: 172 YTPQQDIQKYNQAMMDIGASICTRSKPNCAACPVAIDCKAQLIGRQTDFPG-KKPKKTIP 230

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
              A  + +  DN++ L KR    +  G+   P  A  +  + ++               
Sbjct: 231 TKAAWMLVLMQDNQVFLAKRPPAGIWGGLWCFPEFATHAALETHL-EEQGFAGQQLEWLT 289

Query: 298 TITHTFTHFTLTLFVWKTIVPQ----------IVIIPDSTWHDAQNLANAALPTVMKKAL 347
              HTF+HF L +      +            ++    S W++  + +   L    ++ L
Sbjct: 290 GFRHTFSHFHLDIQPMMLNLDNTHGNKESVGAVMEQNQSLWYNISHPSKVGLAAATERVL 349

Query: 348 SAGG 351
           +  G
Sbjct: 350 ANLG 353


>gi|227824799|ref|ZP_03989631.1| A/G-specific adenine glycosylase [Acidaminococcus sp. D21]
 gi|226905298|gb|EEH91216.1| A/G-specific adenine glycosylase [Acidaminococcus sp. D21]
          Length = 361

 Score =  245 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 125/341 (36%), Positives = 176/341 (51%), Gaps = 9/341 (2%)

Query: 11  KILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPT 70
            +L W+D   R LPWR +          PY VW+SEIMLQQT  +TV+ Y+ ++M  +PT
Sbjct: 19  ALLHWFDETKRDLPWRAN------HPRDPYHVWVSEIMLQQTRTETVKDYYVRWMAAFPT 72

Query: 71  IFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYT 130
           +  L+ A +EE+L  W GLGYY+RARNL K A  IV +Y G FP  +E ++ LPGIGDYT
Sbjct: 73  VSALAQASEEEVLKLWQGLGYYSRARNLHKAAREIVLQYHGIFPDTLEAVRALPGIGDYT 132

Query: 131 ASAIVAIAFNHFAVVVDTNIERIISRYFDI--IKPAPLYHKTIKNYARKITSTSRPGDFV 188
           A AI+++AF H    VD N+ R+++R F I     +    + I   A+ +    RPGDF 
Sbjct: 133 AGAILSMAFGHAVPAVDGNLLRVMARLFGISDDILSLKGKRIIGRIAQTVIPQDRPGDFN 192

Query: 189 QAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITN 248
           +A+MDLGA IC  + P C  CP++  C  F E ++  L +   KK          + I  
Sbjct: 193 EALMDLGATICIPHVPRCGSCPLKDFCTAFLENRTSELPVRKKKKAP-TIYEVTSLFIRK 251

Query: 249 DNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTL 308
              +LL KR  T LL  + ELP     + K+   +      T    +  T  H FTH   
Sbjct: 252 QGALLLHKRPETGLLASLWELPTFLGKTEKESRKEAERMLGTVEGKIIWTHRHVFTHQIW 311

Query: 309 TLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSA 349
            + V+   +P  +  P   W D   L    L    +K L+A
Sbjct: 312 QMTVYLGTIPCSLPDPSYVWVDEGTLGTLPLCGPAEKCLAA 352


>gi|330874227|gb|EGH08376.1| A/G-specific adenine glycosylase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 355

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 124/355 (34%), Positives = 179/355 (50%), Gaps = 15/355 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  S +LDWYD + R  LPW+           +PY+VW+SEIMLQQT V TV  YF
Sbjct: 1   MQPEQFSSAVLDWYDRHGRHDLPWQQ--------GITPYRVWVSEIMLQQTQVSTVLNYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FM+  PT+  L+ A ++E+L  W GLGYYTRARNL+K A I+V  ++G FP  VE L 
Sbjct: 53  DRFMEALPTVQALAEAPEDEVLHLWTGLGYYTRARNLQKTAKIVVADHDGEFPRDVEKLI 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPGIG  TA AI +++    A ++D N++R+++R+         P   K +   A + T
Sbjct: 113 LLPGIGLSTAGAIASLSMGLRAPILDGNVKRVLARFTAQEGYPGEPKVAKQLWATAERFT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             SR  ++ QAMMDLGA +CT +KP C LCP+++ C     G      I   +K  P + 
Sbjct: 173 PHSRVNNYTQAMMDLGATLCTRSKPSCLLCPLERACQAHMLGLETRYPIPKPRKTVPQKR 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +    D  ILL +R ++ L  G+  LP              H+     +  L   +
Sbjct: 233 TLMPMLANEDGAILLYRRPSSGLWGGLWSLPELDDFDDLQHLATQHALQLGEHHELPG-L 291

Query: 300 THTFTHFTLTLFVWKTIVPQI---VIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
            HTF+HF L++  W   V +    V   D  W++        L   +KK L    
Sbjct: 292 VHTFSHFQLSIEPWLVKVQESADHVAEADWLWYNLATPPRLGLAAPVKKLLKRAA 346


>gi|254850682|ref|ZP_05240032.1| A/G-specific adenine glycosylase [Vibrio cholerae MO10]
 gi|254846387|gb|EET24801.1| A/G-specific adenine glycosylase [Vibrio cholerae MO10]
          Length = 368

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 104/348 (29%), Positives = 170/348 (48%), Gaps = 17/348 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
               IL WYD   R  LPW+ +         + Y+VW+SEIMLQQT V TV PYF++F++
Sbjct: 19  FAQAILTWYDAYGRKNLPWQQN--------KNAYRVWLSEIMLQQTQVATVIPYFERFLE 70

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A  +E+L  W GLGYY RARNL K A ++V +Y G FP  +E +  LPG+
Sbjct: 71  RFPTVHALAAAPQDEVLHFWTGLGYYARARNLHKAAQMVVSEYGGEFPTDLEQMNALPGV 130

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++  +     ++D N++R ++R F +            + +YA   T     
Sbjct: 131 GRSTAAAVLSSVYKKPHAILDGNVKRTLARCFAVEGWPGQKSVENQLWHYAEMHTPKVDV 190

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA+ICT +KP C LCP++  CL   +G          K  +       F+
Sbjct: 191 DKYNQAMMDMGAMICTRSKPKCSLCPVESFCLAKQQGNPQEYPGKKPKTDK-PVKATWFV 249

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSA-PFTANWILCNTITHTF 303
            + +DN + L +R  + +  G+   P S  ++ +              +        HTF
Sbjct: 250 MLYHDNAVWLEQRPQSGIWGGLYCFPQSEIANIQTTIDQRAIGDSTITSQKTLIAFRHTF 309

Query: 304 THFTLTLFVWKTIVPQIV----IIPDSTWHDAQNLANAALPTVMKKAL 347
           +H+ L +      + +            W++  +     L   +K+ L
Sbjct: 310 SHYHLDITPILLQLSRKPDIVMEGSKGLWYNLSHPDEIGLAAPVKQLL 357


>gi|288555177|ref|YP_003427112.1| A/G-specific DNA adenine glycosylase [Bacillus pseudofirmus OF4]
 gi|288546337|gb|ADC50220.1| A/G-specific DNA adenine glycosylase [Bacillus pseudofirmus OF4]
          Length = 362

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 108/354 (30%), Positives = 177/354 (50%), Gaps = 17/354 (4%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               Q  +++W+  N R LPWR +          PY+VW+SEIMLQQT V TV PY+  F
Sbjct: 11  ISQFQQDLINWFKENQRTLPWREN--------KDPYRVWVSEIMLQQTRVDTVIPYYLNF 62

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M+++PT+  L+ A+++ IL AW GLGYY+R RNL+     +V++Y    P  ++ +  L 
Sbjct: 63  MREFPTLEDLAYAEEDRILKAWEGLGYYSRVRNLQTAVREVVEEYNAAVPDTLKEISALK 122

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYH--KTIKNYARKITSTS 182
           G+G YTA AI++IA+      VD N+ R++SR  +I +        KT +     + S  
Sbjct: 123 GVGPYTAGAILSIAYAKPEPAVDGNVMRVLSRVLEIDEDIAKAKTRKTFEAIIYDLISKE 182

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
            P  F Q +M+LGALICT   P C LCP++++C+ +++G    L + + KKK   +  A 
Sbjct: 183 DPSSFNQGLMELGALICTPTSPGCLLCPVREHCMAYNKGIQDTLPVKSKKKKAKRKLMAA 242

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSA------WSSTKDGNIDTHSAPFTANWILC 296
           F+    D ++L+ KR +  LL G+ + P                 +        +     
Sbjct: 243 FVVKDEDGKVLIEKRPDKGLLAGLWQFPNVEVDSHSFNKEEMAEALSLAIGKPISIRDRI 302

Query: 297 NTITHTFTHFTLTLFVWKTIVP-QIVIIPDSTWHDAQNLANAALPTVMKKALSA 349
             + H F+H    + V+  ++P +        + D   + + A P   +K +  
Sbjct: 303 QKVEHVFSHIVWDIDVYTAVIPIKEWEKEGQRFVDQYQIEDFAFPVSHQKIIKH 356


>gi|28899400|ref|NP_799005.1| A/G-specific adenine glycosylase [Vibrio parahaemolyticus RIMD
           2210633]
 gi|260366271|ref|ZP_05778730.1| A/G-specific adenine glycosylase [Vibrio parahaemolyticus K5030]
 gi|260878912|ref|ZP_05891267.1| A/G-specific adenine glycosylase [Vibrio parahaemolyticus AN-5034]
 gi|260898287|ref|ZP_05906783.1| A/G-specific adenine glycosylase [Vibrio parahaemolyticus Peru-466]
 gi|28807636|dbj|BAC60889.1| A/G-specific adenine glycosylase [Vibrio parahaemolyticus RIMD
           2210633]
 gi|308085868|gb|EFO35563.1| A/G-specific adenine glycosylase [Vibrio parahaemolyticus Peru-466]
 gi|308090512|gb|EFO40207.1| A/G-specific adenine glycosylase [Vibrio parahaemolyticus AN-5034]
 gi|308113513|gb|EFO51053.1| A/G-specific adenine glycosylase [Vibrio parahaemolyticus K5030]
          Length = 358

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 107/358 (29%), Positives = 168/358 (46%), Gaps = 23/358 (6%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
             S IL+WYD   R  LPW+ +         + Y VW+SEIMLQQT V TV PY+++F++
Sbjct: 4   FASAILEWYDAYGRKDLPWQQN--------KTAYSVWLSEIMLQQTQVTTVIPYYQRFLE 55

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A+ +E+L  W GLGYY RARNL K A  +  KY G FP  +E +  LPGI
Sbjct: 56  RFPTVVDLANAEQDEVLHLWTGLGYYARARNLHKAAKEVAHKYSGEFPLNLEQMNALPGI 115

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++        ++D N++R +SR F +            +   A   T  +  
Sbjct: 116 GRSTAAAVLSSVHKQPHAILDGNVKRTLSRCFAVEGWPGQKKVENQLWEIAEAHTPQTDV 175

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGK---SHLLGINTIKKKRPMRTGA 241
             + QAMMD+GA++CT +KP C LCP+   C+   +G             K  +  R   
Sbjct: 176 DKYNQAMMDMGAMVCTRSKPKCTLCPVADLCVAKKQGNVLDYPGKKPKKEKPVKQTRFVM 235

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAW---SSTKDGNIDTH--SAPFTANWILC 296
           +     N + + L +R  T +  G+   P +      S  D  ++     A         
Sbjct: 236 LHHHNENGHEVWLEQRPQTGIWGGLFCFPQTEHVDVESDIDLLLEQRGIKASDINKQETL 295

Query: 297 NTITHTFTHFTLTLFVWKTIVPQ----IVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            T  HTF+H+ L +      + +    ++      W++        L   +K  L A 
Sbjct: 296 ITFRHTFSHYHLDITPILIDLSKQPDVVMEGSKGLWYNLSQPEEVGLAAPVKLLLEAL 353


>gi|91228697|ref|ZP_01262611.1| A/G-specific adenine glycosylase [Vibrio alginolyticus 12G01]
 gi|269965735|ref|ZP_06179832.1| A/G-specific adenine glycosylase [Vibrio alginolyticus 40B]
 gi|91187768|gb|EAS74086.1| A/G-specific adenine glycosylase [Vibrio alginolyticus 12G01]
 gi|269829603|gb|EEZ83840.1| A/G-specific adenine glycosylase [Vibrio alginolyticus 40B]
          Length = 358

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 105/358 (29%), Positives = 164/358 (45%), Gaps = 23/358 (6%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
             S IL+WYD   R  LPW+ +         + Y VW+SEIMLQQT V TV PY+++F++
Sbjct: 4   FASAILEWYDAYGRKDLPWQQN--------KTAYSVWLSEIMLQQTQVTTVIPYYQRFLE 55

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A+ +E+L  W GLGYY RARNL K A  +   Y G FP  +E +  LPGI
Sbjct: 56  RFPTVIDLANAEQDEVLHLWTGLGYYARARNLHKAAQEVASTYNGEFPLDIEKMNALPGI 115

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+AI++  +     ++D N++R +SR F +            +   A   T  +  
Sbjct: 116 GRSTAAAILSSVYKQPHAILDGNVKRTLSRCFAVEGWPGQKKVENQLWEIAETHTPQTDV 175

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGK---SHLLGINTIKKKRPMRTGA 241
             + QAMMD+GA++CT +KP C LCP+   C+   +G             K  +  R   
Sbjct: 176 DKYNQAMMDMGAMVCTRSKPKCSLCPVADLCVAKQQGNVLDYPGKKPKKDKPIKQTRFVM 235

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTH-----SAPFTANWILC 296
           +     N + + L +R  T +  G+   P +     +             A         
Sbjct: 236 LHHNTENGHEVWLEQRPQTGIWGGLFCFPQTEHVDAESDIELLLDQRGIQASNIKQKQTL 295

Query: 297 NTITHTFTHFTLTLFVWKTIVPQ----IVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            T  HTF+H+ L +      + +    I+      W++        L   +K  L   
Sbjct: 296 ITFRHTFSHYHLDITPILIDLSKQPDVIMEGNKGLWYNLSKPEEVGLAAPVKLLLETL 353


>gi|238754620|ref|ZP_04615974.1| A/G-specific adenine glycosylase [Yersinia ruckeri ATCC 29473]
 gi|238707251|gb|EEP99614.1| A/G-specific adenine glycosylase [Yersinia ruckeri ATCC 29473]
          Length = 366

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 108/359 (30%), Positives = 169/359 (47%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                    +LDWY    R  LPW+           +PY+VW+SE+MLQQT V TV PYF
Sbjct: 2   MQAQQFAQVVLDWYQRYGRKTLPWQQD--------KTPYQVWLSEVMLQQTQVATVIPYF 53

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++F+ ++P +  L++A  +EIL  W GLGYY RARNL K A  IV K++G FP   + + 
Sbjct: 54  QRFLARFPDVRILAAAPLDEILHLWTGLGYYARARNLHKAAQTIVAKHQGEFPTTFDEIA 113

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPGIG  TA AI+++A      ++D N++R+++R + +            +   + ++T
Sbjct: 114 DLPGIGRSTAGAILSLALGQHFPILDGNVKRVLARCYAVDGWPGKKEVEKRLWQLSEEVT 173

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                G F QAMMDLGA++CT +KP C LCP+   C+ ++             K+     
Sbjct: 174 PAKGVGQFNQAMMDLGAMVCTRSKPKCELCPLNTGCIAYANHSWSQYPGKK-PKQTIPEK 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
            A F+ I ND ++ L +R    L  G+   P  +        +     P   N       
Sbjct: 233 TAYFLLIQNDTQVWLEQRPPVGLWGGLFCFPQFSEREDLSRWLQQRGMP-EKNLQQLTAF 291

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +         +    D     W++     +  +   +++ L     + P
Sbjct: 292 RHTFSHFHLDIVPMWLNAATLSGCMDEGAGLWYNLAQPPSVGVAAPVERLLQQLTKQPP 350


>gi|229507090|ref|ZP_04396596.1| A/G-specific adenine glycosylase [Vibrio cholerae BX 330286]
 gi|229509074|ref|ZP_04398562.1| A/G-specific adenine glycosylase [Vibrio cholerae B33]
 gi|229606254|ref|YP_002876902.1| A/G-specific adenine glycosylase [Vibrio cholerae MJ-1236]
 gi|229353999|gb|EEO18933.1| A/G-specific adenine glycosylase [Vibrio cholerae B33]
 gi|229355835|gb|EEO20755.1| A/G-specific adenine glycosylase [Vibrio cholerae BX 330286]
 gi|229368909|gb|ACQ59332.1| A/G-specific adenine glycosylase [Vibrio cholerae MJ-1236]
          Length = 378

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 104/348 (29%), Positives = 170/348 (48%), Gaps = 17/348 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
               IL WYD   R  LPW+ +         + Y+VW+SEIMLQQT V TV PYF++F++
Sbjct: 29  FAQAILTWYDAYGRKNLPWQQN--------KNAYRVWLSEIMLQQTQVATVIPYFERFLE 80

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A  +E+L  W GLGYY RARNL K A ++V +Y G FP  +E +  LPG+
Sbjct: 81  RFPTVHALAAAPQDEVLHFWTGLGYYARARNLHKAAQMVVSEYGGEFPTDLEQMNALPGV 140

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++  +     ++D N++R ++R F +            + +YA   T     
Sbjct: 141 GRSTAAAVLSSVYKKPHAILDGNVKRTLARCFAVEGWPGQKSVENQLWHYAEMHTPKVDV 200

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA+ICT +KP C LCP++  CL   +G          K  +       F+
Sbjct: 201 DKYNQAMMDMGAMICTRSKPKCSLCPVESFCLAKQQGNPQEYPGKKPKTDK-PVKATWFV 259

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSA-PFTANWILCNTITHTF 303
            + +DN + L +R  + +  G+   P S  ++ +              +        HTF
Sbjct: 260 MLYHDNAVWLEQRPQSGIWGGLYCFPQSEIANIQTTIDQRAIGDSTITSQKTLIAFRHTF 319

Query: 304 THFTLTLFVWKTIVPQIV----IIPDSTWHDAQNLANAALPTVMKKAL 347
           +H+ L +      + +            W++  +     L   +K+ L
Sbjct: 320 SHYHLDITPILLQLSRKPDIVMEGSKGLWYNLSHPDEIGLAAPVKQLL 367


>gi|227327693|ref|ZP_03831717.1| adenine DNA glycosylase [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 368

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 103/362 (28%), Positives = 169/362 (46%), Gaps = 21/362 (5%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                   ++LDWY    R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 2   MQAQQFAHQVLDWYQRYGRKTLPWQ--------LEKTPYKVWLSEVMLQQTQVTTVIPYF 53

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM+++P +  L++A  +E+L  W GLGYY RARNL K A  IV ++ G FP   + + 
Sbjct: 54  QRFMERFPNVSALAAAPLDEVLHLWTGLGYYARARNLHKAAQTIVSRHGGEFPTTFDEVA 113

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLY--HKTIKNYARKIT 179
            LPG+G  TA A++++A      ++D N++R+++R + +          K +   +  +T
Sbjct: 114 ALPGVGRSTAGAVLSLALGQHYPILDGNVKRVLARCYAVDGWPGKKDVEKKLWARSEDVT 173

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT ++P C LCP+   C+ ++            K+  P +T
Sbjct: 174 PAEGVSQFNQAMMDLGAIVCTRSRPKCELCPLSTGCIAYANHSWAQYPGKKPKQTLPEKT 233

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +     +++ L++R    L  G+   P  +     +  +            L    
Sbjct: 234 GWFLLM-QQGSQVWLQQRPAVGLWGGLFCFPQFSERRELELWLQQRGLNPDGLQQLV-AF 291

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD--------STWHDAQNLANAALPTVMKKALSAGG 351
            HTF+HF L +      V Q     +          W++     +  L   +++ L    
Sbjct: 292 RHTFSHFHLDIVPLWLDVSQTDRSQNRSCMDDGAGLWYNLAQPPSVGLAAPVERLLRELA 351

Query: 352 IK 353
             
Sbjct: 352 HP 353


>gi|56418998|ref|YP_146316.1| adenine glycosylase [Geobacillus kaustophilus HTA426]
 gi|56378840|dbj|BAD74748.1| adenine glycosylase [Geobacillus kaustophilus HTA426]
          Length = 366

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 111/351 (31%), Positives = 169/351 (48%), Gaps = 16/351 (4%)

Query: 4   PEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKK 63
           P    Q  +LDW+    R LPWR            PYKVW+SE+MLQQT V+TV PYF++
Sbjct: 9   PAREFQRDLLDWFARERRDLPWRK--------GRDPYKVWVSEVMLQQTRVETVIPYFEQ 60

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           F+ ++PT+  L+ A ++E+L AW GLGYY+R RNL      +  +Y G  P   +   +L
Sbjct: 61  FIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRL 120

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITST 181
            G+G YT  A++++A+      VD N+ R++SR F +      P   K  +   R+I + 
Sbjct: 121 KGVGPYTVGAVLSLAYGVPEPAVDGNVMRVLSRLFLVTDDIAKPSTRKRFEQIVREIMAY 180

Query: 182 SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGA 241
             PG F +A+++LGAL+CT  +P C LCP+Q  C  F+EG +  L + T K        A
Sbjct: 181 ENPGAFNEALIELGALVCTPRRPSCLLCPVQVYCQAFAEGVAEELPVKTKKTAVKQVPLA 240

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAWS-----STKDGNIDTHSAPFTANWILC 296
           V +   ++ R+L+RKR NT LL  + E P             +  +              
Sbjct: 241 VTVLADDEGRVLIRKRDNTGLLANLWEFPSCETDGADGKEKLEQMVGEQYGLQVELTEPI 300

Query: 297 NTITHTFTHFTLTLFVWKTIVPQIVIIPD-STWHDAQNLANAALPTVMKKA 346
            +  H F+H    L V+   +       +         L   A P   ++ 
Sbjct: 301 VSFEHAFSHLVWQLTVFPGRLISSESTKEPFRLVSEDELEAYAFPVSHQRV 351


>gi|146293794|ref|YP_001184218.1| A/G-specific adenine glycosylase [Shewanella putrefaciens CN-32]
 gi|145565484|gb|ABP76419.1| A/G-specific DNA-adenine glycosylase [Shewanella putrefaciens
           CN-32]
          Length = 362

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 108/363 (29%), Positives = 171/363 (47%), Gaps = 23/363 (6%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M        ++I+ WYD + R  LPW+           +PY+VW+SEIMLQQT V TV P
Sbjct: 1   MKSTAS-FATRIVSWYDNHGRKTLPWQQD--------KTPYRVWVSEIMLQQTQVATVIP 51

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           Y+ KFM ++P +  L++A D+E+L  W GLGYY RARNL K A +I   Y+G FP   E 
Sbjct: 52  YYLKFMARFPDVLALANAPDDEVLHHWNGLGYYARARNLHKAAKMIRDDYQGLFPTDFEQ 111

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARK 177
           +  LPGIG  TA A+++++      ++D N++R+++R+  I          + +      
Sbjct: 112 VLALPGIGRSTAGAVLSLSLGQHHPILDGNVKRVLARHGAIAGWPGQKTVEEQLWQLTDT 171

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T       + QAMMD+GA ICT +KP C +CP+  +C     G+          KK   
Sbjct: 172 LTPQQDIQKYNQAMMDIGASICTRSKPNCAVCPVAIDCKAQLIGRQTDFPG-KKPKKTIP 230

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
              A  + +  DN++ L KR    +  G+   P  A     + ++               
Sbjct: 231 TKAAWMLVLMQDNQVFLAKRPPAGIWGGLWCFPEFATQDALETHL-EEQGFDAQQLEWLT 289

Query: 298 TITHTFTHFTLTLFVWKTIVPQ---------IVIIPDSTWHDAQNLANAALPTVMKKALS 348
              HTF+HF L +      + Q         ++    S W++  + +   L    ++ L+
Sbjct: 290 GFRHTFSHFHLDIQPMMLNLDQTQNNSQMMGVMEQNQSLWYNISHPSRVGLAAATERVLA 349

Query: 349 AGG 351
             G
Sbjct: 350 NLG 352


>gi|330967497|gb|EGH67757.1| A/G-specific adenine glycosylase [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 355

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 123/355 (34%), Positives = 179/355 (50%), Gaps = 15/355 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  S +LDWYD + R  LPW+           +PY+VW+SEIMLQQT V TV  YF
Sbjct: 1   MQPEQFSSAVLDWYDRHGRHDLPWQQ--------GITPYRVWVSEIMLQQTQVSTVLNYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FM+  PT+  L+ A ++E+L  W GLGYYTRARNL+K A I+V  ++G FP  VE L 
Sbjct: 53  DRFMEALPTVQALAEAPEDEVLHLWTGLGYYTRARNLQKTAKIVVADHDGEFPRDVEKLI 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPGIG  TA AI +++    A ++D N++R+++R+         P   K +   A + T
Sbjct: 113 LLPGIGLSTAGAIASLSMGLRAPILDGNVKRVLARFTAQEGYPGEPKVAKQLWATAERFT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             SR  ++ QAMMDLGA +CT +KP C LCP+++ C     G      I   +K  P + 
Sbjct: 173 PHSRVNNYTQAMMDLGATLCTRSKPSCLLCPLERACQAHMLGLETRYPIPKPRKTVPQKR 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +    D  ILL +R ++ L  G+  LP              H+     +  L   +
Sbjct: 233 TLMPMLANEDGAILLYRRPSSGLWGGLWSLPELDDFDDLQHLATQHALQLGEHHELPG-L 291

Query: 300 THTFTHFTLTLFVWKTIVPQI---VIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
            HTF+HF L++  W   V +    +   D  W++        L   +KK L    
Sbjct: 292 VHTFSHFQLSIEPWLVKVQEAADHMAEADWLWYNLATPPRLGLAAPVKKLLKRAA 346


>gi|86608236|ref|YP_476998.1| A/G-specific adenine glycosylase [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86556778|gb|ABD01735.1| A/G-specific adenine glycosylase [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 358

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 100/353 (28%), Positives = 161/353 (45%), Gaps = 19/353 (5%)

Query: 8   IQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQK 67
           ++  +  WY  + R LPWR +          PY +W+SE+MLQQT V TV PYF+++MQ 
Sbjct: 1   MRQSLQRWYREHGRDLPWRRT--------RDPYAIWVSEVMLQQTQVATVIPYFQRWMQT 52

Query: 68  WPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIG 127
            P I  L++A  +++L  W GLGYY RA NL K A I++++  G FP  +E +  LPGIG
Sbjct: 53  LPGIPALAAAPQQQVLKLWEGLGYYRRALNLHKAAQILMRERNGEFPRDLEQVLALPGIG 112

Query: 128 DYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDF 187
             TA  I++ AF+    ++D N++R+++R   + +P       +   ++++    +P  F
Sbjct: 113 RTTAGGILSAAFDQPLPILDGNVKRVLARLVALQQPPSQCLPLLWQLSQQLLDPVQPRAF 172

Query: 188 VQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAIT 247
            QA+MDLGA +C   KP C  CP Q    +      H     +  +            + 
Sbjct: 173 NQALMDLGATVCRPKKPHCGRCPWQA-DCSAYNRGQHQQLPMSAPRASRPHKQIAVAIVL 231

Query: 248 NDNRILLRKRTNTRLLEGMDELPGSAWSSTKDG------NIDTHSAPFTANWILCNTITH 301
               IL+ +R  + +L G+ E PG      +         +               T+ H
Sbjct: 232 RGKEILIDRRLESSMLSGLWEFPGGKIEPGETAAECVVREVKEEIGIDIEVVAPLATVEH 291

Query: 302 TFTHFTLTLFVWKTI----VPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            +THFT+TL  +         Q +   +  W     L+    P   +K     
Sbjct: 292 VYTHFTVTLIAFICRYLGGEAQALQCSEVRWVSPAELSEFPFPGANQKLFPHL 344


>gi|330939279|gb|EGH42678.1| A/G-specific adenine glycosylase [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 355

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 124/355 (34%), Positives = 179/355 (50%), Gaps = 15/355 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  S +LDWYD + R  LPW+           +PY+VW+SEIMLQQT V TV  YF
Sbjct: 1   MQPEQFSSAVLDWYDRHGRHDLPWQQD--------ITPYRVWVSEIMLQQTQVSTVLSYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FM+  P++  L+ A ++E+L  W GLGYYTRARNL+K A I+V  + G FP  VE L 
Sbjct: 53  DRFMEALPSVQALADAPEDEVLHLWTGLGYYTRARNLQKTAKIVVADHGGEFPRNVEKLI 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPGIG  TA AI +++    A ++D N++R+++R+         P   K +   A + T
Sbjct: 113 LLPGIGLSTAGAIASLSMGIRAPILDGNVKRVLARFTAQEGYPGEPKVAKQLWATAERFT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             SR  ++ QAMMDLGA +CT +KP C LCP++++C     G      I   +K  P + 
Sbjct: 173 PHSRVNNYTQAMMDLGATLCTRSKPSCLLCPLERSCEAHMLGLETRYPIPKPRKTVPQKR 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +    D  ILL +R ++ L  G+  LP              H+     +  L   I
Sbjct: 233 TLMPMLANEDGAILLYRRPSSGLWGGLWSLPELDDFDDLQHLATQHALQLGEHHELPGLI 292

Query: 300 THTFTHFTLTLFVWKTIVPQI---VIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
            HTF+HF L++  W   V +    V   D  W++        L   +KK L    
Sbjct: 293 -HTFSHFQLSIEPWLVKVRESADHVAEADWLWYNLATPPRLGLAAPVKKLLKHAA 346


>gi|217968884|ref|YP_002354118.1| A/G-specific adenine glycosylase [Thauera sp. MZ1T]
 gi|217506211|gb|ACK53222.1| A/G-specific adenine glycosylase [Thauera sp. MZ1T]
          Length = 359

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 110/357 (30%), Positives = 169/357 (47%), Gaps = 18/357 (5%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
                ++++W   + R  LPW+            PY++W+SEIMLQQT V+TV PY+++F
Sbjct: 2   SDFSIRLIEWQRKHGRHDLPWQ--------GGHDPYRIWLSEIMLQQTRVETVIPYYERF 53

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           + ++P +  L++A  E++++ W+GLGYY RARNL + A +++  + G FP     +  LP
Sbjct: 54  LARFPDVAALAAAPVEDVMALWSGLGYYARARNLHRAARVVMDAHGGAFPRSAAAIAGLP 113

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTS 182
           GIG  TA+AI A A+   A ++D N++R++ R F I            +   A  +    
Sbjct: 114 GIGRSTAAAIAAFAWGERAAILDGNVKRVLCRVFGIEGFPGDKAVETRLWALAESLLPER 173

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
             G ++QA MDLGA +CT  +P C  CP   +C+   +G+   L      KK   R GA 
Sbjct: 174 GIGRYIQAQMDLGATLCTRARPACARCPFHDDCVARRDGRVAALPT-ARPKKVVPRRGAR 232

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWS-STKDGNIDTHSAPFTANWILCNTITH 301
              I +   +LL +R    +  G+  LP                    TA       +TH
Sbjct: 233 CAVILHQGAVLLERRPPAGIWGGLLALPELPAEVDDAQAWSAQRFGLATAAPRPLAPLTH 292

Query: 302 TFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIKVP 355
            FTHF L L         I  + D     W      A AALP  +++ L   G+  P
Sbjct: 293 AFTHFVLELQPLLLHASAIQGLADDGALCWLPLGAHAEAALPAPVRRILD--GLAAP 347


>gi|160876302|ref|YP_001555618.1| A/G-specific adenine glycosylase [Shewanella baltica OS195]
 gi|160861824|gb|ABX50358.1| A/G-specific adenine glycosylase [Shewanella baltica OS195]
 gi|315268491|gb|ADT95344.1| A/G-specific adenine glycosylase [Shewanella baltica OS678]
          Length = 363

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 107/364 (29%), Positives = 167/364 (45%), Gaps = 24/364 (6%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M        ++I+ WYD + R  LPW+           +PY VW+SEIMLQQT V TV P
Sbjct: 1   MKSTAS-FATRIVSWYDNHGRKTLPWQQD--------KTPYSVWVSEIMLQQTQVATVIP 51

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           Y+ KFM ++P +  L++A D+E+L  W GLGYY RARNL K A +I   Y+G FP   E 
Sbjct: 52  YYLKFMARFPDVLALANAPDDEVLHHWTGLGYYARARNLHKAAKMIRDDYQGLFPTDFEQ 111

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARK 177
           +  LPGIG  TA A+++++      ++D N++R+++R+  I            +      
Sbjct: 112 VLALPGIGRSTAGAVLSLSLGQHHPILDGNVKRVLARHGAIAGWPGQKTVEAQLWQLTDT 171

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
            T       + QAMMD+GA ICT +KP C  CP+  +C     G+          KK   
Sbjct: 172 YTPQQDIQKYNQAMMDIGASICTRSKPNCAACPVAIDCKAQLIGRQTDFPG-KKPKKTIP 230

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
              A  + +  DN++ L KR    +  G+   P  A  +  + ++               
Sbjct: 231 TKAAWMLVLMQDNQVFLAKRPPAGIWGGLWCFPEFATQAALETHL-EEQGFAAQPLEWLT 289

Query: 298 TITHTFTHFTLTLFVWKTIVPQ----------IVIIPDSTWHDAQNLANAALPTVMKKAL 347
              HTF+HF L +      +            ++    S W++  + +   L    ++ L
Sbjct: 290 GFRHTFSHFHLDIQPMMLNLDNTHGNKESVGAVMEQNQSLWYNISHPSKVGLAAATERVL 349

Query: 348 SAGG 351
           +  G
Sbjct: 350 ANLG 353


>gi|92112655|ref|YP_572583.1| A/G-specific DNA-adenine glycosylase [Chromohalobacter salexigens
           DSM 3043]
 gi|91795745|gb|ABE57884.1| A/G-specific DNA-adenine glycosylase [Chromohalobacter salexigens
           DSM 3043]
          Length = 353

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 116/357 (32%), Positives = 179/357 (50%), Gaps = 16/357 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           +P      + ++  W+D + R  LPW+           +PY+VW+SEIMLQQT V TV P
Sbjct: 4   IPLTAEAFRQRLFAWFDEHGRKTLPWQFD--------KTPYRVWVSEIMLQQTQVATVIP 55

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFP-HKVE 118
           Y+++FM ++P +F L+ A  +E+L  W GLGYY RARNL K A ++V+++ G FP   VE
Sbjct: 56  YYQRFMDRFPDVFALAEAPQDEVLHLWTGLGYYARARNLHKAARVVVEEHGGEFPVDSVE 115

Query: 119 ILKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYAR 176
            L  LPGIG  TA AI++I+    A ++D N++R+++R   +      P   + +   A 
Sbjct: 116 ALSTLPGIGRSTAGAIISISTGRRAPILDGNVKRVLTRLHGVEGWPGRPAVERELWVLAE 175

Query: 177 KITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRP 236
           + T   R  D+ QAMMD+GA +CT  KP C LCP    C+  + G+      +  +K  P
Sbjct: 176 RYTPEERLPDYTQAMMDVGATLCTRGKPACLLCPFNDVCVAHARGEETRFPESKPRKTLP 235

Query: 237 MRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILC 296
            RT  + +    + R+ L++R  + L  G+  LP     +     +D    P        
Sbjct: 236 ERTTRMLVLRDPEGRVFLQQRPASGLWGGLWSLPQFDDEAALRAWLDQRF-PRAQREADG 294

Query: 297 NTITHTFTHFTLTLFVWKTIVPQIVI---IPDSTWHDAQNLANAALPTVMKKALSAG 350
              THTF+HF L +      + +           W+D Q  A+  L   +K  L   
Sbjct: 295 AAFTHTFSHFRLVITPSPARLHEPFSSVGETGELWYDVQAPASVGLAAPVKTLLDQA 351


>gi|294084665|ref|YP_003551423.1| A/G-specific adenine glycosylase [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664238|gb|ADE39339.1| A/G-specific adenine glycosylase [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 372

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 136/346 (39%), Positives = 183/346 (52%), Gaps = 14/346 (4%)

Query: 11  KILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPT 70
            +  WYD + R LPWR        +L   Y VW+SEIMLQQT V TV PYF  F ++WP 
Sbjct: 28  ALFAWYDRHGRDLPWRH----RWPALAPAYHVWLSEIMLQQTVVATVIPYFLDFTRRWPD 83

Query: 71  IFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYT 130
           +  L+SA  +++L+AWAGLGYY RARNL K A+ +  +  G FP  V  L+ LPGIG YT
Sbjct: 84  VTALASAPLDDVLAAWAGLGYYARARNLHKAANKVAFELGGIFPADVGGLRDLPGIGPYT 143

Query: 131 ASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQA 190
           A AI AIAF   + VVD NIER+++R + +  P P     I      I    RP DF QA
Sbjct: 144 AGAISAIAFGQHSTVVDGNIERVLARQYAVTTPLPAAKVEISAIYAAIRPDQRPSDFPQA 203

Query: 191 MMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDN 250
           +MD    +CT   P C  CP+  +C+   +G +    + T KK +P R G  F+A   + 
Sbjct: 204 LMDFANAVCTVKAPGCSSCPLATSCIAGRQGTAASFPVKTAKKPKPARRGIAFVAFDAEG 263

Query: 251 RILLRKRTNTRLLEGMDELPGSAWSS-TKDGNIDTHSAPFTANWILC-NTITHTFTHFTL 308
           R LL KR +  LL GM   P   W     D       APF A+W++  + + H FTHF L
Sbjct: 264 RCLLVKRPDKGLLGGMLAFPSVGWDHRAPDSVASLDDAPFAADWVILDDPVQHVFTHFAL 323

Query: 309 TLFVWKTIVPQIVIIP-----DSTWHDAQNLANAALPTVMKKALSA 349
            + V  T +   +        D+ W   +      LP++M+K L A
Sbjct: 324 DMQVAVTRLDTGISPDLPDGIDANWVTPRAAD---LPSLMRKVLKA 366


>gi|167822671|ref|ZP_02454142.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei 9]
 gi|226199503|ref|ZP_03795060.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei
           Pakistan 9]
 gi|225928384|gb|EEH24414.1| A/G-specific adenine glycosylase [Burkholderia pseudomallei
           Pakistan 9]
          Length = 368

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 102/362 (28%), Positives = 171/362 (47%), Gaps = 25/362 (6%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
                 ++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+ +F
Sbjct: 18  SAFAPTLIAWQRKHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVVPYYVRF 69

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           ++++P +  L++A  +++++ WAGLGYY+RARNL++CA  +V+++ G FP   E L +LP
Sbjct: 70  LERYPDVAALAAAPIDDVMALWAGLGYYSRARNLRRCAQAVVERHGGAFPASPEALAELP 129

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITS-- 180
           GIG  TA+AI + AF   A ++D N++R+++R F +            +   A  +    
Sbjct: 130 GIGRSTAAAIASFAFGARATILDGNVKRVLARVFGVEGFPGDKRIENEMWALAEALLPDA 189

Query: 181 --TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
              +    + Q +MDLGA +C   KP C  CP    C+    G+   L     KK  P R
Sbjct: 190 AEPTDVTAYTQGLMDLGATLCVRGKPECGRCPFAGECVAQRSGRQRELPAARPKKAVPTR 249

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
                + + + + +LL++R    +  G+  LP +   +              A  +    
Sbjct: 250 RT-WMLVLRDGDAVLLQRRPPAGIWGGLWSLPEADGDAALARRAREFGG---AALVPLAP 305

Query: 299 ITHTFTHFTLTLFVWKTIV------PQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGI 352
           +THTFTHF L +      +             ++ W     L    +P  ++K L     
Sbjct: 306 LTHTFTHFRLEIEPRLAELDGAAGGAPPAADDETAWVLLDRLDAYGVPAPVRKLLDGLSG 365

Query: 353 KV 354
            +
Sbjct: 366 PL 367


>gi|227113691|ref|ZP_03827347.1| adenine DNA glycosylase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 368

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 102/362 (28%), Positives = 168/362 (46%), Gaps = 21/362 (5%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                   ++LDWY    R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 2   MQAQQFAHQVLDWYQRYGRKTLPWQ--------LEKTPYKVWLSEVMLQQTQVTTVIPYF 53

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM+++P +  L++A  +E+L  W GLGYY RARNL K A  IV ++ G FP   + + 
Sbjct: 54  QRFMERFPNVNALAAAPLDEVLHLWTGLGYYARARNLHKAAQTIVSRHGGEFPTTFDEVA 113

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA A++++A      ++D N++R+++R + +            +   +  +T
Sbjct: 114 ALPGVGRSTAGAVLSLALGQHYPILDGNVKRVLARCYAVDGWPGKKEVEKKLWARSEDVT 173

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT ++P C LCP+   C+ ++            K+  P +T
Sbjct: 174 PAEGVSQFNQAMMDLGAMVCTRSRPKCELCPLNTGCIAYANHSWAQYPGKKPKQTLPEKT 233

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +     +++ L++R    L  G+   P  +     +  +            L    
Sbjct: 234 GWFLLM-QQGSQVWLQQRPAVGLWGGLFCFPQFSERRELELWLQQRGLNPDGLQQLV-AF 291

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD--------STWHDAQNLANAALPTVMKKALSAGG 351
            HTF+HF L +      V Q     +          W++     +  L   +++ L    
Sbjct: 292 RHTFSHFHLDIVPLWLDVSQTDRSQNQSCMDDGAGLWYNLAQPPSVGLAAPVERLLRELA 351

Query: 352 IK 353
             
Sbjct: 352 HP 353


>gi|330891675|gb|EGH24336.1| A/G-specific adenine glycosylase [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 355

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 124/355 (34%), Positives = 180/355 (50%), Gaps = 15/355 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  + +LDWYD + R  LPW+           +PY+VW+SEIMLQQT V TV  YF
Sbjct: 1   MQPEQFSNAVLDWYDRHGRHDLPWQQD--------ITPYRVWVSEIMLQQTQVSTVLNYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FM+  PT+  L+ A ++E+L  W GLGYYTRARNL+K A I+V  ++G FP  VE L 
Sbjct: 53  DRFMEALPTVQALAEAPEDEVLHLWTGLGYYTRARNLQKTAKIVVADHDGEFPRDVEKLI 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPGIG  TA AI +++    A ++D N++R+++R+         P   K +   A + T
Sbjct: 113 LLPGIGLSTAGAIASLSMGLRAPILDGNVKRVLARFTAQEGYPGEPKVAKQLWATAERFT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             SR  ++ QAMMDLGA +CT +KP C LCP++++C     G      I   +K  P + 
Sbjct: 173 PHSRVNNYTQAMMDLGATLCTRSKPSCLLCPLERSCEAHMLGLETRYPIPKPRKTVPQKR 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +    D  ILL +R ++ L  G+  LP              H+     +  L   I
Sbjct: 233 TLMPMLANEDGAILLYRRPSSGLWGGLWSLPELDDFDDLQHLATQHALQLGEHHELPGLI 292

Query: 300 THTFTHFTLTLFVWKTIVPQI---VIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
            HTF+HF L++  W   V +    V   D  W++        L   +KK L    
Sbjct: 293 -HTFSHFQLSIEPWLVKVQESADHVAEADWLWYNLAPPPRLGLAAPVKKLLKRAA 346


>gi|330980634|gb|EGH78737.1| A/G-specific adenine glycosylase [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 355

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 124/355 (34%), Positives = 179/355 (50%), Gaps = 15/355 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  S +LDWYD + R  LPW+           +PY+VW+SEIMLQQT V TV  YF
Sbjct: 1   MQPEQFSSAVLDWYDRHGRHDLPWQQD--------ITPYRVWVSEIMLQQTQVSTVLSYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FM+  P++  L+ A ++E+L  W GLGYYTRARNL+K A I+V  + G FP  VE L 
Sbjct: 53  DRFMEALPSVQALADAPEDEVLHLWTGLGYYTRARNLQKTAKIVVADHGGEFPRNVEKLI 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPGIG  TA AI +++    A ++D N++R+++R+         P   K +   A + T
Sbjct: 113 LLPGIGLSTAGAIASLSMGIRAPILDGNVKRVLARFTAQEGYPGEPKVAKQLWATAERFT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             SR  ++ QAMMDLGA +CT +KP C LCP++++C     G      I   +K  P + 
Sbjct: 173 PHSRVNNYTQAMMDLGATLCTRSKPSCLLCPLERSCEAHMLGLETRYPIPKPRKTVPQKR 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +    D  ILL +R ++ L  G+  LP              H+     +  L   I
Sbjct: 233 TLMPMLANEDGAILLYRRPSSGLWGGLWSLPELDDFDDLQHLATQHALQLGEHHELPGLI 292

Query: 300 THTFTHFTLTLFVWKTIVPQI---VIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
            HTF+HF L++  W   V +    V   D  W++        L   +KK L    
Sbjct: 293 -HTFSHFQLSIEPWLVKVRESADHVAEADWLWYNLATPPRLGLAAPVKKLLKRAA 346


>gi|329296961|ref|ZP_08254297.1| adenine DNA glycosylase [Plautia stali symbiont]
          Length = 361

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 103/360 (28%), Positives = 171/360 (47%), Gaps = 19/360 (5%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                   ++L+WY    R  LPW+           +PYKVW+SE+MLQQT V  V PYF
Sbjct: 2   MQAPQFAQQMLEWYQRFGRKTLPWQ--------LEKTPYKVWLSEVMLQQTQVAAVIPYF 53

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +V+ + G FP   + + 
Sbjct: 54  ERFMARFPTVADLAAAPLDEVLHLWTGLGYYARARNLHKAAKQVVELHGGVFPPHFDDVA 113

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            +   +  +T
Sbjct: 114 ALPGVGRSTAGAILSLSLGLHFPILDGNVKRVLARCYAVSGWPGKKEVEKRLWQISEDVT 173

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGAL+CT + P C +CP+   C  +++G         +K   P R+
Sbjct: 174 PAEGVSQFNQAMMDLGALVCTRSSPKCDICPLNSGCEAYAQGNWADYPGKKLKVTLPERS 233

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G  F+ + + + + L +R    L  G+   P           +        A      T 
Sbjct: 234 G-WFLMLQHGDEVFLEQRPPVGLWGGLFCFPQFTSEQALTDWLAARG--IHAKPQQLTTF 290

Query: 300 THTFTHFTLTLFVWKTIVP---QIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVPQ 356
            HTF+HF L +       P    ++      W++     +  L   +++ L    ++ P+
Sbjct: 291 RHTFSHFHLDIVPIWLAWPSSGSLMDEAGGLWYNLAQPPSVGLAAPVERLL--HELRHPR 348


>gi|186896658|ref|YP_001873770.1| adenine DNA glycosylase [Yersinia pseudotuberculosis PB1/+]
 gi|186699684|gb|ACC90313.1| A/G-specific adenine glycosylase [Yersinia pseudotuberculosis
           PB1/+]
          Length = 419

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 106/353 (30%), Positives = 170/353 (48%), Gaps = 16/353 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           +          +LDWY    R  LPW+           +PY+VW+SE+MLQQT V TV P
Sbjct: 47  LMMQAQQFAHVVLDWYQRFGRKTLPWQ--------LDKTPYQVWLSEVMLQQTQVATVIP 98

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF++FM ++P I  L++A  +E+L  W GLGYY RARNL K A ++V+ ++G FP   + 
Sbjct: 99  YFQRFMLRFPDIQALAAAPLDEVLHLWTGLGYYARARNLHKAAQMVVEHHQGEFPTTFDQ 158

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARK 177
           +  LPGIG  TA AI++++      ++D N++R+++R + +            +   +  
Sbjct: 159 ILALPGIGRSTAGAILSLSLGQHFPILDGNVKRVLARCYAVDGWPGKKEVEGRLWQISED 218

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T  +R G F QAMMDLGA++CT +KP C LCP+   C+ ++            K+  P 
Sbjct: 219 VTPANRVGQFNQAMMDLGAMVCTRSKPKCELCPLNIGCMAYANHSWARYPGKKPKQTLPE 278

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
              A F+ + N +++ L +R    L  G+   P  A        +     P         
Sbjct: 279 -KTAWFLLMQNGSQVWLEQRPPVGLWGGLFCFPQFAEQEELIHWLQKQGIPANETQQ-LT 336

Query: 298 TITHTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKAL 347
              HTF+HF L +         +    D     W++     +  L   +++ L
Sbjct: 337 AFRHTFSHFHLDIVPIWLNTASVRGCMDDGAGLWYNLAQPPSVGLAAPVERLL 389


>gi|254465995|ref|ZP_05079406.1| A/G-specific adenine glycosylase [Rhodobacterales bacterium Y4I]
 gi|206686903|gb|EDZ47385.1| A/G-specific adenine glycosylase [Rhodobacterales bacterium Y4I]
          Length = 354

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 147/351 (41%), Positives = 198/351 (56%), Gaps = 8/351 (2%)

Query: 1   MPQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTVEP 59
           +      +  ++L WYD + R +PWR SP    + +   PYKVW+SE+MLQQTTV  V  
Sbjct: 4   LNSNAAEMSGELLAWYDIHAREMPWRVSPAERATGIRPDPYKVWLSEVMLQQTTVAAVRE 63

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF +F+ +WPT+  L++A+D +++S WAGLGYY RARNL KCA  +  + EG FP   E 
Sbjct: 64  YFLRFISRWPTVLDLAAAEDADVMSEWAGLGYYARARNLLKCARTVADEREGVFPDSYEG 123

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKIT 179
           L KLPGIG YTA+AI +IAF+    V+D N+ER++SR  DI  P P     +K  A ++T
Sbjct: 124 LLKLPGIGPYTAAAISSIAFDRPETVLDGNVERVMSRLHDIHDPLPDVKPVLKERAAELT 183

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              RPGD+ QA+MDLGA ICT   P C +CP +  C     G +  L   T KK +P R 
Sbjct: 184 PARRPGDYAQAVMDLGATICTPRSPACGICPWRAPCAARVAGTAAELPKKTPKKPKPTRY 243

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILC-NT 298
           G V++A +     LL +R +  LL GM   PGS W+          + PF A+W      
Sbjct: 244 GIVYLAESAAGTWLLERRPDKGLLGGMLGWPGSEWNEA-----PAPNPPFAADWQDLGGE 298

Query: 299 ITHTFTHFTLTLFVWKTIVPQIVII-PDSTWHDAQNLANAALPTVMKKALS 348
           + HTFTHF L L V    +P+     P            A+LPTVM+KA  
Sbjct: 299 VRHTFTHFHLILQVMTAELPEGFNPDPAQELIPRHGFRPASLPTVMRKAFD 349


>gi|269960454|ref|ZP_06174827.1| A/G-specific adenine glycosylase [Vibrio harveyi 1DA3]
 gi|269834881|gb|EEZ88967.1| A/G-specific adenine glycosylase [Vibrio harveyi 1DA3]
          Length = 358

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 107/358 (29%), Positives = 171/358 (47%), Gaps = 23/358 (6%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
             S IL+WYD   R  LPW+ +         + Y VW+SEIMLQQT V TV PY+++F++
Sbjct: 4   FASAILEWYDAYGRKDLPWQQN--------KTAYSVWLSEIMLQQTQVTTVIPYYQRFLE 55

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A+ +E+L  W GLGYY RARNL K A  +  KY G FP  +E +  LPGI
Sbjct: 56  RFPTVVDLANAEQDEVLHLWTGLGYYARARNLHKAAKEVAHKYNGEFPLDLEQMNALPGI 115

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++  +     ++D N++R +SR F +            +   A   T  +  
Sbjct: 116 GRSTAAAVLSSVYKQPHAILDGNVKRTLSRCFAVDGWPGQKKVENQLWEIAETHTPQTDV 175

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA++CT +KP C LCP+   C+   +G          KK +P++     +
Sbjct: 176 DKYNQAMMDMGAMMCTRSKPKCTLCPVSDLCVAKKQGNVLDYPGKKPKKDKPVKQTRFVM 235

Query: 245 AITND---NRILLRKRTNTRLLEGMDELPGSAW-SSTKDGNIDTHSAPFTAN----WILC 296
               +   + + L +R  T +  G+   P +       D  +        AN        
Sbjct: 236 LHHKNGDSHEVWLEQRPQTGIWGGLFCFPQTEHIDVESDIELLLEQRGIQANDIRHQETL 295

Query: 297 NTITHTFTHFTLTLFVWKTIVPQ----IVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            T  HTF+H+ L +      + +    ++      W++        L   +K  L A 
Sbjct: 296 ITFRHTFSHYHLDITPILIDLSKQPNVVMEGNKGLWYNLSKPEEVGLAAPVKLLLEAL 353


>gi|157374358|ref|YP_001472958.1| A/G-specific adenine glycosylase [Shewanella sediminis HAW-EB3]
 gi|157316732|gb|ABV35830.1| A/G-specific adenine glycosylase [Shewanella sediminis HAW-EB3]
          Length = 370

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 109/348 (31%), Positives = 167/348 (47%), Gaps = 18/348 (5%)

Query: 12  ILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPT 70
           I+DWYD   R  LPW+           +PYKVW+SEIMLQQT V TV PY+ KFM+++P 
Sbjct: 27  IVDWYDKFGRKHLPWQID--------KTPYKVWVSEIMLQQTQVSTVIPYYLKFMERFPD 78

Query: 71  IFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYT 130
           I  L+ A  +E+L  W GLGYY RARNL K A +I  ++ G+FP   E +  LPGIG  T
Sbjct: 79  IQSLADAPQDEVLHHWTGLGYYARARNLHKSAQMIRDEHAGSFPTHFEQVLALPGIGRST 138

Query: 131 ASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTSRPGDFV 188
           A A+++++      ++D N++R+++R+  I            +     K+T       + 
Sbjct: 139 AGAVLSLSLAQHHPILDGNVKRVLARHGAIEGWPGKKTVENRLWELTDKLTPQQDVQKYN 198

Query: 189 QAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITN 248
           QAMMD+GA +C+ +KP C  CP+  +C     G+         KK  P R     + ++ 
Sbjct: 199 QAMMDIGASVCSRSKPACSECPVAIDCQAQLSGRQTEYPGKKPKKMTPERNA-FMLVLSK 257

Query: 249 DNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTL 308
               LL KR    +  G+   P  +     +  +  +    +A         HTF+HF L
Sbjct: 258 GGDTLLEKRPPAGIWGGLWCFPEFSSRQELEVYLVEN-GLDSAEMEDLPGFRHTFSHFHL 316

Query: 309 TLFVWKTIVPQ-----IVIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
            +      V       I+    S W++  N     L    ++ L++ G
Sbjct: 317 DITPIYIHVDDWRDNLIMEDKPSLWYNLPNPPKVGLAAATERILASLG 364


>gi|75676789|ref|YP_319210.1| A/G-specific adenine glycosylase MutY [Nitrobacter winogradskyi
           Nb-255]
 gi|74421659|gb|ABA05858.1| A/G-specific DNA-adenine glycosylase [Nitrobacter winogradskyi
           Nb-255]
          Length = 415

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 146/374 (39%), Positives = 195/374 (52%), Gaps = 40/374 (10%)

Query: 12  ILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPTI 71
           +L+WYD N R+LPWR  P         PY+VW+SEIMLQQTTVKTV PYF+KF+ +WP +
Sbjct: 25  LLEWYDRNRRLLPWRALP----GEPVDPYRVWLSEIMLQQTTVKTVGPYFEKFLARWPDV 80

Query: 72  FCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYTA 131
             ++ A  ++IL  WAGLGYY+RARNL  CA  +++ + G FP   E L+ LPGIG YTA
Sbjct: 81  AAMARASLDDILRMWAGLGYYSRARNLHACAVKVLRDHGGRFPDTEEDLRALPGIGPYTA 140

Query: 132 SAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGD----- 186
           +AI AIAFN   + VD NIER++SR F + +P P     I   A  +   SR G      
Sbjct: 141 AAIAAIAFNRRTMPVDGNIERVVSRLFAVDEPLPKAKPRIHTLAATLLGPSRSGRDGKSR 200

Query: 187 -------------------------FVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEG 221
                                      QA+MDLGA ICT  KP C LCP+  +C   + G
Sbjct: 201 AGDVKTRAGRDGKSRASDVKTRAGDIAQALMDLGAAICTPKKPSCVLCPLSDDCAARARG 260

Query: 222 KSHLLGINTIKKKRPMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGN 281
                   T KK   +R GA F+ +   + +L+R R    LL GM E+P S W + +D  
Sbjct: 261 DQETFPRKTPKKAGELRRGAAFV-VRRGSEVLVRTRPAKGLLGGMTEVPTSTWLAAQDDT 319

Query: 282 IDTHSAPFTAN----WILCNTITHTFTHFTLTLFVWKTIVPQIVIIPDS-TWHDAQNLAN 336
                AP   +          +TH FTHF L L V+   V +    P+   W     L +
Sbjct: 320 AALKQAPCLESAPRWRRKAGAVTHVFTHFPLELAVYTAAVARRTAAPEGMRWVPIARLND 379

Query: 337 AALPTVMKKALSAG 350
            ALP +M+K ++ G
Sbjct: 380 EALPNLMRKVIAHG 393


>gi|78484465|ref|YP_390390.1| A/G-specific adenine glycosylase [Thiomicrospira crunogena XCL-2]
 gi|78362751|gb|ABB40716.1| A/G-specific DNA-adenine glycosylase [Thiomicrospira crunogena
           XCL-2]
          Length = 350

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 110/350 (31%), Positives = 178/350 (50%), Gaps = 14/350 (4%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
                 +L+W+D + R  LPW+ +         +PY+VW+SEIMLQQT V+TV PY+++F
Sbjct: 5   EEFSQTLLEWFDRSGRHDLPWQQN--------KTPYRVWVSEIMLQQTQVQTVIPYYERF 56

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M+ +P++  L+ A  EE+LS W+GLGYY R RNL K A I+V + +G FP  +E +  LP
Sbjct: 57  MKAFPSVEALAQASQEEVLSHWSGLGYYARGRNLLKAAQIVVDELQGKFPQDLEGMMALP 116

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKITSTS 182
           GIG  TA A+++IA      ++D N++R++ RY  +   +        +   A ++T   
Sbjct: 117 GIGRSTAGAVLSIASQQRHPILDGNVKRVLCRYDAVESWSGEKQTEAMLWQRANELTPEQ 176

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
           R  D+ QA+MDLGA +CT +KP C  CP+QKNC  +   +         KK +P R  A+
Sbjct: 177 RFDDYTQAIMDLGATLCTRSKPKCEACPVQKNCQAWRLDRVSDFPYPKPKKAKPTRETAM 236

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDEL--PGSAWSSTKDGNIDTHSAPFTANWILCNTIT 300
            I +  + ++ L++R    +  G+  L         T   +          N I      
Sbjct: 237 MIFLNENRQLFLQQRPQKGIWGGLWSLPEMPLDPLETLIKSKVETLCDERLNLIKWPLFK 296

Query: 301 HTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           HTF+H+ L +  +       + + +  W          LP  ++K ++  
Sbjct: 297 HTFSHYHLMIHPFFLDKVSSIKM-EGEWFTVSEALTKGLPAPIRKLINQL 345


>gi|50119916|ref|YP_049083.1| adenine DNA glycosylase [Pectobacterium atrosepticum SCRI1043]
 gi|49610442|emb|CAG73887.1| A/G-specific adenine glycosylase [Pectobacterium atrosepticum
           SCRI1043]
          Length = 368

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 102/362 (28%), Positives = 168/362 (46%), Gaps = 21/362 (5%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                   ++LDWY    R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 2   MQAQQFAHQVLDWYQRYGRKTLPWQ--------LEKTPYKVWLSEVMLQQTQVTTVIPYF 53

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM+++P +  L++A  +E+L  W GLGYY RARNL K A  IV ++ G FP   + + 
Sbjct: 54  QRFMERFPNVNTLAAAPLDEVLHLWTGLGYYARARNLHKAAQAIVSRHGGKFPTTFDEVA 113

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPGIG  TA A+++++      ++D N++R+++R + +            +   +  +T
Sbjct: 114 ALPGIGRSTAGAVLSLSLGQHYPILDGNVKRVLARCYAVDGWPGKKEVEKKLWARSEDVT 173

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT ++P C LCP+   C+ ++            K+  P +T
Sbjct: 174 PAEGVSQFNQAMMDLGAMVCTRSRPKCELCPLSTGCVAYANHSWAQYPGKKPKQTLPEKT 233

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +     +++ L++R    L  G+   P  +     +  +            L    
Sbjct: 234 GWFLLM-QQGSQVWLQQRPPVGLWGGLFCFPQFSERQELELWMQQRGLNPDGLQQLV-AF 291

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD--------STWHDAQNLANAALPTVMKKALSAGG 351
            HTF+HF L +      V Q     +          W++     +  L   +++ L    
Sbjct: 292 RHTFSHFHLDIVPLWLNVSQTDRSQNRSCMDDGAGLWYNLAQPPSVGLAAPVERLLRELA 351

Query: 352 IK 353
             
Sbjct: 352 HP 353


>gi|46201025|ref|ZP_00207933.1| COG1194: A/G-specific DNA glycosylase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 351

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 141/347 (40%), Positives = 189/347 (54%), Gaps = 8/347 (2%)

Query: 3   QPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFK 62
                + + +L WYD + R+LPWR  P          Y VW+SE+MLQQTTV  V PYF+
Sbjct: 1   MRPADLSAILLAWYDRDRRILPWRYGPGETA----DAYHVWLSEVMLQQTTVAAVIPYFQ 56

Query: 63  KFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKK 122
            F ++WP +  L++A  +E+++AWAGLGYY RARNL  CA ++ +   G FP     L++
Sbjct: 57  TFTRRWPRVEDLAAAPVDEVMTAWAGLGYYARARNLHACAKLVAEWRGGRFPDDEAGLRQ 116

Query: 123 LPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTS 182
           LPGIGDYTA+AI AIAF   AVVVD N+ER+++R F + +P P     IK  A  +T   
Sbjct: 117 LPGIGDYTAAAIAAIAFGRRAVVVDGNVERVMARMFAVTEPLPAAKPRIKELAATLTPDL 176

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
           R GD+ QA+MDLGA ICT   P C LCP +  C   ++G +  L     K +RP R G V
Sbjct: 177 RAGDYAQAVMDLGATICTPRGPACGLCPWRPTCQAQAQGIAETLPAKLAKAERPTRRGVV 236

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSS---TKDGNIDTHSAPFTANWILCNTI 299
           F     D  +LLR+R    LL GM E P + W     + D        P  +  +L   +
Sbjct: 237 FWLTAPDGSVLLRRRPPKGLLGGMMEFPSTDWREAAWSLDEAAPASPLPAKSWKLLPGVV 296

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKA 346
            H+FTHF L L V          +    W     L   ALPT+M+K 
Sbjct: 297 AHSFTHFHLELTVAAGRASAQAAV-RGVWCPLDRLEEQALPTLMRKV 342


>gi|170744952|ref|YP_001773607.1| A/G-specific adenine glycosylase [Methylobacterium sp. 4-46]
 gi|168199226|gb|ACA21173.1| A/G-specific adenine glycosylase [Methylobacterium sp. 4-46]
          Length = 405

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 147/345 (42%), Positives = 196/345 (56%), Gaps = 9/345 (2%)

Query: 9   QSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKW 68
            + +L WYD + R LPWR +P +    +P PY+VW+SEIMLQQTTV  V+PYF +F++++
Sbjct: 13  AADLLVWYDRHRRTLPWRAAPGS----VPDPYRVWLSEIMLQQTTVAAVKPYFARFLERF 68

Query: 69  PTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGD 128
           PT+  L++A +E ++SAWAGLGYY+RARNL  CA  +       FP  VE L++LPGIG 
Sbjct: 69  PTVAALAAAPEEAVMSAWAGLGYYSRARNLHACAKAVAAAGG--FPDTVEGLRRLPGIGA 126

Query: 129 YTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFV 188
           YTA AI AIAF+  A  VD N+ER++SR F I  P P     I+  A  +   +RPGDF 
Sbjct: 127 YTAGAIAAIAFDRPAAAVDGNVERVVSRLFAIETPLPAARAEIRALAESLVPRTRPGDFA 186

Query: 189 QAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAIT- 247
           QA+MDLGA +CT  +P C LCP    C   +EG          ++   +R GA F+A+  
Sbjct: 187 QAVMDLGATLCTPKRPACALCPWMAPCRARAEGLQESFPRKVRREPGLLRRGAAFVAVRA 246

Query: 248 NDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILC-NTITHTFTHF 306
            D  +LLR R    LL  M E P SAW+   D       AP  A W      + HTFTHF
Sbjct: 247 GDEAVLLRTRPPEGLLGSMAEPPTSAWTPDYDPAHGLLDAPLDARWKRLPGVVRHTFTHF 306

Query: 307 TLTLFVWKTIVPQIVIIPDS-TWHDAQNLANAALPTVMKKALSAG 350
            L L V+   V      P+   +     LA+  LP  M+K L+  
Sbjct: 307 PLELTVFLARVAARTEAPEGMRFTPRDALADEPLPGAMRKVLAHA 351


>gi|297539910|ref|YP_003675679.1| A/G-specific adenine glycosylase [Methylotenera sp. 301]
 gi|297259257|gb|ADI31102.1| A/G-specific adenine glycosylase [Methylotenera sp. 301]
          Length = 350

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 110/348 (31%), Positives = 176/348 (50%), Gaps = 15/348 (4%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               ++++ W   + R  LPW+ +          PY +W+SEIMLQQT V  V  Y+ KF
Sbjct: 2   SDFANRLIAWQKIHGRHDLPWQNTV--------DPYAIWVSEIMLQQTQVAAVIGYYSKF 53

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           MQ++P I  L++A  +E+L  W+GLGYY+RARNL   A  I+ +++G FP   E+++ L 
Sbjct: 54  MQRFPNIASLANATQDEVLQHWSGLGYYSRARNLHNAAVTIMDEHKGQFPQDFEMIQTLS 113

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTS 182
           GIG  TA+AI + AFN    ++D N++R+++R+F +      P   K +   A K+    
Sbjct: 114 GIGRSTAAAIASFAFNQVQTILDGNVKRVLARHFLVEGWPSSPKVEKELWLLAEKLLPEQ 173

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
               + Q +MDLGA +CT +KP C  CP+  +C      + H L     +K  P +    
Sbjct: 174 GMVAYTQGLMDLGATLCTRSKPKCSNCPLNGSCKALQAQRVHELPTPKPRKSIPEKHT-T 232

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHT 302
            + +   + ILL KR +T +  G+   P +  S   +            N I    +TH 
Sbjct: 233 MLILRRGDEILLEKRPSTGIWGGLWSFPEAENSQDAEAIALKKFGVTAENDITLPNLTHV 292

Query: 303 FTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKAL 347
           FTHF L +      V ++    +     W + ++   AA+PT ++K L
Sbjct: 293 FTHFKLHICPQTLQVVKLNPQVNQAAHMWLNIEDAIGAAIPTPIRKIL 340


>gi|330970723|gb|EGH70789.1| A/G-specific adenine glycosylase [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 355

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 125/355 (35%), Positives = 180/355 (50%), Gaps = 15/355 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  S +LDWYD + R  LPW+           +PY+VW+SEIMLQQT V TV  YF
Sbjct: 1   MQPEQFSSAVLDWYDRHGRHDLPWQQD--------ITPYRVWVSEIMLQQTQVSTVLSYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FM+  PT+  L+ A ++E+L  W GLGYYTRARNL+K A I+V ++ G FP  VE L 
Sbjct: 53  DRFMEALPTVQVLAEAPEDEVLHLWTGLGYYTRARNLQKTAKIVVAEHGGEFPRDVEKLI 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPGIG  TA AI +++    A ++D N++R+++R+         P   K +   A + T
Sbjct: 113 LLPGIGLSTAGAIASLSMGIRAPILDGNVKRVLARFTAQEGYPGEPKVAKQLWATAERFT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             SR  ++ QAMMDLGA +CT +KP C LCP++++C     G      I   +K  P + 
Sbjct: 173 PHSRVNNYTQAMMDLGATLCTRSKPSCLLCPLERSCEAHMLGLETRYPIPKPRKTVPQKR 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +    D  ILL +R ++ L  G+  LP              H+     +  L   I
Sbjct: 233 TLMPMLANEDGAILLYRRPSSGLWGGLWSLPELDDFDDLQHLATQHALQLGEHHELPGLI 292

Query: 300 THTFTHFTLTLFVWKTIVPQI---VIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
            HTF+HF L++  W   V +    V   D  W++        L   +KK L    
Sbjct: 293 -HTFSHFQLSIEPWLVKVRESADHVAEADWLWYNLATPPRLGLAAPVKKLLKRAA 346


>gi|149909457|ref|ZP_01898112.1| A/G-specific adenine glycosylase [Moritella sp. PE36]
 gi|149807567|gb|EDM67516.1| A/G-specific adenine glycosylase [Moritella sp. PE36]
          Length = 357

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 102/361 (28%), Positives = 173/361 (47%), Gaps = 18/361 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           +   +     ++L W+    R  LPW+            PY  W+SE+MLQQT V TV P
Sbjct: 5   LENNKDTFAPRVLAWFKDFGRKDLPWQQ--------YHEPYPTWLSEVMLQQTQVSTVIP 56

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF  FMQK+PT+  L++A  +E+L  W GLGYY R RNL K A +I  +Y+G FP + E 
Sbjct: 57  YFTTFMQKFPTVTDLANAHIDEVLHLWTGLGYYARGRNLHKAAQLIRDEYQGIFPTEFEQ 116

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARK 177
           +  LPG+G  TA A+++++ N    ++D N++R+++R+  I           T+   + +
Sbjct: 117 VLALPGVGRSTAGAVLSLSLNQPHAILDGNVKRVLTRWGAIEGWYGVKAVENTLWALSEE 176

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T   +  ++ Q MMDLGA +CT ++P C +CP+  +C   + G           KK   
Sbjct: 177 LTPQQQTANYNQVMMDLGATVCTRSRPDCDICPVNDDCKARAMGTPTAFPTPK-PKKTIP 235

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
                 + +   + + L++R  T +  G+   P    + +    +        +   L  
Sbjct: 236 VRTVQMLLLKQGSTLCLQQRPPTGIWGGLWCFPERDDTVSLAEQLAQFGISEFSTLELPG 295

Query: 298 TITHTFTHFTLTLFVWKTIV-----PQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGI 352
              HTF+HF L +      +      QI+    + W++ +  A   L    KK L++  +
Sbjct: 296 -FRHTFSHFHLDISPLLVEIIATTSTQIMESQGTLWYNIEQPATVGLAAATKKLLTSQAL 354

Query: 353 K 353
           +
Sbjct: 355 R 355


>gi|90412030|ref|ZP_01220037.1| putative A/G-specific adenine glycosylase [Photobacterium profundum
           3TCK]
 gi|90327008|gb|EAS43387.1| putative A/G-specific adenine glycosylase [Photobacterium profundum
           3TCK]
          Length = 356

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 103/357 (28%), Positives = 166/357 (46%), Gaps = 17/357 (4%)

Query: 6   HIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
           +     IL WYD   R  LPW+ +         +PYKVW+SEIMLQQT V TV PYF++F
Sbjct: 3   NTFSDAILTWYDKFGRKTLPWQQN--------KTPYKVWLSEIMLQQTQVATVIPYFERF 54

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M+++PT+  L++A+ +E+L  W GLGYY RARNL K A IIV ++   FP  +  ++ LP
Sbjct: 55  MERFPTVQDLAAAEQDEVLHLWTGLGYYARARNLHKAAKIIVSEHNALFPTDIIQVQALP 114

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTS 182
           GIG  TA A+++++      ++D N++R ++R + +            +   A K T  S
Sbjct: 115 GIGRSTAGAVLSLSLKQHHAILDGNVKRTLARCYAVEGWPGKKPVENALWEIAEKNTPDS 174

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
               + QAMMD+GA+ICT +KP C LCPI+  C   ++ +          KK        
Sbjct: 175 GVERYNQAMMDMGAMICTRSKPKCELCPIEAMCEAKAQLRQTDFPGKK-PKKVMPEKQTW 233

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHS-APFTANWILCNTITH 301
           F  + + + + L +R    +  G+   P                           +   H
Sbjct: 234 FAILQHGDEVWLEQRPPVGIWGGLWCFPQHDTDDLSALVTQRIGSESHIVEAEQLHAFRH 293

Query: 302 TFTHFTLTLFVWKTIVPQIV----IIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
           TF+H+ L +   +  +   +          W+         L   +++ L     ++
Sbjct: 294 TFSHYHLDIVPIRMRLSTPMNMVQESGKGQWYSLTTPPKVGLAAPVQQILEGLRYEL 350


>gi|320161307|ref|YP_004174531.1| A/G-specific adenine glycosylase [Anaerolinea thermophila UNI-1]
 gi|319995160|dbj|BAJ63931.1| A/G-specific adenine glycosylase [Anaerolinea thermophila UNI-1]
          Length = 364

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 122/346 (35%), Positives = 174/346 (50%), Gaps = 21/346 (6%)

Query: 7   IIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
            I  ++LDWY  + R LPWR            PY V +SEIMLQQT V+TV PY++++M+
Sbjct: 4   QISRQLLDWYQIHARNLPWRKEESA-------PYAVLVSEIMLQQTRVETVIPYYQRWME 56

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L+ A  EE+L  W GLGYY+RA+NL + A I+V+ Y G FP  VE L+KLPGI
Sbjct: 57  RFPTLESLAQASLEEVLRYWEGLGYYSRAKNLHRTAQILVQTYRGEFPQHVEHLRKLPGI 116

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDI--IKPAPLYHKTIKNYARKITSTSRP 184
           GDYTA+AI +IAF      +D N+ R++SR F I      P   K +K+ A +     + 
Sbjct: 117 GDYTAAAIASIAFGQKVAAIDGNVRRVLSRLFLISEPLSLPETQKKLKSLAVQCLPAEQV 176

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
           GD+ QA+MDLGALIC    P C  CP+   C  +   + + + +   KK  P        
Sbjct: 177 GDYNQALMDLGALICLPRSPKCLQCPLSVLCRAYQNNQQNDIPVKAKKKSLPS-VIVTAA 235

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTK------DGNIDTHSAPFTANWILCNT 298
            I   + +LL KR    LL G+ E PG      +         I               T
Sbjct: 236 IIRKGDTVLLAKRPLGSLLGGLWEFPGGKVEHDERLPECLKREILEELGVRIEVGNHFGT 295

Query: 299 ITHTFTHFTLTLFVWKT-----IVPQIVIIPDSTWHDAQNLANAAL 339
             H +THF +TL  ++       +P  +   +  W    +L    +
Sbjct: 296 YHHAYTHFKVTLHAFEAIIQDSQIPHPIEAEEIRWIPIPSLDKFPM 341


>gi|297531247|ref|YP_003672522.1| A/G-specific adenine glycosylase [Geobacillus sp. C56-T3]
 gi|297254499|gb|ADI27945.1| A/G-specific adenine glycosylase [Geobacillus sp. C56-T3]
          Length = 366

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 109/351 (31%), Positives = 170/351 (48%), Gaps = 16/351 (4%)

Query: 4   PEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKK 63
           P    Q  +LDW+    R LPWR            PYKVW+SE+MLQQT V+TV PYF++
Sbjct: 9   PAREFQRDLLDWFARERRDLPWRKD--------RDPYKVWVSEVMLQQTRVETVIPYFEQ 60

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           F+ ++PT+  L+ A ++E+L AW GLGYY+R RNL      +  +Y G  P   +   +L
Sbjct: 61  FIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRL 120

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITST 181
            G+G YT  A++++A+      VD N+ R++SR F +      P   K  +   R+I + 
Sbjct: 121 KGVGPYTVGAVLSLAYGVPEPAVDGNVMRVLSRLFLVTDDIAKPSTRKRFEQIVREIMAY 180

Query: 182 SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGA 241
             PG F +A+++LGAL+CT  +P C LCP+Q  C  F+EG +  L +   K      + A
Sbjct: 181 ENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKMKKTAVKQVSLA 240

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAWS-----STKDGNIDTHSAPFTANWILC 296
           V +   ++ R+L+RKR +T LL  + E P             +  +              
Sbjct: 241 VAVLADDEGRVLIRKRDSTGLLANLWEFPSCETDGADGKEKLEQMVGEQYGLQVELTEPI 300

Query: 297 NTITHTFTHFTLTLFVWKTIVPQIVIIPD-STWHDAQNLANAALPTVMKKA 346
            +  H F+H    L V+   +     + +         L   A P   ++ 
Sbjct: 301 VSFEHAFSHLVWQLTVFPGRLVHGGPVEEPYRLAPEDELKAYAFPVSHQRV 351


>gi|229823120|ref|ZP_04449189.1| hypothetical protein GCWU000282_00417 [Catonella morbi ATCC 51271]
 gi|229787286|gb|EEP23400.1| hypothetical protein GCWU000282_00417 [Catonella morbi ATCC 51271]
          Length = 410

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 106/364 (29%), Positives = 164/364 (45%), Gaps = 30/364 (8%)

Query: 6   HIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
           H  +  +L WYD N R LPWR S          PY +W+SEIMLQQT V TV PY+++FM
Sbjct: 44  HAFRKDLLAWYDKNKRDLPWRKS--------QDPYAIWVSEIMLQQTQVATVIPYYQRFM 95

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
              PT+  L+ A +E +L+ W GLGYY+R RN++  A  ++  + G  P +V+ L  L G
Sbjct: 96  AALPTVADLAQAPEETLLNLWQGLGYYSRVRNMQAAAQQVMADFGGRMPDQVDSLLSLKG 155

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTSR 183
           IG YTA+AI ++AF   A  +D N+ RI++R F +      P   K        +    R
Sbjct: 156 IGPYTAAAIASMAFGRVAPALDGNLFRIVARLFRLKDDIALPKSRKVFMEILDILIDPDR 215

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVF 243
           PGDF QAMMDLGA + T + P     P+     ++  G S    + + K K+       +
Sbjct: 216 PGDFNQAMMDLGACVMTPSNPRPDNHPLAAYDASYQVGDSDQYPVKSKKVKQTRHDLTAY 275

Query: 244 IAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWIL-------- 295
             + +    LLR+     LL G+   P    S   +            +W+         
Sbjct: 276 FVLDSQGNWLLRRHGEAELLTGLWHFPMLEQSMVYEEVTAAELTEPLLDWLREEALVEGD 335

Query: 296 -----------CNTITHTFTHFTLTLFVWKTIVPQIVIIPDST-WHDAQNLANAALPTVM 343
                         + H F+H    + +    +     + +   W   +++    L T+ 
Sbjct: 336 SPLSSQVVSPALGQVKHVFSHRIWQVQLVGLRLDTSGPLQEGWCWVAPEDVGQLPLSTLQ 395

Query: 344 KKAL 347
           +K +
Sbjct: 396 EKLM 399


>gi|308188051|ref|YP_003932182.1| A/G-specific adenine glycosylase [Pantoea vagans C9-1]
 gi|308058561|gb|ADO10733.1| A/G-specific adenine glycosylase [Pantoea vagans C9-1]
          Length = 360

 Score =  243 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 103/360 (28%), Positives = 170/360 (47%), Gaps = 19/360 (5%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                   ++LDWY    R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQAPQFAQQVLDWYQRFGRKTLPWQ--------LEKTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  IV+ + G FP   + + 
Sbjct: 53  ERFMARFPTVTDLAAAPLDEVLHLWTGLGYYARARNLHKAAKQIVEVHRGEFPRNFDDVS 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA A+++++      ++D N++R+++R + +            +   + ++T
Sbjct: 113 ALPGVGRSTAGAVLSLSLGQHFPILDGNVKRVLARCYAVSGWPGKKEVEKRLWQISEEVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT +KP C +CP+   C  ++            K+  P R+
Sbjct: 173 PAEGVSQFNQAMMDLGAIVCTRSKPKCEICPLNSGCEAYASSSWASYPGKKPKQVLPERS 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D+ + L +R    L  G+   P     +  +  +        A        
Sbjct: 233 GWFLMMQDGDD-VWLEQRPPVGLWGGLFCFPQFTTEAALNDWLAARG--IHAKPQQLTAF 289

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVPQ 356
            HTF+HF L +       P     +      W++     +  L   +++ L    ++ P+
Sbjct: 290 RHTFSHFHLDIVPMWLSWPSAGAAMDEAGGLWYNLALPPSVGLAAPVERLL--HELRHPR 347


>gi|205372625|ref|ZP_03225436.1| adenine glycosylase [Bacillus coahuilensis m4-4]
          Length = 366

 Score =  243 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 118/353 (33%), Positives = 179/353 (50%), Gaps = 18/353 (5%)

Query: 4   PEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKK 63
           P    Q  ++ W+    R LPWR            PYKVW+SEIMLQQT V TV PYF +
Sbjct: 13  PIESFQQDLIGWFTEEMRDLPWRKD--------QDPYKVWVSEIMLQQTRVDTVIPYFNR 64

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           F++++PTI  L++A +E++L AW GLGYY+R RNL+     + + Y G  P+  E + KL
Sbjct: 65  FIEQFPTIEALATADEEKVLKAWEGLGYYSRVRNLQAAVQEVHETYGGVVPNTPEEISKL 124

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITST 181
            G+G YT  A+++IA+      VD N+ R+ISR   I      P   K  +   R++ S 
Sbjct: 125 KGVGPYTTGAVLSIAYGVPEPAVDGNVMRVISRVLSIWDDIAKPSSRKIFEQAIRELISH 184

Query: 182 SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGA 241
             P  F QA+M+LGAL+CT   P C LCP++++C  F EG +  L + T KK       A
Sbjct: 185 KNPSYFNQALMELGALVCTPTSPSCLLCPVREHCHAFHEGVTSELPVKTKKKSTKRVRLA 244

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDT-------HSAPFTANWI 294
             I + +  +I+L KR ++ LL  + E P +  ++      D        +S       +
Sbjct: 245 SAILVDSSGKIVLHKRPSSGLLANLWEFPMAEVNAFSTPREDLVRFIQEHYSEQVELEKV 304

Query: 295 LCNTITHTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLA-NAALPTVMKKA 346
             + I H F+H    + V+   +   +    + +  A  L  + ALP   +K 
Sbjct: 305 QLDKIEHIFSHLVWEVDVFVGTISGSIKESGARFVTADELEGDYALPVSHQKM 357


>gi|171779253|ref|ZP_02920224.1| hypothetical protein STRINF_01101 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171282309|gb|EDT47736.1| hypothetical protein STRINF_01101 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 382

 Score =  243 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 114/369 (30%), Positives = 173/369 (46%), Gaps = 31/369 (8%)

Query: 3   QPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFK 62
           +     +  +L+WYD   R LPWR +         +PY +WISEIMLQQT V TV PY++
Sbjct: 15  EKIASFRRTLLNWYDNEKRDLPWRRT--------KNPYFIWISEIMLQQTQVVTVIPYYE 66

Query: 63  KFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKK 122
           +F++ +PTI  L++A ++++L AW GLGYY+R RN++K A  I+ K++G FP   + +  
Sbjct: 67  RFLKWFPTIEDLANAPEDKLLKAWEGLGYYSRVRNMQKAAQEIMVKFDGVFPDNHKDILS 126

Query: 123 LPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITS 180
           L GIG YTA AI +IAF      VD N+ R+++R F++      P   K  +     +  
Sbjct: 127 LKGIGPYTAGAISSIAFGLAEPAVDGNVMRVMARLFEVNYDIGEPKNRKIFQAIMEILID 186

Query: 181 TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG 240
             RPGDF QA+MDLG  I ++  P     PI+     +  G      I   KKK      
Sbjct: 187 PERPGDFNQALMDLGTDIESAKNPRPDESPIRFFSAAYLHGTYDKYPIKLPKKKPKPLQL 246

Query: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWS-----------STKDGNIDTHSAPF 289
             F+   N    LL K  + RLL G    P                +T      +  A F
Sbjct: 247 QAFVIRNNGGDFLLEKNLDGRLLGGFWSFPIVETDFIGQQLDLFEKNTASLKTVSQKALF 306

Query: 290 TANWILCN--------TITHTFTHFTLTLFVWK--TIVPQIVIIPDSTWHDAQNLANAAL 339
             ++ +           + HTF+H   T+ + +      ++    +  W     L +  +
Sbjct: 307 EKDYQVTPDWTKREFSPVKHTFSHQKWTIELIEGMVTSDEVSKDKELRWVSLDQLQDYPM 366

Query: 340 PTVMKKALS 348
            T  KK L+
Sbjct: 367 ATPQKKMLA 375


>gi|58039545|ref|YP_191509.1| A/G-specific adenine DNA glycosylase [Gluconobacter oxydans 621H]
 gi|58001959|gb|AAW60853.1| A/G-specific adenine DNA glycosylase [Gluconobacter oxydans 621H]
          Length = 458

 Score =  243 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 156/354 (44%), Positives = 198/354 (55%), Gaps = 13/354 (3%)

Query: 9   QSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKW 68
            S +L WYD + RVLPWR+ P       P PY VW+SEIMLQQTTVK V  Y+++F+  +
Sbjct: 110 ASALLRWYDHHRRVLPWRSLP----GHRPDPYAVWLSEIMLQQTTVKAVIAYYERFLTHY 165

Query: 69  PTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGD 128
           PT+  L++A  E++L  WAGLGYY RARNL  CA  + ++    FP  VE L  LPGIG 
Sbjct: 166 PTVQDLAAAPLEDVLHLWAGLGYYARARNLHACAKRVSERGG--FPDTVEELLTLPGIGA 223

Query: 129 YTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKN----YARKITSTSRP 184
           YTA AI AIAF    V VD N+ER+ +R   I  P P     +            + SRP
Sbjct: 224 YTARAIAAIAFGRPVVPVDGNVERVTARLNAIEDPLPASRPLLARQAALLNDDPVAQSRP 283

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
            DF QA+ DLGA ICT   P C  CP Q +C+  + G +  L     K+ RP R GA F+
Sbjct: 284 SDFAQALFDLGATICTPRSPACLTCPWQTSCIAHARGIAAQLPAKQPKQARPTRYGAHFL 343

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKD-GNIDTHSAPFTANWILCNTITHTF 303
              ND +ILLR R  T LL  MDELPG+ W ST          AP   +W+    I H F
Sbjct: 344 MHDNDGQILLRTRPPTGLLGSMDELPGTDWRSTPWTDEEALTHAPCLTHWVRRGEIRHVF 403

Query: 304 THFTLTLFVWKTIVPQIVIIP-DSTWHDAQNLANAALPTVMKKALSAGGIKVPQ 356
           THFTL L V++  +PQ      DS++   ++   AALP VMKK L A   + P+
Sbjct: 404 THFTLYLTVYEACLPQSHNAGIDSSFGTFRSAKRAALPGVMKKCL-ALTKQTPE 456


>gi|15640479|ref|NP_230106.1| A/G-specific adenine glycosylase [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121728580|ref|ZP_01681601.1| A/G-specific adenine glycosylase [Vibrio cholerae V52]
 gi|153819148|ref|ZP_01971815.1| A/G-specific adenine glycosylase [Vibrio cholerae NCTC 8457]
 gi|153823186|ref|ZP_01975853.1| A/G-specific adenine glycosylase [Vibrio cholerae B33]
 gi|227080662|ref|YP_002809213.1| A/G-specific adenine glycosylase [Vibrio cholerae M66-2]
 gi|255744301|ref|ZP_05418254.1| A/G-specific adenine glycosylase [Vibrio cholera CIRS 101]
 gi|262147274|ref|ZP_06028073.1| A/G-specific adenine glycosylase [Vibrio cholerae INDRE 91/1]
 gi|298501017|ref|ZP_07010818.1| A/G-specific adenine glycosylase [Vibrio cholerae MAK 757]
 gi|9654877|gb|AAF93625.1| A/G-specific adenine glycosylase [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121629136|gb|EAX61579.1| A/G-specific adenine glycosylase [Vibrio cholerae V52]
 gi|126510293|gb|EAZ72887.1| A/G-specific adenine glycosylase [Vibrio cholerae NCTC 8457]
 gi|126519312|gb|EAZ76535.1| A/G-specific adenine glycosylase [Vibrio cholerae B33]
 gi|227008550|gb|ACP04762.1| A/G-specific adenine glycosylase [Vibrio cholerae M66-2]
 gi|255738241|gb|EET93633.1| A/G-specific adenine glycosylase [Vibrio cholera CIRS 101]
 gi|262031268|gb|EEY49883.1| A/G-specific adenine glycosylase [Vibrio cholerae INDRE 91/1]
 gi|297540265|gb|EFH76325.1| A/G-specific adenine glycosylase [Vibrio cholerae MAK 757]
          Length = 353

 Score =  243 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 104/348 (29%), Positives = 170/348 (48%), Gaps = 17/348 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
               IL WYD   R  LPW+ +         + Y+VW+SEIMLQQT V TV PYF++F++
Sbjct: 4   FAQAILTWYDAYGRKNLPWQQN--------KNAYRVWLSEIMLQQTQVATVIPYFERFLE 55

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A  +E+L  W GLGYY RARNL K A ++V +Y G FP  +E +  LPG+
Sbjct: 56  RFPTVHALAAAPQDEVLHFWTGLGYYARARNLHKAAQMVVSEYGGEFPTDLEQMNALPGV 115

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++  +     ++D N++R ++R F +            + +YA   T     
Sbjct: 116 GRSTAAAVLSSVYKKPHAILDGNVKRTLARCFAVEGWPGQKSVENQLWHYAEMHTPKVDV 175

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA+ICT +KP C LCP++  CL   +G          K  +       F+
Sbjct: 176 DKYNQAMMDMGAMICTRSKPKCSLCPVESFCLAKQQGNPQEYPGKKPKTDK-PVKATWFV 234

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSA-PFTANWILCNTITHTF 303
            + +DN + L +R  + +  G+   P S  ++ +              +        HTF
Sbjct: 235 MLYHDNAVWLEQRPQSGIWGGLYCFPQSEIANIQTTIDQRAIGDSTITSQKTLIAFRHTF 294

Query: 304 THFTLTLFVWKTIVPQIV----IIPDSTWHDAQNLANAALPTVMKKAL 347
           +H+ L +      + +            W++  +     L   +K+ L
Sbjct: 295 SHYHLDITPILLQLSRKPDIVMEGSKGLWYNLSHPDEIGLAAPVKQLL 342


>gi|330961857|gb|EGH62117.1| A/G-specific adenine glycosylase [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 355

 Score =  243 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 124/355 (34%), Positives = 179/355 (50%), Gaps = 15/355 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  S +LDWYD + R  LPW+           +PY+VW+SEIMLQQT V TV  YF
Sbjct: 1   MQPEQFSSAVLDWYDRHGRHDLPWQQ--------GITPYRVWVSEIMLQQTQVSTVLNYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FM+  PT+  L+ A ++E+L  W GLGYYTRARNL+K A I+V  ++G FP  VE L 
Sbjct: 53  DRFMEALPTVQALAEAPEDEVLHLWTGLGYYTRARNLQKTAKIVVAYHDGEFPRDVEKLI 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPGIG  TA AI +++    A ++D N++R+++R+         P   K +   A + T
Sbjct: 113 LLPGIGLSTAGAIASLSMGLRAPILDGNVKRVLARFTAQEGYPGEPKVAKQLWATAERFT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             SR  ++ QAMMDLGA +CT +KP C LCP+++ C     G      I   +K  P + 
Sbjct: 173 PYSRVNNYTQAMMDLGATLCTRSKPSCLLCPLERGCQAHLLGLETRYPIPKPRKTVPQKR 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +    +  ILL +R ++ L  G+  LP              H+     +  L   I
Sbjct: 233 TLMPMLANREGAILLYRRPSSGLWGGLWSLPELDDFEDLKHLATQHALELGEHHELPGLI 292

Query: 300 THTFTHFTLTLFVWKTIVPQI---VIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
            HTF+HF L++  W   V +    V   D  W++        L   +KK L    
Sbjct: 293 -HTFSHFQLSIEPWLIEVQESAHHVAEADWLWYNLATPPRLGLAAPVKKLLKRAA 346


>gi|317049440|ref|YP_004117088.1| A/G-specific adenine glycosylase [Pantoea sp. At-9b]
 gi|316951057|gb|ADU70532.1| A/G-specific adenine glycosylase [Pantoea sp. At-9b]
          Length = 361

 Score =  243 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 105/360 (29%), Positives = 170/360 (47%), Gaps = 19/360 (5%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                   ++LDWY    R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 2   MQAPQFAQQVLDWYQRFGRKTLPWQQ--------EKTPYKVWLSEVMLQQTQVATVIPYF 53

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  +V K+ G FP   + + 
Sbjct: 54  ERFMARFPTVADLAAAPLDEVLHLWTGLGYYARARNLHKAAKQVVDKHAGEFPRNFDDVA 113

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            +   + ++T
Sbjct: 114 ALPGVGRSTAGAILSLSLGLHFPILDGNVKRVLARCYAVAGWPGKKEVEKRLWQISEEVT 173

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGAL+CT ++P C +CP+   C+ ++            K+  P R+
Sbjct: 174 PAQGVSQFNQAMMDLGALVCTRSRPKCEICPLNSGCVAYANTSWANYPGKKPKQTLPERS 233

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D+ + L +R    L  G+   P           +        A        
Sbjct: 234 GWFLMMQHGDD-VWLEQRPPVGLWGGLFCFPQFTTEQAMTDWLAERG--IHARPQQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVP---QIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVPQ 356
            HTF+HF L +       P    ++      W++     +  L   +++ L    ++ PQ
Sbjct: 291 RHTFSHFHLDIVPMWLAWPSSGSLMDEAGGLWYNLAQPPSVGLAAPVERLL--HELRHPQ 348


>gi|307129775|ref|YP_003881791.1| adenine DNA glycosylase [Dickeya dadantii 3937]
 gi|306527304|gb|ADM97234.1| adenine DNA glycosylase [Dickeya dadantii 3937]
          Length = 363

 Score =  243 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 103/357 (28%), Positives = 166/357 (46%), Gaps = 16/357 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                   ++L+WY+   R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 2   MQAQRFAQQVLEWYERYGRKTLPWQ--------LEKTPYKVWLSEVMLQQTQVTTVIPYF 53

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++PT+  L++A  +E+L  W GLGYY RARNL K A  IV ++ G FP + + + 
Sbjct: 54  ERFMARFPTVAELAAAPLDEVLHLWTGLGYYARARNLHKAAQTIVDRHGGEFPTRFDDIA 113

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +            +   +  +T
Sbjct: 114 DLPGVGRSTAGAILSLSLGQHYPILDGNVKRVLARCYAVAGWPGKKEVEKRLWTLSETVT 173

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT ++P C LCP+   C+ ++            K+  P   
Sbjct: 174 PAHGVEKFNQAMMDLGAMVCTRSRPKCELCPLSNGCIAYANHSWAEYPGKKPKQTLPE-K 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
            A F+ + N   + L +R    L  G+   P           +D       A        
Sbjct: 233 TAWFLLMQNGQTVWLEQRPAVGLWGGLYCFPQFPNPDDLTQWLDQRGIRRQALRQGI-AF 291

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIK 353
            HTF+HF L +      +       D     W++     +  L   +++ L      
Sbjct: 292 RHTFSHFHLDIVPMWLELSDQGSCMDEGAGLWYNLAQPPSVGLAAPVERLLRQLAQP 348


>gi|192293337|ref|YP_001993942.1| A/G-specific adenine glycosylase [Rhodopseudomonas palustris TIE-1]
 gi|192287086|gb|ACF03467.1| A/G-specific adenine glycosylase [Rhodopseudomonas palustris TIE-1]
          Length = 349

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 142/346 (41%), Positives = 186/346 (53%), Gaps = 10/346 (2%)

Query: 10  SKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWP 69
           + +L WYD + R LPWR  P         PY VW+SEIMLQQTTV+ V PYF KFM +WP
Sbjct: 6   AALLAWYDRHRRTLPWRAPPGATA----DPYAVWLSEIMLQQTTVRAVGPYFDKFMARWP 61

Query: 70  TIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDY 129
           T+  L  A  +++L  WAGLGYY+RARNL  CA  + +++ G FP   E L+ LPG+G Y
Sbjct: 62  TVTALGEASLDDVLKMWAGLGYYSRARNLHACAVAVTRQHGGRFPDTEEGLRALPGVGPY 121

Query: 130 TASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQ 189
           TA+AI AIAF+   + VD NIER++SR + +    P     IK  A  +   SR GD  Q
Sbjct: 122 TAAAIAAIAFSRRTMPVDGNIERVVSRLYAVEDELPKAKPRIKALAETLLGPSRAGDSAQ 181

Query: 190 AMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITND 249
           A+MDLGA ICT  KP C LCP+ + C     G +        KK   +R GA F+ I  D
Sbjct: 182 ALMDLGATICTPKKPACALCPLMQGCTARLRGDAESFPRKAPKKTGALRRGAAFVVIRGD 241

Query: 250 NRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTA----NWILCNTITHTFTH 305
             +L+R R    LL GM E+P S W   +D       AP              ++H FTH
Sbjct: 242 Q-VLVRSRPAKGLLGGMTEVPNSDWLPDQDEAAAKAQAPALKGVGRWHRKAGVVSHVFTH 300

Query: 306 FTLTLFVWKTIVPQIVIIPDS-TWHDAQNLANAALPTVMKKALSAG 350
           F L L V+          P    W     L++ ALP +M+K ++ G
Sbjct: 301 FPLELAVYVAHASAGTRAPTGMRWTQISTLSDEALPNLMRKVIAHG 346


>gi|311067343|ref|YP_003972266.1| YfhQ protein [Bacillus atrophaeus 1942]
 gi|310867860|gb|ADP31335.1| YfhQ [Bacillus atrophaeus 1942]
          Length = 364

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 109/353 (30%), Positives = 168/353 (47%), Gaps = 17/353 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFK 62
           +   + +  ++ W++   R+LPWR            PYKVW+SE+MLQQT V+TV PYF 
Sbjct: 11  KDIDMFRDDLITWFEREQRILPWRED--------QDPYKVWVSEVMLQQTRVETVIPYFL 62

Query: 63  KFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKK 122
           +F++++P +  L+ A +E++L AW GLGYY+R RNL+     + ++Y G  P   +    
Sbjct: 63  RFVEQFPNVEALAEADEEKVLKAWEGLGYYSRVRNLQSAVKEVQQQYGGTVPSTEKEFGG 122

Query: 123 LPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITS 180
           L G+G YT  A+++IA+N     VD N+ R++SR   I      P      +       S
Sbjct: 123 LKGVGPYTKGAVLSIAYNKPIPAVDGNVMRVMSRILSIWDDIAKPKTRTIFEQAVHAFIS 182

Query: 181 TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG 240
             +P +F Q +M+LGA+ICT   P C LCP+QK+C  F+EG    L + + KKK  ++T 
Sbjct: 183 KEKPSEFNQGLMELGAIICTPKSPSCLLCPVQKHCSAFAEGSERELPVKSKKKKPGIKTM 242

Query: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANW------- 293
           A  +   +   I + KR +  LL  + E P            D                 
Sbjct: 243 AAVVLTDDQGNIYIHKRPSKGLLANLWEFPNVETQKGIKTERDQLVLFLENEMGINAEID 302

Query: 294 ILCNTITHTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKA 346
            L   + H FTH    + V+   V Q+           + L   A P   +K 
Sbjct: 303 ELQGVVEHVFTHLVWNISVFFGKVKQVSDGTRLKKVTKEQLEEFAFPVSHQKI 355


>gi|229918134|ref|YP_002886780.1| A/G-specific adenine glycosylase [Exiguobacterium sp. AT1b]
 gi|229469563|gb|ACQ71335.1| A/G-specific adenine glycosylase [Exiguobacterium sp. AT1b]
          Length = 344

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 102/349 (29%), Positives = 165/349 (47%), Gaps = 26/349 (7%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
            H    +++ W++   R LPWR           +PY+VW+SE+MLQQT V TV PY+ +F
Sbjct: 13  IHHFNEELVTWFNREKRDLPWRH--------AKNPYRVWVSEVMLQQTRVDTVIPYYNRF 64

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M+++PT+  L++A  +E++  W GLGYY+R RNL +    +   YEG  P + E  +KL 
Sbjct: 65  MERFPTLEDLAAADTDEVVKYWEGLGYYSRVRNLHEAVKEVASVYEGIVPEEKERFEKLK 124

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDI--IKPAPLYHKTIKNYARKITSTS 182
           G+G YT  A+++IA+N     VD N+ R++SR F I      P   K  +   R++   +
Sbjct: 125 GVGPYTTGAVLSIAYNQPEPAVDGNVMRVMSRQFGIYDDIAMPKTRKIFEQVVRRLMDPA 184

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
              DF + +M+LGA +CT   P+C LCP+Q  C  ++      L + T K          
Sbjct: 185 HASDFNEGVMELGATVCTPKNPMCSLCPVQDTCYAYAHHVQDELPVKTKKGAA-RIEMYD 243

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHT 302
            + I  D ++   +R +  LL GM + P     + +             N      + H 
Sbjct: 244 ALCIEKDGKVAYEQRADKGLLAGMWQYPLMDRGTGEQ-----------LNGTYLGQVKHV 292

Query: 303 FTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
           F+H    + +++      +   D  W DA       +    +K L    
Sbjct: 293 FSHIVWYIDLYRVET---LPTDDVVWLDASEREVKTVSVAQQK-LERLA 337


>gi|311103762|ref|YP_003976615.1| A/G-specific adenine glycosylase [Achromobacter xylosoxidans A8]
 gi|310758451|gb|ADP13900.1| A/G-specific adenine glycosylase [Achromobacter xylosoxidans A8]
          Length = 356

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 112/352 (31%), Positives = 169/352 (48%), Gaps = 19/352 (5%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
              +I+DW   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+++F+Q
Sbjct: 3   FAPRIVDWQRRHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVATVIPYYERFLQ 54

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++P +  L +A  E+++  WAGLGYY RARNL +CA  I + + G FP   E +  LPGI
Sbjct: 55  RFPDVAALGAAAQEDVMPYWAGLGYYARARNLHRCAQEIARDWSGRFPPTAEAIATLPGI 114

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYH-----KTIKNYARKITST 181
           G  TA+AI A A+   A ++D N++R+ +R+F I               + +   +    
Sbjct: 115 GRSTAAAIAAFAYGERAPILDGNVKRVFTRHFGIAGDPTKREVEQKLWALADAQVEAAPG 174

Query: 182 SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGA 241
                + Q +MDLGA +CT  KP C  CP   +C+   EG+   L     +K  P R   
Sbjct: 175 LDMAAYTQGLMDLGATLCTRGKPACDACPAADSCVAKREGRQAELPTPKARKAIPERET- 233

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITH 301
             + + ++   LL++R    +  G+  LP    S   D                     H
Sbjct: 234 CMLVLRHEGAFLLQQRPEPGIWGGLWSLPEFDVSQDPDSASRAL-GLEPEQRFELAAFAH 292

Query: 302 TFTHFTLTLFVWKTIVPQIVIIPDS---TWHDAQNLANAALPTVMKKALSAG 350
           TFTH+ L +  W   V    +   +    W  A+ LA+ ALP  +KK L   
Sbjct: 293 TFTHYRLHIRPWLVPVRAAGLRESARPERWVQAEELASVALPAPVKKLLQGL 344


>gi|134096047|ref|YP_001101122.1| adenine DNA glycosylase [Herminiimonas arsenicoxydans]
 gi|133739950|emb|CAL63001.1| A/G-specific adenine glycosylase [Herminiimonas arsenicoxydans]
          Length = 391

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 110/356 (30%), Positives = 178/356 (50%), Gaps = 22/356 (6%)

Query: 5   EHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKK 63
           +      ++ W   + R  LPW+ +          PY+VW+SEIMLQQT V  V PY+ +
Sbjct: 33  DPTFSHAVIHWQKQHGRHALPWQNT--------RDPYRVWLSEIMLQQTQVAAVIPYYLR 84

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           F+  +PT+  L++A  EE+++ W+GLGYY+RARNL KCA  IV  + G FP    +L++L
Sbjct: 85  FLASFPTVASLAAAPSEEVMAHWSGLGYYSRARNLHKCAQAIVSMHGGVFPGDPVLLEQL 144

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITST 181
           PGIG  TA+AI A ++   A ++D N++R+ +R F + +          +   A  +   
Sbjct: 145 PGIGRSTAAAIAAFSYGTRAAILDGNVKRVFARVFGVERYPGEKAVENELWLRAVALLPE 204

Query: 182 SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGA 241
           +    + Q +MDLGA +CT N+P C  CP+ + C+ ++  ++  L I   KK  P     
Sbjct: 205 AGVESYTQGLMDLGATLCTRNRPSCNRCPLVQRCVAYATDRTSELPIRKPKKAVPE-KAT 263

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSA-------WSSTKDGNIDTHSAPFTANWI 294
             + I + ++ILL +R +  +  G+  LP                    T +     +  
Sbjct: 264 AMLLIIDGDQILLEQRPDKGIWGGLLSLPEMDAALQPGTTDFDIALAHATAACGVPVSVE 323

Query: 295 LCNTITHTFTHFTLTLFVWKTIVPQIVII---PDSTWHDAQNLANAALPTVMKKAL 347
                +HTFTHF L +  ++  + Q +         W+    +ANA LP  +KK L
Sbjct: 324 KLPQFSHTFTHFKLHVTPYRIALAQRLQSAGQSSHNWYPTARMANAPLPAPVKKLL 379


>gi|39937545|ref|NP_949821.1| A/G-specific adenine glycosylase [Rhodopseudomonas palustris
           CGA009]
 gi|39651404|emb|CAE29926.1| adenine glycosylase mutY [Rhodopseudomonas palustris CGA009]
          Length = 349

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 143/346 (41%), Positives = 188/346 (54%), Gaps = 10/346 (2%)

Query: 10  SKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWP 69
           + +L WYD + R LPWR  P         PY VW+SEIMLQQTTV+ V PYF KFM +WP
Sbjct: 6   AALLAWYDRHRRTLPWRAPPGATA----DPYAVWLSEIMLQQTTVRAVGPYFDKFMARWP 61

Query: 70  TIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDY 129
           T+  L  A  +++L  WAGLGYY+RARNL  CA  + +++ G FP   E L+ LPG+G Y
Sbjct: 62  TVTALGEASLDDVLKMWAGLGYYSRARNLHACAVAVTRQHGGRFPDTEEGLRALPGVGPY 121

Query: 130 TASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQ 189
           TA+AI AIAF+   + VD NIER++SR + +    P     IK  A  +   SR GD  Q
Sbjct: 122 TAAAIAAIAFSRRTMPVDGNIERVVSRLYAVEDELPKAKPRIKALAETLLGPSRAGDSAQ 181

Query: 190 AMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITND 249
           A+MDLGA ICT  KP C LCP+ + C     G +        KK   +R GA F+ I  D
Sbjct: 182 ALMDLGATICTPKKPACALCPLMQGCTARLRGDAESFPRKAPKKTGTLRRGAAFVVIRGD 241

Query: 250 NRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPF---TANW-ILCNTITHTFTH 305
             +L+R R    LL GM E+P S W   +D       AP     + W      ++H FTH
Sbjct: 242 Q-VLVRSRPAKGLLGGMTEVPNSDWLPDQDEAAAKAQAPALKGVSRWHRKAGVVSHVFTH 300

Query: 306 FTLTLFVWKTIVPQIVIIPDS-TWHDAQNLANAALPTVMKKALSAG 350
           F L L V+          P    W     L++ ALP +M+K ++ G
Sbjct: 301 FPLELAVYVAHAAAGTRAPTGMRWTQISTLSDEALPNLMRKVIAHG 346


>gi|293365513|ref|ZP_06612222.1| A/G-specific adenine glycosylase [Streptococcus oralis ATCC 35037]
 gi|307703471|ref|ZP_07640413.1| A/G-specific adenine glycosylase [Streptococcus oralis ATCC 35037]
 gi|291315881|gb|EFE56325.1| A/G-specific adenine glycosylase [Streptococcus oralis ATCC 35037]
 gi|307622878|gb|EFO01873.1| A/G-specific adenine glycosylase [Streptococcus oralis ATCC 35037]
          Length = 392

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 107/373 (28%), Positives = 168/373 (45%), Gaps = 36/373 (9%)

Query: 2   PQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
            +     + K+L+WYD N R LPWR S         +PY++W+SEIMLQQT V TV PY+
Sbjct: 14  EEKIISFREKLLNWYDENKRDLPWRRS--------KNPYRIWVSEIMLQQTRVDTVIPYY 65

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++F+  +PT+  L++A ++ +L AW GLGYY+R RN++  A  I+  + G FP+  E + 
Sbjct: 66  ERFLDWFPTVESLANAPEDRLLKAWEGLGYYSRVRNMQAAAQQIMADFGGQFPNTYEGIS 125

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            L GIG YTA AI +IAFN     VD N+ R+++R F++      P   K  +     + 
Sbjct: 126 SLKGIGPYTAGAISSIAFNLPEPAVDGNVMRVLARLFEVNHDIGVPSNRKIFQAMMEILI 185

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              RPGDF QA+MDLG+ I     P     P+++    +  G   +  I   KKK     
Sbjct: 186 DPKRPGDFNQALMDLGSDIEAPVNPRPEESPVKEFSAAYQNGTMDVYPIKEPKKKPLPIY 245

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWS------------------------ 275
               +   +  + LL K  + +LL G    P                             
Sbjct: 246 LKALVVRNDRGQYLLEKNESEKLLAGFWHFPLIEVDDFSSDDDQIDLFSQVKEESRAFGP 305

Query: 276 STKDGNIDTHSAPFTANWILCNTITHTFTHFTLTLFVWKTIVPQIVIIPD--STWHDAQN 333
           S ++     +      +  + + + H F+H    + +    V +     D    W   Q 
Sbjct: 306 SPQENFEQDYDLEVNWSQQVFDQVKHVFSHRKWHIQILAGQVTETKQFSDREIRWVSPQE 365

Query: 334 LANAALPTVMKKA 346
            ++  L    +K 
Sbjct: 366 FSDYPLAKPQQKI 378


>gi|238918235|ref|YP_002931749.1| adenine DNA glycosylase [Edwardsiella ictaluri 93-146]
 gi|238867803|gb|ACR67514.1| A/G-specific adenine glycosylase, putative [Edwardsiella ictaluri
           93-146]
          Length = 362

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 106/359 (29%), Positives = 169/359 (47%), Gaps = 16/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                    +L WY    R  LPW+           +PY+VW+SE+MLQQT V TV PYF
Sbjct: 2   MQAQQFAHAVLAWYARFGRKTLPWQHP--------KTPYRVWLSEVMLQQTQVATVLPYF 53

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++F Q++P +  L+SA  +E+L  W GLGYY RARNL K A +IV ++ G FPH  E + 
Sbjct: 54  QRFTQRFPDVQTLASAPLDEVLHLWTGLGYYARARNLHKAAQLIVSRHHGEFPHDFEQVA 113

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPGIG  TA AI++++      ++D N++R+++R + +            +   + ++T
Sbjct: 114 ALPGIGRSTAGAILSLSLGQHHPILDGNVKRVLARCYAVPGWPGRKDVETRLWQLSGEVT 173

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGAL+CT ++P C LCP+   CL +++G          ++  P R 
Sbjct: 174 PADGVSQFNQAMMDLGALVCTRSRPKCELCPLNAGCLAYADGNWADFPGKKPRQTLPERQ 233

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
               + + +   + L++R  + L  G+   P     +     +  H              
Sbjct: 234 A-YLLLLQHGETVWLQQRPASGLWGGLFCFPQYDSEAALHTRL-RHLGQDPTAAQTLTAF 291

Query: 300 THTFTHFTLTLFVW---KTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            HTF+HF L +       T     +   D  W++     +  L    ++ L     + P
Sbjct: 292 RHTFSHFHLDIIPVWSTYTTASACMDEGDGLWYNLAQPPSVGLAAPTERLLQQLRRQPP 350


>gi|259418050|ref|ZP_05741969.1| A/G-specific adenine glycosylase [Silicibacter sp. TrichCH4B]
 gi|259346956|gb|EEW58770.1| A/G-specific adenine glycosylase [Silicibacter sp. TrichCH4B]
          Length = 353

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 142/349 (40%), Positives = 199/349 (57%), Gaps = 8/349 (2%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTVEPYFKK 63
             I+   +L+WYD + R +PWR  P+   + +   PY++W+SE+MLQQTTV  V+ YF++
Sbjct: 8   PEILSQDLLEWYDRHARQMPWRVGPEARAAGVRPDPYRIWLSEVMLQQTTVAAVKDYFER 67

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           F ++WPT+  L++A D ++++ WAGLGYY RARNL KCA ++     G FP   E L  L
Sbjct: 68  FTRRWPTVSDLAAAADADVMAEWAGLGYYARARNLLKCARVVADDLSGVFPDTYEGLIAL 127

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSR 183
           PGIG YTA+AI AIAF+    V+D N+ER+++R  D   P P     +K++A  +T   R
Sbjct: 128 PGIGPYTAAAISAIAFDRPETVLDGNVERVMARLHDEHAPLPGVKPVLKDHAAHLTPAQR 187

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVF 243
           PGD+ QA+MDLGA ICT   P C +CP +  C     G +  L   T KK +P R G V+
Sbjct: 188 PGDYAQAVMDLGATICTPKSPACGICPWRTPCRARLNGTAAELPKKTPKKPKPTRHGFVY 247

Query: 244 IAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN-TITHT 302
           IA  ++   L+ +R +  LL GM   PGS W+        T + PF ANW      + HT
Sbjct: 248 IARNHEGDWLMERRPDKGLLGGMLGWPGSDWNEAP-----TEAPPFEANWQDLGAEVRHT 302

Query: 303 FTHFTLTLFVWKTIVPQIVIIPDST-WHDAQNLANAALPTVMKKALSAG 350
           FTHF L L V    +P    + D        +   + LPTVM+KA    
Sbjct: 303 FTHFHLILQVRMAELPAGFNLSDGQEIIKRHDFRPSDLPTVMRKAFDLL 351


>gi|304396766|ref|ZP_07378646.1| A/G-specific adenine glycosylase [Pantoea sp. aB]
 gi|304355562|gb|EFM19929.1| A/G-specific adenine glycosylase [Pantoea sp. aB]
          Length = 378

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 105/362 (29%), Positives = 171/362 (47%), Gaps = 19/362 (5%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           +         ++LDWY    R  LPW+           +PYKVW+SE+MLQQT V TV P
Sbjct: 17  LMMQAPQFAQQVLDWYQRFGRKTLPWQ--------LEKTPYKVWLSEVMLQQTQVATVIP 68

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF++FM ++PT+  L++A  +E+L  W G+GYY RARNL K A  IV+ ++G FP   + 
Sbjct: 69  YFERFMARFPTVTDLAAAPLDEVLHLWTGMGYYARARNLHKAAKQIVEVHQGEFPRNFDD 128

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARK 177
           +  LPG+G  TA AI++++      ++D N++R+++R + I            +   + +
Sbjct: 129 VSALPGVGRSTAGAILSLSLGQHFPILDGNVKRVLARCYAIGGWPGKKEVEKRLWQISEE 188

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T       F QAMMDLGAL+CT +KP C +CP+   C  ++            K+  P 
Sbjct: 189 VTPAEGVSQFNQAMMDLGALVCTRSKPKCEICPLNSGCEAYASSSWASYPGKKPKQVLPE 248

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
           R+G   +    D+ + L +R    L  G+   P     +     +        A      
Sbjct: 249 RSGWFLMMQDGDD-VWLEQRPPVGLWGGLFCFPQFTTETALTDWLTARG--IHAKPQQLT 305

Query: 298 TITHTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
              HTF+HF L +       P     +      W++     +  L   +++ L    ++ 
Sbjct: 306 AFRHTFSHFHLDIVPMWLSWPSAGAAMDEAGGLWYNLALPPSVGLAAPVERLL--HELRH 363

Query: 355 PQ 356
           P+
Sbjct: 364 PR 365


>gi|319654226|ref|ZP_08008315.1| YfhQ protein [Bacillus sp. 2_A_57_CT2]
 gi|317394160|gb|EFV74909.1| YfhQ protein [Bacillus sp. 2_A_57_CT2]
          Length = 366

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 121/349 (34%), Positives = 172/349 (49%), Gaps = 18/349 (5%)

Query: 8   IQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQK 67
            Q  +L W++   R LPWR            PYKVW+SEIMLQQT V TV PYF +F+++
Sbjct: 17  FQDDLLRWFEAEQRDLPWRKD--------QDPYKVWVSEIMLQQTRVDTVIPYFHRFIEQ 68

Query: 68  WPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIG 127
           +PT+  LS A +E++L AW GLGYY+RARNL+     + +KY G  P   + +  L G+G
Sbjct: 69  FPTVKDLSEADEEKVLKAWEGLGYYSRARNLQAAVREVHEKYGGRVPDTPKEISSLKGVG 128

Query: 128 DYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTSRPG 185
            YTA AI++IA+      VD N+ R++SR   I      P   K  ++  RK+ S   P 
Sbjct: 129 PYTAGAILSIAYGIPEPAVDGNVMRVLSRILSIWDDIAKPSSRKIFESSVRKLISHKNPS 188

Query: 186 DFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIA 245
            F QA+M+LGALICT   P C LCP++++C  F EG  H L + T  KK+     A  + 
Sbjct: 189 HFNQALMELGALICTPTSPSCLLCPVREHCTAFYEGTQHELPVKTKTKKQRNVQLAAAVL 248

Query: 246 ITNDNRILLRKRTNTRLLEGMDELPGSA-------WSSTKDGNIDTHSAPFTANWILCNT 298
           I +  RIL+ KR    LL  + E P +                  T          +   
Sbjct: 249 IDDHERILIHKRPEKGLLANLWEFPMAEINIAYVSDKEQMKDVFSTQFGAEVEIQEMTGQ 308

Query: 299 ITHTFTHFTLTLFVWKTIVPQIVIIP-DSTWHDAQNLANAALPTVMKKA 346
           I H F+H T  + V+K  +  +     D      + +     P   +K 
Sbjct: 309 IEHVFSHLTWNINVYKGKIIILEEEKNDLKLVSLEEIKEFPFPVSHQKI 357


>gi|238798793|ref|ZP_04642263.1| A/G-specific adenine glycosylase [Yersinia mollaretii ATCC 43969]
 gi|238717364|gb|EEQ09210.1| A/G-specific adenine glycosylase [Yersinia mollaretii ATCC 43969]
          Length = 353

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 107/358 (29%), Positives = 168/358 (46%), Gaps = 16/358 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                    +LDWY    R  LPW+           +PY+VW+SE+MLQQT V TV PYF
Sbjct: 2   MQAQQFAHAVLDWYQRFGRKTLPWQ--------LDKTPYQVWLSEVMLQQTQVATVIPYF 53

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++P I  L++A  +E+L  W GLGYY RARNL K A  +V++++G FP   + + 
Sbjct: 54  QRFMLRFPDIRALAAAPLDEVLHLWTGLGYYARARNLHKAAQTVVERHQGEFPTTFDEIL 113

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPGIG  TA AI+++A      ++D N++R+++R + +            +   + ++T
Sbjct: 114 ALPGIGRSTAGAILSLALGQHFPILDGNVKRVLARCYAVEGWPGKKEVESRLWQISEEVT 173

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                G F QAMMDLGA++CT +KP C LCP+   C+ ++            K+  P   
Sbjct: 174 PAKGVGQFNQAMMDLGAIVCTRSKPKCELCPLNTGCMAYANHSWARYPGKKPKQTIPE-K 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
            A F+ + ND +  L +R    L  G+   P  A     +  +                 
Sbjct: 233 TAYFLLMQNDTQAWLEQRPPVGLWGGLFCFPQFAEQEELERWLQQQGISANG-LQQLTAF 291

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIKV 354
            HTF+HF L +      V  +    D     W++     +  L   +++ L       
Sbjct: 292 RHTFSHFHLDIVPMWLNVGSVRGCMDDGAGLWYNLAQPPSVGLAAPVERLLHMLAKTA 349


>gi|318604338|emb|CBY25836.1| A/G-specific adenine glycosylase [Yersinia enterocolitica subsp.
           palearctica Y11]
          Length = 380

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 104/359 (28%), Positives = 168/359 (46%), Gaps = 16/359 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           +          +L+WY    R  LPW+           +PY+VW+SE+MLQQT V TV P
Sbjct: 17  LMMQAQQFAHVVLEWYQRFGRKTLPWQ--------LDKTPYQVWLSEVMLQQTQVATVIP 68

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF++FM ++P I  L++A  +E+L  W GLGYY RARNL K A  +V+ ++G FP   + 
Sbjct: 69  YFQRFMLRFPDISALAAAPLDEVLHLWTGLGYYARARNLHKAAQTVVEHHQGEFPTTFDE 128

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLY--HKTIKNYARK 177
           +  LPGIG  TA AI++++      ++D N++R+++R + +            +   +  
Sbjct: 129 ILALPGIGRSTAGAILSLSLGQHFPILDGNVKRVLARCYAVEGWPGKKDVEGRLWQISED 188

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T     G F QAMMDLGA++CT +KP C LCP+   CL ++             K+   
Sbjct: 189 VTPAKGVGQFNQAMMDLGAIVCTRSKPKCELCPLNIGCLAYANHSWARYPEKK-PKQTIP 247

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
           +  A F+ + N +++ L +R    L  G+   P  A     D  +        +      
Sbjct: 248 KKTAYFLLLQNGSQVWLEQRPPVGLWGGLFCFPQFAGQDDLDSWLQQ-RGMAASELQQLT 306

Query: 298 TITHTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIK 353
              HTF+HF L +              D     W++     +  L   +++ L     +
Sbjct: 307 AFRHTFSHFHLDIVPMWLDTASARGCMDDGAGLWYNLAQPPSVGLAAPVERLLLQLAKE 365


>gi|22127215|ref|NP_670638.1| adenine DNA glycosylase [Yersinia pestis KIM 10]
 gi|45443228|ref|NP_994767.1| adenine DNA glycosylase [Yersinia pestis biovar Microtus str.
           91001]
 gi|21960283|gb|AAM86889.1|AE013935_6 adenine glycosylase [Yersinia pestis KIM 10]
 gi|45438096|gb|AAS63644.1| A/G-specific adenine glycosylase [Yersinia pestis biovar Microtus
           str. 91001]
          Length = 415

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 104/353 (29%), Positives = 169/353 (47%), Gaps = 16/353 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           +          +LDWY    R  LPW+           +PY+VW+SE+MLQQT V TV P
Sbjct: 43  LMMQAQQFAHVVLDWYQHFGRKTLPWQ--------LDKTPYQVWLSEVMLQQTQVATVIP 94

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF++FM ++P I  L++A  +++L  W GLGYY RARNL K A ++V+ ++G FP   + 
Sbjct: 95  YFQRFMLRFPDIQALAAAPLDDVLHLWTGLGYYARARNLHKAAQMVVEHHQGEFPTTFDQ 154

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARK 177
           +  LPGIG  TA AI++++      ++D N++R+++R + +            +   +  
Sbjct: 155 ILALPGIGRSTAGAILSLSLGQHFPILDGNVKRVLARCYAVDGWPGKKEVEGRLWQISED 214

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T  +  G F QAMMDLGA++CT +KP C LCP+   C+ ++            K+  P 
Sbjct: 215 VTPANGVGQFNQAMMDLGAMVCTRSKPKCELCPLNIGCMAYANHSWARYPGKKPKQTLPE 274

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
              A F+ + N +++ L +R    L  G+   P  A        +     P         
Sbjct: 275 -KTAWFLLMQNGSQVWLEQRPPVGLWGGLFCFPQFAEQEELIHWLQKQGIPANETQQ-LT 332

Query: 298 TITHTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKAL 347
              HTF+HF L +         +    D     W++     +  L   +++ L
Sbjct: 333 AFRHTFSHFHLDIVPIWLNTASVRGCMDDGAGLWYNLAQPPSVGLAAPVERLL 385


>gi|268612274|pdb|3G0Q|A Chain A, Crystal Structure Of Muty Bound To Its Inhibitor Dna
          Length = 352

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 108/351 (30%), Positives = 168/351 (47%), Gaps = 16/351 (4%)

Query: 4   PEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKK 63
           P    Q  +LDW+    R LPWR            PYKVW+SE+MLQQT V+TV PYF++
Sbjct: 1   PAREFQRDLLDWFARERRDLPWRKD--------RDPYKVWVSEVMLQQTRVETVIPYFEQ 52

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           F+ ++PT+  L+ A ++E+L AW GLGYY+R RNL      +  +Y G  P   +   +L
Sbjct: 53  FIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRL 112

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLY--HKTIKNYARKITST 181
            G+G YT  A++++A+      VD N+ R++SR F +          K  +   R+I + 
Sbjct: 113 KGVGPYTVGAVLSLAYGVPEPAVDGNVMRVLSRLFLVTDDIAKCSTRKRFEQIVREIMAY 172

Query: 182 SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGA 241
             PG F +A+++LGAL+CT  +P C LCP+Q  C  F+EG +  L +   K        A
Sbjct: 173 ENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKMKKTAVKQVPLA 232

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAWS-----STKDGNIDTHSAPFTANWILC 296
           V +   ++ R+L+RKR +T LL  + E P             +  +              
Sbjct: 233 VAVLADDEGRVLIRKRDSTGLLANLWEFPSCETDGADGKEKLEQMVGEQYGLQVELTEPI 292

Query: 297 NTITHTFTHFTLTLFVWKTIVPQIVIIPD-STWHDAQNLANAALPTVMKKA 346
            +  H F+H    L V+   +     + +         L   A P   ++ 
Sbjct: 293 VSFEHAFSHLVWQLTVFPGRLVHGGPVEEPYRLAPEDELKAYAFPVSHQRV 343


>gi|170023069|ref|YP_001719574.1| adenine DNA glycosylase [Yersinia pseudotuberculosis YPIII]
 gi|169749603|gb|ACA67121.1| A/G-specific adenine glycosylase [Yersinia pseudotuberculosis
           YPIII]
          Length = 419

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 106/353 (30%), Positives = 170/353 (48%), Gaps = 16/353 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           +          +LDWY    R  LPW+           +PY+VW+SE+MLQQT V TV P
Sbjct: 47  LMMQAQQFAHVVLDWYQHFGRKTLPWQ--------LDKTPYQVWLSEVMLQQTQVATVIP 98

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF++FM ++P I  L++A  +E+L  W GLGYY RARNL K A ++V+ ++G FP   + 
Sbjct: 99  YFQRFMLRFPDIQALAAAPLDEVLHLWTGLGYYARARNLHKAAQMVVEHHQGEFPTTFDQ 158

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARK 177
           +  LPGIG  TA AI++++      ++D N++R+++R + +            +   +  
Sbjct: 159 ILALPGIGRSTAGAILSLSLGQHFPILDGNVKRVLARCYAVDGWPGKKEVESRLWQISED 218

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T  +R G F QAMMDLGA++CT +KP C LCP+   C+ ++            K+  P 
Sbjct: 219 VTPANRVGQFNQAMMDLGAMVCTRSKPKCELCPLNIGCMAYANHSWARYPGKKPKQTLPE 278

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
              A F+ + N +++ L +R    L  G+   P  A        +     P         
Sbjct: 279 -KTAWFLLMQNGSQVWLEQRPPVGLWGGLFCFPQFAEQEELIHWLQKQGIPANETQQ-LT 336

Query: 298 TITHTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKAL 347
              HTF+HF L +         +    D     W++     +  L   +++ L
Sbjct: 337 AFRHTFSHFHLDIVPIWLNTASVRGCMDDGAGLWYNLAQPPSVGLAAPVERLL 389


>gi|253687278|ref|YP_003016468.1| A/G-specific adenine glycosylase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251753856|gb|ACT11932.1| A/G-specific adenine glycosylase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 368

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 100/362 (27%), Positives = 168/362 (46%), Gaps = 21/362 (5%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                   ++LDWY    R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 2   MQAQQFAHQVLDWYQRYGRKTLPWQ--------LEKTPYKVWLSEVMLQQTQVTTVIPYF 53

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM+++P +  L++A  +E+L  W GLGYY RA NL K A  IV ++ G FP   + + 
Sbjct: 54  QRFMERFPNVSALAAAPLDEVLHLWTGLGYYARAHNLHKAAQTIVSRHGGEFPTTFDEVA 113

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPG+G  TA A+++++      ++D N++R+++R + +            +   + ++T
Sbjct: 114 ALPGVGRSTAGAVLSLSLGQHYPILDGNVKRVLARCYAVDGWPGKKEVEKKLWARSEEVT 173

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT ++P C LCP+   C+ ++            K+  P +T
Sbjct: 174 PAEGVSQFNQAMMDLGAMVCTRSRPKCELCPLNTGCMAYANHSWGQYPGKKPKQTLPEKT 233

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +     +++ L++R    L  G+   P  +     +  +            L    
Sbjct: 234 GWFLLM-QQGSQVWLQQRPAVGLWGGLFCFPQFSERRELELWMQQRGLNPDGLQQLV-AF 291

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD--------STWHDAQNLANAALPTVMKKALSAGG 351
            HTF+HF L +      V Q     +          W++     +  L   +++ L    
Sbjct: 292 RHTFSHFHLDIVPLWLDVSQSDRSQNRSCMDDDAGLWYNLAQPPSVGLAAPVERLLRELA 351

Query: 352 IK 353
             
Sbjct: 352 HP 353


>gi|331266317|ref|YP_004325947.1| A/G-specific adenine glycosylase, putative [Streptococcus oralis
           Uo5]
 gi|326682989|emb|CBZ00606.1| A/G-specific adenine glycosylase, putative [Streptococcus oralis
           Uo5]
          Length = 392

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 108/368 (29%), Positives = 164/368 (44%), Gaps = 36/368 (9%)

Query: 7   IIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
             + K+L+WYD N R LPWR S         +PY +W+SEIMLQQT V TV PY+++F+ 
Sbjct: 19  SFREKLLNWYDENKRDLPWRRS--------KNPYHIWVSEIMLQQTRVDTVIPYYERFLD 70

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
            +PT+  L++A +E +L AW GLGYY+R RN++  A  I+  + G FP+  E +  L GI
Sbjct: 71  WFPTVESLANAPEERLLKAWEGLGYYSRVRNMQAAAQQIMADFGGQFPNTYEGISCLKGI 130

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTSRP 184
           G YTA AI +IAFN     VD N+ R+++R F++      P   K  +     +    RP
Sbjct: 131 GPYTAGAISSIAFNLPEPAVDGNVMRVLARLFEVNHDIGVPSNRKIFQAMMEILIDPKRP 190

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
           GDF QA+MDLG+ I     P     P++     +  G      I   KKK         +
Sbjct: 191 GDFNQALMDLGSDIEAPVNPRPEESPVKDFSAAYQNGTMGRYPIKEPKKKPLPIYLKALV 250

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWS------------------------STKDG 280
              +  + LL K  + +LL G    P                             S ++ 
Sbjct: 251 VRNDQGQFLLEKNESEKLLAGFWHFPLIEVDDFSSDDDQLDLFSQVKEESRAFGPSPQEN 310

Query: 281 NIDTHSAPFTANWILCNTITHTFTHFTLTLFVWKTIVPQIVIIPD--STWHDAQNLANAA 338
               +      +  + + + H F+H    + +    V +     D    W   Q  ++  
Sbjct: 311 FEQDYDLEVNWSQQVFDQVKHVFSHRKWHIQILAGQVTETKQFSDREIRWVSPQEFSDYP 370

Query: 339 LPTVMKKA 346
           L    +K 
Sbjct: 371 LAKPQQKI 378


>gi|315613223|ref|ZP_07888133.1| A/G-specific adenine glycosylase [Streptococcus sanguinis ATCC
           49296]
 gi|315314785|gb|EFU62827.1| A/G-specific adenine glycosylase [Streptococcus sanguinis ATCC
           49296]
          Length = 386

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 108/373 (28%), Positives = 165/373 (44%), Gaps = 36/373 (9%)

Query: 2   PQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
            +     + K+L+WYD N R LPWR S         +PY +W+SEIMLQQT V TV PY+
Sbjct: 14  EEKIISFREKLLNWYDENKRDLPWRRS--------KNPYHIWVSEIMLQQTRVDTVIPYY 65

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++F+  +PT+  L++A +E +L AW GLGYY+R RN++  A  I+  + G FP+  E + 
Sbjct: 66  ERFLDWFPTVESLANAPEERLLKAWEGLGYYSRVRNMQAAAQQIMADFGGQFPNTYEGIS 125

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            L GIG YTA AI +IAFN     VD N+ R+++R F++      P   K  +     + 
Sbjct: 126 SLKGIGPYTAGAISSIAFNLPEPAVDGNVMRVLARLFEVNHDIGVPSNRKIFQAMMEILI 185

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              RPGDF QA+MDLG+ I     P     P++     +  G      I   KKK     
Sbjct: 186 DPKRPGDFNQALMDLGSDIEAPVNPRPEESPVKDFSAAYQNGTMGRYPIKEPKKKPLPIY 245

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWS------------------------ 275
               +   +  + LL K  + +LL G    P                             
Sbjct: 246 LKALVVRNDQGQFLLEKNESEKLLAGFWHFPLIEVDDFSSDDNQLDLFSQVTEESRVFGP 305

Query: 276 STKDGNIDTHSAPFTANWILCNTITHTFTHFTLTLFVWKTIVPQIVIIPD--STWHDAQN 333
           S ++     +      +  + + + H F+H    + +    V +     D    W   Q 
Sbjct: 306 SPQENFEQDYDLEVNWSQQVFDQVKHVFSHRKWHIQIIAGQVTETKQFSDREIRWVSPQE 365

Query: 334 LANAALPTVMKKA 346
            ++  L    +K 
Sbjct: 366 FSDYPLAKPQQKI 378


>gi|294634371|ref|ZP_06712908.1| A/G-specific adenine glycosylase [Edwardsiella tarda ATCC 23685]
 gi|291092179|gb|EFE24740.1| A/G-specific adenine glycosylase [Edwardsiella tarda ATCC 23685]
          Length = 362

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 106/357 (29%), Positives = 174/357 (48%), Gaps = 16/357 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                    +L WY    R  LPW+           +PY+VW+SE+MLQQT V TV PYF
Sbjct: 2   MQAQPFAQAVLAWYARFGRKTLPWQNP--------KTPYRVWLSEVMLQQTQVATVLPYF 53

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++F+Q++P +  L+ A  +E+L  W GLGYY RARNL K A  IV +Y G FP + + + 
Sbjct: 54  QRFIQRFPDVQALAEAPLDEVLHLWTGLGYYARARNLHKAAQTIVAQYGGEFPREFDQVA 113

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPGIG  TA AI++++      ++D N++R+++R + +            +   + ++T
Sbjct: 114 ALPGIGRSTAGAILSLSLGQHHPILDGNVKRVLARCYAVAGWPGKKEVEKRLWQLSAQVT 173

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGAL+CT ++P C LCP+   CL ++ G          K+  P R 
Sbjct: 174 PADGVSQFNQAMMDLGALVCTRSRPKCELCPLSSGCLAYANGDWAAYPGKKPKQTLPERQ 233

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
               + + ++ ++ L++R  + L  G+   P    ++    ++        A   +    
Sbjct: 234 A-YLLLLQHEGQVWLQQRPASGLWGGLFCFPQFDNAAALHAHLRQL-GQDPAAAQVLTAF 291

Query: 300 THTFTHFTLTLF-VWKTIVPQIVIIPD--STWHDAQNLANAALPTVMKKALSAGGIK 353
            HTF+HF L +  VW    P    + D    W++     +  L    ++ L    ++
Sbjct: 292 RHTFSHFHLDIIPVWSHYAPAAACMDDGAGLWYNLAQPPSVGLAAPTERLLQQLPLQ 348


>gi|168702310|ref|ZP_02734587.1| A/G-specific adenine glycosylase [Gemmata obscuriglobus UQM 2246]
          Length = 375

 Score =  242 bits (617), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 97/367 (26%), Positives = 171/367 (46%), Gaps = 16/367 (4%)

Query: 2   PQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
           P+    +++K+L+W+D + R LPWR +           Y+VW+SE+MLQQTTV  V PYF
Sbjct: 9   PRTLAGVRTKLLNWFDKHQRDLPWRRTVNGA----RDAYQVWVSEVMLQQTTVAAVVPYF 64

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++F+  +P +  L++A ++ +L  W GLGYY RAR+L   A ++V+ + G+ P   ++ +
Sbjct: 65  ERFLAAFPDVRALAAADEQRVLKLWEGLGYYRRARHLHAAAKLLVEAHNGDLPDDPDVWE 124

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFD--IIKPAPLYHKTIKNYARKIT 179
            LPG+G Y   A+++ AF+    +V+ N  R+++R F              +   A  + 
Sbjct: 125 PLPGVGRYILGAVLSQAFDRPLPIVEANSLRVLARLFAYPGDPREGEGKVWVWAAAETVL 184

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              R GDF Q++M+LGAL+CT   P C  CP++ NC     G+   +     +       
Sbjct: 185 PAKRAGDFNQSLMELGALVCTPTAPACDRCPVRDNCEAKRLGRQDQIPPKKKQPAITEVA 244

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKD------GNIDTHSAPFTANW 293
               +     N +L ++  N    + M E+P +  +  +D            +       
Sbjct: 245 EVGVVIRDGANVLLCQRPANAGRWQNMWEIPHAPRTEGEDVSAAAVRVARELTGFDVEPG 304

Query: 294 ILCNTITHTFTHFTLTL----FVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSA 349
               T+ H  T + +TL     V +          ++ W   Q L +  + +  +K ++A
Sbjct: 305 AEIRTVRHGVTRYAITLVCVGSVLRGGAFAAGHYANAKWVAPQELGDYPVSSPQRKLMTA 364

Query: 350 GGIKVPQ 356
                 Q
Sbjct: 365 LADPNHQ 371


>gi|167568722|ref|ZP_02361596.1| A/G-specific adenine glycosylase [Burkholderia oklahomensis C6786]
          Length = 368

 Score =  242 bits (617), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 102/352 (28%), Positives = 167/352 (47%), Gaps = 25/352 (7%)

Query: 7   IIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
                ++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+ +F+
Sbjct: 19  AFAPTLIAWQRKHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVVPYYMRFL 70

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
           +++P +  L++A  +++++ WAGLGYY+RARNL +CA  +V+ + G FP   E L +LPG
Sbjct: 71  ERYPDVAALAAAPIDDVMALWAGLGYYSRARNLHRCAQAVVELHGGAFPASPEALAELPG 130

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITS--- 180
           IG  TA+AI + AF   A ++D N++R+++R F +            +   A  +     
Sbjct: 131 IGRSTAAAIASFAFGARATILDGNVKRVLARVFGVEGFPGDKRVENEMWALAEALLPDAA 190

Query: 181 -TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             +    + Q +MDLGA +C   KP C  CP   +C+    G+   L     KK  P R 
Sbjct: 191 EQADVTAYTQGLMDLGATLCARGKPDCARCPFAGDCVAERSGRQRELPAARPKKAVPTRR 250

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
               + + + + +LL +R    +  G+  LP +   +              A  +    +
Sbjct: 251 T-WMLVLRDGDAVLLLRRPPAGIWGGLWSLPEADGDAALALRARAFGG---AELVPLAPL 306

Query: 300 THTFTHFTLTLFVWKTIVPQI------VIIPDSTWHDAQNLANAALPTVMKK 345
           THTFTHF L +      +             +S W     L    +P  ++K
Sbjct: 307 THTFTHFKLEIEPRLAELDGAAGGVLQAADDESAWVALDKLDAYGVPAPVRK 358


>gi|311695906|gb|ADP98779.1| A/G-specific adenine glycosylase-like protein [marine bacterium
           HP15]
          Length = 355

 Score =  242 bits (617), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 116/358 (32%), Positives = 186/358 (51%), Gaps = 21/358 (5%)

Query: 1   MPQPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           MP       +K+L WYD + R  LPW  +         + Y+VW+SEIMLQQT V TV P
Sbjct: 1   MP---DSFANKLLQWYDCHGRHDLPWHHN--------RNAYRVWVSEIMLQQTQVTTVIP 49

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF+ FM+++P +  L+ A  +++LS W+GLGYY RARNL+K A  +V++++G FP   E 
Sbjct: 50  YFEAFMKRFPDVHALAEAPVDDVLSHWSGLGYYARARNLQKAAQTVVREFDGEFPQTQEK 109

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARK 177
           L+ L GIG  TA+AI+A AF   A ++D N++R+++RY  I            +   A +
Sbjct: 110 LESLTGIGRSTAAAILAQAFGIRAAILDGNVKRVLARYHAIPGWPGQTAVLNQLWQRAEE 169

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
            T   R   + Q +MDLGA++CT ++P C  CP+Q+ C  +++G++ L   +  KK +P 
Sbjct: 170 HTPKQRVRGYTQGIMDLGAMVCTRSRPACESCPLQEGCRAYAQGETSLYPGSKPKKAKPE 229

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMD---ELPGSAWSSTKDGNIDTHSAPFTANWI 294
           ++  + I    + RILL +R  + +  G+    EL  +  +       +       A   
Sbjct: 230 KSTWMVILEDGEGRILLERRPPSGIWGGLWSLPELDPAYGADELQEACEQSLGLDCAEPE 289

Query: 295 LCNTITHTFTHFTLTLFVWKTIV----PQIVIIPDSTWHDAQNLANAALPTVMKKALS 348
           L +   HTF+H+ L +   +  V      +       W       N  LP  ++  L+
Sbjct: 290 LISGFRHTFSHYHLHIQPARLNVTGGANTVADKDHLKWLHRHEALNLGLPAPIRSLLT 347


>gi|87198982|ref|YP_496239.1| A/G-specific DNA-adenine glycosylase [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87134663|gb|ABD25405.1| A/G-specific DNA-adenine glycosylase [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 359

 Score =  242 bits (617), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 145/354 (40%), Positives = 198/354 (55%), Gaps = 16/354 (4%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
              I   +LDWYD + R LPWR  P   +     PY+VW+SE+MLQQTTV  V PYF+KF
Sbjct: 13  PQAIAPALLDWYDAHARKLPWRRLPGEAR---QDPYRVWLSEVMLQQTTVAAVGPYFEKF 69

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
            + WPT+  L++A D ++++AWAGLGYY RARNL  CA   V    G FP   + L+ LP
Sbjct: 70  TRLWPTVGDLAAADDGDVMAAWAGLGYYARARNLLACA-RAVAAMGGTFPDSEDGLRALP 128

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRP 184
           G+G+YTA+A+ AIAF   AVVVD N+ER+I+R F I +P P     I+  A ++T   R 
Sbjct: 129 GLGEYTAAAVAAIAFGRRAVVVDANVERVIARLFAIDEPLPAGKAAIRLAAGQVTPEERA 188

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
           GDF QAMMDLGA +CT+  P C LCP++++C   +EG    L +   +K +P+R G  + 
Sbjct: 189 GDFAQAMMDLGATVCTARSPRCMLCPLREHCRALAEGAPERLPVKAARKAKPVRQGRAY- 247

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFT 304
            I  + R+LL +R    +L GM  LP   WS+  DG            W     + H FT
Sbjct: 248 WIEREGRVLLVRRPGRGMLGGMRALPDDGWSARGDGADA-----IGGEWRGGGVVRHGFT 302

Query: 305 HFTLTLFVWKTIVPQIVIIP-----DSTWHDAQNLANAALPTVMKKALSAGGIK 353
           HF L L +   +  +   +P     +  W     +  A LPTV  KA +   I 
Sbjct: 303 HFDLELQLMLCVQAEAASLPGLNDIEGEWWPVDEIEAAGLPTVFAKA-ARLAIA 355


>gi|261418791|ref|YP_003252473.1| A/G-specific adenine glycosylase [Geobacillus sp. Y412MC61]
 gi|319765607|ref|YP_004131108.1| A/G-specific adenine glycosylase [Geobacillus sp. Y412MC52]
 gi|261375248|gb|ACX77991.1| A/G-specific adenine glycosylase [Geobacillus sp. Y412MC61]
 gi|317110473|gb|ADU92965.1| A/G-specific adenine glycosylase [Geobacillus sp. Y412MC52]
          Length = 366

 Score =  242 bits (617), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 109/351 (31%), Positives = 169/351 (48%), Gaps = 16/351 (4%)

Query: 4   PEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKK 63
           P    Q  +LDW+    R LPWR            PYKVW+SE+MLQQT V+TV PYF++
Sbjct: 9   PARKFQRDLLDWFARERRDLPWRKD--------RDPYKVWVSEVMLQQTRVETVIPYFEQ 60

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           F+ ++PT+  L+ A ++E+L AW GLGYY+R RNL      +  +Y G  P   +   +L
Sbjct: 61  FIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRL 120

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITST 181
            G+G YT  A++++A+      VD N+ R++SR F +      P   K  +   R+I + 
Sbjct: 121 KGVGPYTVGAVLSLAYGVPEPAVDGNVMRVLSRLFLVTDDIAKPSTRKRFEQIVREIMAY 180

Query: 182 SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGA 241
             PG F +A+++LGAL+CT  +P C LCP+Q  C  F+EG +  L +   K        A
Sbjct: 181 ENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKMKKTAVKQVPLA 240

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAWS-----STKDGNIDTHSAPFTANWILC 296
           V +   ++ R+L+RKR +T LL  + E P             +  +              
Sbjct: 241 VAVLADDEGRVLIRKRDSTGLLANLWEFPSCETDGADGKEKLEQMVGEQYGLQVELTEPI 300

Query: 297 NTITHTFTHFTLTLFVWKTIVPQIVIIPD-STWHDAQNLANAALPTVMKKA 346
            +  H F+H    L V+   +     + +         L   A P   ++ 
Sbjct: 301 VSFEHAFSHLVWQLTVFPGRLVHGGPVEEPYRLAPEDELKAYAFPVSHQRV 351


>gi|197104044|ref|YP_002129421.1| A/G-specific adenine glycosylase [Phenylobacterium zucineum HLK1]
 gi|196477464|gb|ACG76992.1| A/G-specific adenine glycosylase [Phenylobacterium zucineum HLK1]
          Length = 349

 Score =  242 bits (616), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 143/350 (40%), Positives = 195/350 (55%), Gaps = 10/350 (2%)

Query: 7   IIQSKILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTVEPYFKKFM 65
            +++++L WYD N R LPWR  P    + +   PY+VW+SE+MLQQTTV    PYF KF 
Sbjct: 6   TLRAQLLAWYDQNARDLPWRVGPADRAAGVRADPYRVWLSEVMLQQTTVPHATPYFLKFT 65

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
            +WPT+  L++A DEE+++AWAGLGYY RARNL  CA  +   + G FP     L KLPG
Sbjct: 66  ARWPTVSDLAAAPDEEVMAAWAGLGYYARARNLLACARAVANDHGGVFPDTEAGLLKLPG 125

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPG 185
           +G YTA+A+ AIAF+  A VVD N+ER++SR F + +P P     +K  A  + +  RPG
Sbjct: 126 LGPYTAAAVAAIAFDRPANVVDGNVERVVSRLFAVEQPLPAAKPELKRLAAALVAEDRPG 185

Query: 186 DFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIA 245
           D+ QA+MDLGA IC    PLC  CP+  +C  F+ G        T K  RP R G  ++ 
Sbjct: 186 DWAQALMDLGATICRPKAPLCDRCPLADHCAAFATGTPDAWPRKTAKAARPRRHGVAYV- 244

Query: 246 ITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKD-GNIDTHSAPFTANWILCNTITHTFT 304
           +T  +++ L +R    LL GM  LP S W S          +AP  A W     + H FT
Sbjct: 245 LTRGDQVALVRRPPKGLLGGMLALPTSDWRSEPWSEAEAISAAPAPAAWRGVGEVEHVFT 304

Query: 305 HFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
           HF+LTL + +             W    +L   ALP+V  KA +  G+  
Sbjct: 305 HFSLTLRLLRAE----GDADGVIWSPRGDLE--ALPSVFLKA-ARAGLSN 347


>gi|319427166|gb|ADV55240.1| A/G-specific adenine glycosylase [Shewanella putrefaciens 200]
          Length = 362

 Score =  242 bits (616), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 108/363 (29%), Positives = 170/363 (46%), Gaps = 23/363 (6%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M        ++I+ WYD + R  LPW+           +PY VW+SEIMLQQT V TV P
Sbjct: 1   MKSTAS-FATRIVSWYDNHGRKTLPWQQD--------KTPYSVWVSEIMLQQTQVATVIP 51

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           Y+ KFM ++P +  L++A D+E+L  W GLGYY RARNL K A +I   Y+G FP   E 
Sbjct: 52  YYLKFMARFPDVLALANAPDDEVLHHWTGLGYYARARNLHKAAKMIRDDYQGLFPTDFEQ 111

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARK 177
           +  LPGIG  TA A+++++      ++D N++R+++R+  I          + +      
Sbjct: 112 VLALPGIGRSTAGAVLSLSLGQHHPILDGNVKRVLARHGAIAGWPGQKTVEEQLWQLTDT 171

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T       + QAMMD+GA ICT +KP C +CP+  +C     G+          KK   
Sbjct: 172 LTPQQDIQKYNQAMMDIGASICTRSKPNCAVCPVAIDCKAQLIGRQTDFPG-KKPKKTIP 230

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
              A  + +  DN++ L KR    +  G+   P  A     + ++               
Sbjct: 231 TKAAWMLVLMQDNQVFLAKRPPEGIWGGLWCFPEFATQDALETHL-EEQGFDAQQLEWLT 289

Query: 298 TITHTFTHFTLTLFVWKTIVPQ---------IVIIPDSTWHDAQNLANAALPTVMKKALS 348
              HTF+HF L +      + Q         ++    S W++  + +   L    ++ L+
Sbjct: 290 GFRHTFSHFHLDIQPMMLNLEQTQNNSQMMSVMEQNQSLWYNISHPSRVGLAAATERVLA 349

Query: 349 AGG 351
             G
Sbjct: 350 NLG 352


>gi|33603427|ref|NP_890987.1| putative A/G-specific adenine glycosylase [Bordetella
           bronchiseptica RB50]
 gi|33577551|emb|CAE34816.1| putative A/G-specific adenine glycosylase [Bordetella
           bronchiseptica RB50]
          Length = 358

 Score =  242 bits (616), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 107/359 (29%), Positives = 170/359 (47%), Gaps = 21/359 (5%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
             S+I  W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+++F++
Sbjct: 6   FASRITAWQARHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVATVIPYYQRFLE 57

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++P +  L++A+ E+++  WAGLGYY RARNL +CA  I+++  G FP + E +  LPGI
Sbjct: 58  RFPDVAALAAARQEDVMPYWAGLGYYARARNLHRCAQEIMQRCGGRFPPRAEEIATLPGI 117

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA-----PLYHKTIKNYARKITST 181
           G  TA+AI A A+   + ++D N++R+ +R+F I               +     +    
Sbjct: 118 GRSTAAAIAAFAYGERSPIMDGNVKRVFTRHFGIEGDPARRAVEQQLWALAAAQVQAAPD 177

Query: 182 SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGA 241
                + Q +MDLGA +CT  KP C  CP+ ++C+   +G+   L     +K  P R+  
Sbjct: 178 LDMPGYTQGLMDLGATLCTRGKPACERCPVAQSCIARRDGRQAELPTPKARKAIPERST- 236

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITH 301
             + +   + ILL  R    +  G+  LP    +               A         H
Sbjct: 237 AMLVLHGPDGILLHLRPAPGIWGGLWSLPECDPAHDPGAAARELGLQAEAPVE-LAAFAH 295

Query: 302 TFTHFTLTLFVWKTIVPQIVIIPDS---TWHDAQNLANAALPTVMKKALSAG--GIKVP 355
           TFTH+ L +  W   V    +   +    W     L   ALP  ++K L      +  P
Sbjct: 296 TFTHYRLHVRPWYLAVRGAALRQAATPERWVSPAELPATALPAPVRKLLDGLLAALPAP 354


>gi|308050666|ref|YP_003914232.1| A/G-specific DNA-adenine glycosylase [Ferrimonas balearica DSM
           9799]
 gi|307632856|gb|ADN77158.1| A/G-specific DNA-adenine glycosylase [Ferrimonas balearica DSM
           9799]
          Length = 351

 Score =  242 bits (616), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 100/362 (27%), Positives = 170/362 (46%), Gaps = 17/362 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M         ++LDWY    R  LPW+ +         +PY+VW+SEIMLQQT V TV P
Sbjct: 1   MEANTGSFAKRMLDWYQQYGRKDLPWQQN--------RTPYRVWLSEIMLQQTQVTTVIP 52

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           Y+ KF +++PT+  L++A+D+E++  W GLGYY RARNL K A  +  ++ G FP +++ 
Sbjct: 53  YYLKFTERFPTLIDLANAEDDEVMHLWTGLGYYARARNLLKAARQVRDQHNGEFPTQIDQ 112

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARK 177
           +  LPGIG  TA AI++++ +    ++D N++R+++R+  I            + +    
Sbjct: 113 VMALPGIGRSTAGAILSLSLDQPHPILDGNVKRVLARHQAIEGWPGNKAVENQLWDLTTT 172

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T   +   + QAMMDLGA  C+ +KP CP CP+  +C  +++G+          KK   
Sbjct: 173 LTPAQQVQPYNQAMMDLGASHCSRSKPNCPACPVNDDCRAYAQGRQADYPG-KKPKKEKP 231

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
                 + + + + + L KR    +  G+   P     ++ D               +  
Sbjct: 232 VKACFLLLLRHQDEVYLEKRPGAGIWGGLWCPPQYNDKASLDH--ALLPLKAQQAPQMLT 289

Query: 298 TITHTFTHFTLTLFVWKTIVPQIV---IIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
              HTF+H+ L +      +   +         W          L    ++ L+    + 
Sbjct: 290 PFRHTFSHYHLDIQPVLVQLSAPLSQVAEHPGQWFALGADNRIGLAAPTERLLAELQNQY 349

Query: 355 PQ 356
           PQ
Sbjct: 350 PQ 351


>gi|134296993|ref|YP_001120728.1| A/G-specific DNA-adenine glycosylase [Burkholderia vietnamiensis
           G4]
 gi|134140150|gb|ABO55893.1| A/G-specific DNA-adenine glycosylase [Burkholderia vietnamiensis
           G4]
          Length = 368

 Score =  242 bits (616), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 102/362 (28%), Positives = 174/362 (48%), Gaps = 25/362 (6%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               ++++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+ +F
Sbjct: 18  RTFATRLVAWQRVHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVVPYYTRF 69

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           ++++P +  L++A  +++++ WAGLGYY+RARNL +CA ++V ++ G FP   + L +LP
Sbjct: 70  LERFPDVAALAAAPSDDVMALWAGLGYYSRARNLHRCAQVVVAEHGGVFPSTPDGLAELP 129

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITST- 181
           GIG  TA+AI + A+   A ++D N++R+++R F +            +   A  +    
Sbjct: 130 GIGRSTAAAIASFAYGARATILDGNVKRVLARVFGVEGFPGDKRVENDMWALAESLLPDA 189

Query: 182 ---SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
              +    + Q +MDLGA +C   KP C  CP   +C+  S G+   L     KK  P R
Sbjct: 190 ANAADVSAYTQGLMDLGATLCVRGKPDCARCPFAGDCVAQSTGRQRELPAARPKKAVPTR 249

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
                + + + + +LL +R    +  G+  LP +   +                 +    
Sbjct: 250 KT-WMLVLRDGDAVLLERRPPAGIWGGLWCLPQADGDAALAALAQGFGGGGP---VPLAP 305

Query: 299 ITHTFTHFTLTLFVWKTIVPQI------VIIPDSTWHDAQNLANAALPTVMKKALSAGGI 352
            THTFTHF L +    + +          +  D+ W     L    +P  ++K L A   
Sbjct: 306 FTHTFTHFRLEIEPRLSDMTHGGQAQAAALDADTAWVPLAGLDAYGVPAPVRKLLDALSG 365

Query: 353 KV 354
            +
Sbjct: 366 PL 367


>gi|332162821|ref|YP_004299398.1| adenine DNA glycosylase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|325667051|gb|ADZ43695.1| adenine DNA glycosylase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
          Length = 380

 Score =  242 bits (616), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 104/359 (28%), Positives = 167/359 (46%), Gaps = 16/359 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           +          +L+WY    R  LPW+           +PY+VW+SE+MLQQT V TV P
Sbjct: 17  LMMQAQQFAHVVLEWYQRVGRKTLPWQ--------LDKTPYQVWLSEVMLQQTQVATVIP 68

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF++FM ++P I  L++A  +E+L  W GLGYY RARNL K A  +V+ ++G FP   + 
Sbjct: 69  YFQRFMLRFPDISALAAAPLDEVLHLWTGLGYYARARNLHKAAQTVVEHHQGEFPTTFDE 128

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLY--HKTIKNYARK 177
           +  LPGIG  TA AI++++      ++D N++R+++R + +            +   +  
Sbjct: 129 ILALPGIGRSTAGAILSLSLGQHFPILDGNVKRVLARCYAVEGWPGKKDVEGRLWQISED 188

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T     G F QAMMDLGA++CT +KP C LCP+   CL ++             K+   
Sbjct: 189 VTPAKGVGQFNQAMMDLGAIVCTRSKPKCELCPLNIGCLAYANHSWARYPEKK-PKQTIP 247

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
              A F+ + N +++ L +R    L  G+   P  A     D  +        +      
Sbjct: 248 EKTAYFLLLQNGSQVWLEQRPPVGLWGGLFCFPQFAGQDDLDSWLQQ-RGMAASELQQLT 306

Query: 298 TITHTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIK 353
              HTF+HF L +              D     W++     +  L   +++ L     +
Sbjct: 307 AFRHTFSHFHLDIVPMWLDTASARGCMDDGAGLWYNLAQPPSVGLAAPVERLLLQLAKE 365


>gi|56476954|ref|YP_158543.1| A/G-specific DNA glycosylase [Aromatoleum aromaticum EbN1]
 gi|56312997|emb|CAI07642.1| A/G-specific DNA glycosylase [Aromatoleum aromaticum EbN1]
          Length = 355

 Score =  242 bits (616), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 110/354 (31%), Positives = 173/354 (48%), Gaps = 12/354 (3%)

Query: 5   EHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKK 63
           +    ++++DW+  + R  LPW+         +P PY+VW+SEIMLQQT V TV PY+ +
Sbjct: 4   DKTFATRLVDWHRRHGRHDLPWQHRCD----GVPDPYRVWLSEIMLQQTQVDTVIPYYAR 59

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           F+ ++P +  L++A  +E+L+ W+GLGYY RARNL K A  +   + GNFP + E + +L
Sbjct: 60  FLARFPDLAALAAAPVDEVLTLWSGLGYYARARNLHKAAQAVADFHGGNFPSRAEAIARL 119

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITST 181
           PGIG  TA+AI A AF   A ++D N++R++ R F +            +   A  +   
Sbjct: 120 PGIGRSTAAAIAAFAFGERAAILDGNVKRVLCRAFGVAGFPGQRAVEARLWALAESLLPP 179

Query: 182 SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGA 241
           +  G ++QA MDLGA +C  ++P C  CP+  +C+   E +   L      +K   +   
Sbjct: 180 TDVGTYIQAQMDLGATVCRRSRPACARCPLADSCVARREDRIAELPA-ARPRKAVPQRRV 238

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGS-AWSSTKDGNIDTHSAPFTANWILCNTIT 300
               I    R+LL +R    +  G+  LP            + T  A      +    + 
Sbjct: 239 RVAVIHAAGRVLLEQRPPAGIWGGLLALPEIPDSEPDAGRWLQTRFALAPRASLQLAPLN 298

Query: 301 HTFTHFTLTLFVWKTIVPQI---VIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
           H FTHF L +   +  V      V      W    +L  A LPT +++ L A  
Sbjct: 299 HAFTHFRLEITPIRFDVEDAGRSVAEAGHRWLALADLDAAGLPTPVRRILDALA 352


>gi|322375302|ref|ZP_08049815.1| A/G-specific adenine glycosylase [Streptococcus sp. C300]
 gi|321279565|gb|EFX56605.1| A/G-specific adenine glycosylase [Streptococcus sp. C300]
          Length = 392

 Score =  242 bits (616), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 107/373 (28%), Positives = 167/373 (44%), Gaps = 36/373 (9%)

Query: 2   PQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
            +     + K+L+WYD N R LPWR S         +PY +W+SEIMLQQT V TV PY+
Sbjct: 14  EEKIISFREKLLNWYDENKRDLPWRRS--------KNPYHIWVSEIMLQQTRVDTVIPYY 65

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++F+  +PT+  L++A ++ +L AW GLGYY+R RN++  A  I+  + G FP+  E + 
Sbjct: 66  ERFLDWFPTVESLANAPEDRLLKAWEGLGYYSRVRNMQAAAQQIMTDFGGQFPNTYEGIS 125

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            L GIG YTA AI +IAFN     VD N+ R+++R F++      P   K  +     + 
Sbjct: 126 SLKGIGPYTAGAISSIAFNLPEPAVDGNVMRVLARLFEVDHDIGVPSNRKIFQAMMEILI 185

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              RPGDF QA+MDLG+ I +   P     P++     +  G   +  I   KKK     
Sbjct: 186 DPKRPGDFNQALMDLGSDIESPVNPRPEESPVKDFSAAYQNGTMDVYPIKEPKKKPLPIY 245

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWS------------------------ 275
               +   +  + LL K  + +LL G    P                             
Sbjct: 246 LKALVVRNDRGQYLLEKNESEKLLAGFWHFPLIEVDDFSIFDDQLDLFSQVKEESREFGP 305

Query: 276 STKDGNIDTHSAPFTANWILCNTITHTFTHFTLTLFVWKTIVPQIVIIPD--STWHDAQN 333
           S ++     +      +  + + + H F+H    + +    V +     D    W   Q 
Sbjct: 306 SPQENFEQDYDLEVNWSHQVFDQVKHVFSHRKWHIKILAGQVTETKQFSDREIRWVSPQE 365

Query: 334 LANAALPTVMKKA 346
            ++  L    +K 
Sbjct: 366 FSDYPLAKPQQKI 378


>gi|238786237|ref|ZP_04630183.1| A/G-specific adenine glycosylase [Yersinia bercovieri ATCC 43970]
 gi|238712852|gb|EEQ04918.1| A/G-specific adenine glycosylase [Yersinia bercovieri ATCC 43970]
          Length = 370

 Score =  242 bits (616), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 104/358 (29%), Positives = 167/358 (46%), Gaps = 16/358 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           +          +LDWY    R  LPW+           +PY+VW+SE+MLQQT V TV P
Sbjct: 17  LMMQAQQFAHAVLDWYQRFGRKTLPWQ--------LDKTPYQVWLSEVMLQQTQVATVIP 68

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF++FM ++P I  L++A  +E+L  W GLGYY RARNL K A  +V++++G FP   + 
Sbjct: 69  YFQRFMLRFPDIRALAAAPLDEVLHLWTGLGYYARARNLHKAAQTVVERHQGEFPTTFDE 128

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARK 177
           +  LPGIG  TA AI+++A      ++D N++R+++R + +            +   + +
Sbjct: 129 ILALPGIGRSTAGAILSLALGQHFPILDGNVKRVLARCYAVEGWPGKKEVEGRLWQISEE 188

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T     G F QAMMDLGA++CT +KP C LCP+   C+ ++             K+   
Sbjct: 189 VTPAKGVGQFNQAMMDLGAIVCTRSKPKCELCPLNIGCMAYANHSWARYPGKK-PKQTIP 247

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
              A F+ + N  +  L +R    L  G+   P  A     +  +        +      
Sbjct: 248 EKTAYFLLMQNGTQAWLEQRPPVGLWGGLFCFPQFAEQEELERWLQQ-RGISASGLQQLT 306

Query: 298 TITHTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGI 352
              HTF+HF L +      V       D     W++     +  +   +++ L     
Sbjct: 307 AFRHTFSHFHLDIVPMWLNVESARGCMDDGAGLWYNLTQPPSVGVAAPVERLLHMLAK 364


>gi|33598484|ref|NP_886127.1| putative A/G-specific adenine glycosylase [Bordetella parapertussis
           12822]
 gi|33574613|emb|CAE39263.1| putative A/G-specific adenine glycosylase [Bordetella
           parapertussis]
          Length = 358

 Score =  242 bits (616), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 106/359 (29%), Positives = 169/359 (47%), Gaps = 21/359 (5%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
             S+I  W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+++F++
Sbjct: 6   FASRITAWQARHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVATVIPYYQRFLE 57

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++P +  L++A+ E+++  WAGLGYY RARNL +CA  I+++  G  P + E +  LPGI
Sbjct: 58  RFPDVAALAAARQEDVMPYWAGLGYYARARNLHRCAQEIMQRCGGRLPPRAEEIATLPGI 117

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA-----PLYHKTIKNYARKITST 181
           G  TA+AI A A+   + ++D N++R+ +R+F I               +     +    
Sbjct: 118 GRSTAAAIAAFAYGERSPIMDGNVKRVFTRHFGIEGDPARRAVEQQLWALAAAQVQAAPD 177

Query: 182 SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGA 241
                + Q +MDLGA +CT  KP C  CP+ ++C+   +G+   L     +K  P R+  
Sbjct: 178 LDMPGYTQGLMDLGATLCTRGKPACERCPVAQSCIARRDGRQAELPTPKARKAIPERST- 236

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITH 301
             + +   + ILL  R    +  G+  LP    +               A         H
Sbjct: 237 AMLVLHGPDGILLHLRPAPGIWGGLWSLPECDPAHDPGAAARELGLQAEAPVE-LAAFAH 295

Query: 302 TFTHFTLTLFVWKTIVPQIVIIPDS---TWHDAQNLANAALPTVMKKALSAG--GIKVP 355
           TFTH+ L +  W   V    +   +    W     L   ALP  ++K L      +  P
Sbjct: 296 TFTHYRLHVRPWYLAVRGAALRQAATPERWVSPAELPATALPAPVRKLLDGLLAALPAP 354


>gi|284055514|pdb|3FSP|A Chain A, Muty Adenine Glycosylase Bound To A Transition State
           Analog (1n) Paired With Dg In Duplexed Dna
 gi|284055517|pdb|3FSQ|A Chain A, Muty Adenine Glycosylase Bound To A Transition State
           Analog (1n) Paired With D(8-Oxog) In Duplexed Dna
          Length = 369

 Score =  242 bits (616), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 109/351 (31%), Positives = 169/351 (48%), Gaps = 16/351 (4%)

Query: 4   PEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKK 63
           P    Q  +LDW+    R LPWR            PYKVW+SE+MLQQT V+TV PYF++
Sbjct: 12  PAREFQRDLLDWFARERRDLPWRKD--------RDPYKVWVSEVMLQQTRVETVIPYFEQ 63

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           F+ ++PT+  L+ A ++E+L AW GLGYY+R RNL      +  +Y G  P   +   +L
Sbjct: 64  FIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRL 123

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITST 181
            G+G YT  A++++A+      VD N+ R++SR F +      P   K  +   R+I + 
Sbjct: 124 KGVGPYTVGAVLSLAYGVPEPAVDGNVMRVLSRLFLVTDDIAKPSTRKRFEQIVREIMAY 183

Query: 182 SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGA 241
             PG F +A+++LGAL+CT  +P C LCP+Q  C  F+EG +  L +   K        A
Sbjct: 184 ENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKMKKTAVKQVPLA 243

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAWS-----STKDGNIDTHSAPFTANWILC 296
           V +   ++ R+L+RKR +T LL  + E P             +  +              
Sbjct: 244 VAVLADDEGRVLIRKRDSTGLLANLWEFPSCETDGADGKEKLEQMVGEQYGLQVELTEPI 303

Query: 297 NTITHTFTHFTLTLFVWKTIVPQIVIIPD-STWHDAQNLANAALPTVMKKA 346
            +  H F+H    L V+   +     + +         L   A P   ++ 
Sbjct: 304 VSFEHAFSHLVWQLTVFPGRLVHGGPVEEPYRLAPEDELKAYAFPVSHQRV 354


>gi|320539444|ref|ZP_08039113.1| adenine DNA glycosylase [Serratia symbiotica str. Tucson]
 gi|320030569|gb|EFW12579.1| adenine DNA glycosylase [Serratia symbiotica str. Tucson]
          Length = 361

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 102/360 (28%), Positives = 164/360 (45%), Gaps = 16/360 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  S +L WY    R  LPW+           + Y+VW+SE+MLQQT V TV PYF
Sbjct: 2   MQAQQFASVVLSWYQRYGRKTLPWQ--------LDKTAYQVWLSEVMLQQTQVATVIPYF 53

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++P +  L+ A  +E+L  W GLGYY RARNL K A  IV ++ G FP     + 
Sbjct: 54  QRFMARFPNVRALAEAPLDEVLHLWTGLGYYARARNLHKAAQTIVVQHSGEFPTTYADIA 113

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPGIG  TA A++++A      ++D N++R+++R + +            +   + ++T
Sbjct: 114 ALPGIGRSTAGAVLSLALGQHYPILDGNVKRVLARCYAVEGWPGTKTVENRLWTISEEVT 173

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                G F QAMMDLGA++CT  KP C LCP+  +C+ ++            K+  P   
Sbjct: 174 PAQDVGQFNQAMMDLGAMVCTRTKPKCELCPLNVDCIAYANHHWAKYPGKKPKQTLPE-K 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
            A F+ + +  R+ L +R    L  G+   P  +        +              +  
Sbjct: 233 TAYFLLLQHGERVWLEQRPAVGLWGGLFCFPQFSERDGLVFWLQQRGVKSN-RMEQLSAF 291

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVPQ 356
            HTF+HF L +      +      +      W++     +  L   + + L     + P+
Sbjct: 292 RHTFSHFHLDIVPMWLEMSAVGGGMDEGAGLWYNLAQPPSVGLAAPVDRLLQLLAKQSPR 351


>gi|241764078|ref|ZP_04762116.1| A/G-specific adenine glycosylase [Acidovorax delafieldii 2AN]
 gi|241366609|gb|EER61090.1| A/G-specific adenine glycosylase [Acidovorax delafieldii 2AN]
          Length = 360

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 100/367 (27%), Positives = 167/367 (45%), Gaps = 19/367 (5%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M   +  I  +++ W + + R  LPW+ +          PY+VW+SEIMLQQT V TV  
Sbjct: 1   MSSSQAEIAPRVVRWQEAHGRNHLPWQQT--------RDPYRVWLSEIMLQQTQVSTVLG 52

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           Y+ +F++++P +  L+ A  +++++ W+GLGYY+RARNL +CA ++V  + G FP   E+
Sbjct: 53  YYARFLERFPDVRALAEASQDDVMALWSGLGYYSRARNLHRCAQVVVSDHGGAFPSSAEV 112

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARK 177
           L  LPGIG  TA A+ A  F     ++D N+ R+++R              + +  +A+ 
Sbjct: 113 LATLPGIGRSTAGAVAAFCFAERTPILDANVRRVLTRVLGFDADLAQAKNERALWGHAQA 172

Query: 178 ITSTSR----PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKK 233
           +   +        + Q +MDLGA +C    P C  CP+Q+ C+   EG+     + T K 
Sbjct: 173 LLPVTDIESAMPRYTQGLMDLGAGLCLPRNPDCGGCPLQEGCVASIEGQPERYPVRTRKL 232

Query: 234 KRPMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANW 293
           KR   +  + +      RI L +R    +  G+  +P     +     ++  S       
Sbjct: 233 KRRAESWWLLVLQDAGARIWLSRRPAAGIWAGLFCVPVFDQRTDLLAFVNGVSPAAVNAM 292

Query: 294 ILCNTITHTFTHFTLTLFVWKTIV--PQIVIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
                  H  TH  L L            +   D  W   +  A+  LP  ++K L    
Sbjct: 293 EEQPPFVHVLTHRDLHLHPVTARGLPAAALAGEDGDWFALEKAASLGLPAPIRKLLGELA 352

Query: 352 IK--VPQ 356
                P+
Sbjct: 353 APAAAPR 359


>gi|302877518|ref|YP_003846082.1| A/G-specific adenine glycosylase [Gallionella capsiferriformans
           ES-2]
 gi|302580307|gb|ADL54318.1| A/G-specific adenine glycosylase [Gallionella capsiferriformans
           ES-2]
          Length = 362

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 106/355 (29%), Positives = 172/355 (48%), Gaps = 17/355 (4%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               S ++ W  ++ R  LPW+            PY +W+SEIMLQQT V TV PY+++F
Sbjct: 14  SSFSSSLIAWQRSHGRHDLPWQ---------CADPYCIWLSEIMLQQTQVVTVIPYYQRF 64

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           +  +PTI  L+SA +E++L+ W+GLGYY R RNL + A IIV ++ G FP + E++  LP
Sbjct: 65  VASFPTIAALASATEEQVLAHWSGLGYYARGRNLHRAAQIIVAQHGGAFPRQFELILALP 124

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDI--IKPAPLYHKTIKNYARKITSTS 182
           GIG  TA+AI A+A+     ++D N+ R+++RY  I            +   A  +   +
Sbjct: 125 GIGRSTAAAICALAYQQNRAILDGNVRRVLARYCGIYGSPAIKSVEARLWQQAEALLPLN 184

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
               + QA+MD+GA +CT ++P C  CP+Q +C+    G    L     ++  P    A 
Sbjct: 185 DVDRYTQALMDMGATLCTRSRPKCASCPVQPDCVAHQTGCVADLPTPRQRRVVPE-RTAC 243

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWIL-CNTITH 301
           F+ +  D+ + + +R    +  G+  LP     +        H               TH
Sbjct: 244 FLLLLVDHDVFMERREPAGIWGGLWCLPQFEDEAAALFWCAQHGVEAADRQRDALTPFTH 303

Query: 302 TFTHFTLTLFVWKTIVPQIVII---PDSTWHDAQNLANAALPTVMKKALSAGGIK 353
           TFTHF L +   +  V    +        W    +  ++A+P  ++  L   G+ 
Sbjct: 304 TFTHFKLHITPLRVSVTAKPLHVLQTKGAWLRVSDALSSAIPAPVRTILEGYGVP 358


>gi|296282458|ref|ZP_06860456.1| A/G-specific adenine glycosylase [Citromicrobium bathyomarinum
           JL354]
          Length = 350

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 136/345 (39%), Positives = 185/345 (53%), Gaps = 12/345 (3%)

Query: 1   MPQPEH--IIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVE 58
           M   E    I +++L WYD + R LPWR++P    +    PY+VW+SEIMLQQTTV  V+
Sbjct: 1   MTTRETCAQIPARLLAWYDEHARALPWRSAPGEPPA---DPYRVWLSEIMLQQTTVAAVK 57

Query: 59  PYFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVE 118
           PYF  F  +WP++  L++A  E++++AWAGLGYY+RARNL K A ++ +     FP   +
Sbjct: 58  PYFAAFTARWPSVEALAAAPQEDVMAAWAGLGYYSRARNLVKAAGVVAELGG--FPDTED 115

Query: 119 ILKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKI 178
            L+ LPG+G YTA+AI AIAF   AVVVD N+ER+++R F I  P P     I+  A  I
Sbjct: 116 GLRALPGVGAYTAAAIAAIAFGRRAVVVDANVERVVARLFAIDTPLPGARAAIREGADLI 175

Query: 179 TSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMR 238
           T   R GDF QAMMDLG+ ICT   P C  CP+  +C    +    L       KK    
Sbjct: 176 TPDERSGDFAQAMMDLGSRICTPRAPNCDACPLAADCAGRGDDPERLPV--KAAKKAKPV 233

Query: 239 TGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT 298
                  I  +  + L +R    +L GM  LP   WS+  DG+ D    P    W     
Sbjct: 234 RQGRAYWIEREGAVWLVQRAPEGMLGGMRALPDDGWSAAHDGSGD---PPVAGAWEDAGV 290

Query: 299 ITHTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVM 343
           + HTFTHF + L V +    Q   +    W   + +  A LPT+ 
Sbjct: 291 VRHTFTHFVIELSVLRLENAQKTGLTQGEWWPVERIDEAGLPTLF 335


>gi|153947319|ref|YP_001399803.1| adenine DNA glycosylase [Yersinia pseudotuberculosis IP 31758]
 gi|152958814|gb|ABS46275.1| A/G-specific adenine glycosylase [Yersinia pseudotuberculosis IP
           31758]
          Length = 371

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 105/351 (29%), Positives = 168/351 (47%), Gaps = 16/351 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                    +LDWY    R  LPW+           +PY+VW+SE+MLQQT V TV PYF
Sbjct: 1   MQAQQFAHVVLDWYQRFGRKTLPWQ--------LDKTPYQVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++P I  L++A  +E+L  W GLGYY RARNL K A ++V+ ++G FP   + + 
Sbjct: 53  QRFMLRFPDIQALAAAPLDEVLHLWTGLGYYARARNLHKAAQMVVEHHQGEFPTTFDQIL 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPGIG  TA AI++++      ++D N++R+++R + +            +   +  +T
Sbjct: 113 ALPGIGRSTAGAILSLSLGQHFPILDGNVKRVLARCYAVDGWPGKKEVEGRLWQISEDVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             +  G F QAMMDLGA++CT +KP C LCP+   C+ ++            K+  P   
Sbjct: 173 PANGVGQFNQAMMDLGAMVCTRSKPKCELCPLNIGCMAYANHSWARYPGKKPKQTLPE-K 231

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
            A F+ + N +++ L +R    L  G+   P  A        +     P           
Sbjct: 232 TAWFLLMQNGSQVWLEQRPPVGLWGGLFCFPQFAEQEELIHWLQKQGIPANETQQ-LTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKAL 347
            HTF+HF L +         +    D     W++     +  L   +++ L
Sbjct: 291 RHTFSHFHLDIVPIWLNTASVRGCMDDGAGLWYNLAQPPSVGLAAPVERLL 341


>gi|170079332|ref|YP_001735970.1| A/G-specific adenine glycosylase [Synechococcus sp. PCC 7002]
 gi|169887001|gb|ACB00715.1| A/G-specific adenine glycosylase [Synechococcus sp. PCC 7002]
          Length = 348

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 106/347 (30%), Positives = 168/347 (48%), Gaps = 15/347 (4%)

Query: 7   IIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
            ++  +LDWY    R LPWR  P          Y+VW+SEIMLQQT VKTV PY+++++ 
Sbjct: 11  EMRRSLLDWYQQAGRTLPWRNEP--------DIYRVWVSEIMLQQTQVKTVIPYYERWLA 62

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A  + +L  W GLGYY RARNL + A  +V  + G FP  ++ +  L GI
Sbjct: 63  QFPTVEALAAADLQAVLKQWEGLGYYARARNLHQAAQQVVTDFAGQFPKDLDKMLCLKGI 122

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGD 186
           G  TA  I++ A N    ++D N++R+++R   +  P       + + +  +     P D
Sbjct: 123 GRTTAGGILSSARNLPLAILDGNVKRVLARLIALEVPPAKALNELWDVSETLLDPENPRD 182

Query: 187 FVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAI 246
           F QA+MDLGA +C    P CP CP Q +C  + + +         KK+ P +     IA 
Sbjct: 183 FNQALMDLGATLCMVKNPDCPRCPWQNHCTAYLKHQPTDFPRKAPKKQIPTKKIVAAIAF 242

Query: 247 TNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHF 306
             +N++ +++R    LL G+ E P    +      + T   P        NT+ H +THF
Sbjct: 243 NLENQVFIQQRPQDGLLGGLWEFPNQEGNIQP---LLTDLFPGAQYERRLNTVFHAYTHF 299

Query: 307 TLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIK 353
            + +      V     +  + W   Q+L N        K +      
Sbjct: 300 KIQVEPQIYRVN----LSGAGWVSLQSLKNYPFSKAHLKIIEQLQDP 342


>gi|119900101|ref|YP_935314.1| putative A/G-specific adenine glycosylase [Azoarcus sp. BH72]
 gi|119672514|emb|CAL96428.1| putative A/G-specific adenine glycosylase [Azoarcus sp. BH72]
          Length = 366

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 109/356 (30%), Positives = 172/356 (48%), Gaps = 17/356 (4%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               +++LDW  T+ R  LPW+ S          PY++W+SEIMLQQT V+TV PY+ +F
Sbjct: 19  RDFAARLLDWQRTDGRHDLPWQRSA--------DPYRIWLSEIMLQQTQVETVIPYYARF 70

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           + ++PT+  L++A  E++++ W+GLGYY RARNL + A  +  ++ G FP     + +LP
Sbjct: 71  LDRFPTLADLAAAPVEDVMALWSGLGYYARARNLHRAAVAVATQHGGRFPPSAAAIAELP 130

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTS 182
           GIG  TA+AI A A+   A ++D N++R++ R F I            +   A  +   +
Sbjct: 131 GIGRSTAAAIAAFAYGERAAILDGNVKRVLCRAFGIDGFPGEKAVENRLWALADALLPQA 190

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
             G ++QA MDLGA +CT  KP C  CP   +C+  + G+   L +   +K  P R  + 
Sbjct: 191 EVGRYIQAQMDLGATVCTRGKPACTRCPFAADCVALTTGRVGELPVPRPRKAAPRRH-SR 249

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWS-STKDGNIDTHSAPFTANWILCNTITH 301
              +   +R+LL +R    +  G+  LP      +                      +TH
Sbjct: 250 MAVLRCGDRVLLERRPPAGIWGGLLALPEIPPDGANVGQWTQARFGLRATTMTPLPPLTH 309

Query: 302 TFTHFTLTLFVWKTIVPQIVIIPD----STWHDAQNLANAALPTVMKKALSAGGIK 353
            FTHF L +   +  V       D      W    +   AALPT +++ L      
Sbjct: 310 VFTHFVLEIAPLQIEVEAGGSRADDDGALCWLALSDTTGAALPTPVRRILDGLATP 365


>gi|320155269|ref|YP_004187648.1| A/G-specific adenine glycosylase [Vibrio vulnificus MO6-24/O]
 gi|319930581|gb|ADV85445.1| A/G-specific adenine glycosylase [Vibrio vulnificus MO6-24/O]
          Length = 350

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 105/351 (29%), Positives = 175/351 (49%), Gaps = 17/351 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
             S IL WYD   R  LPW+ +         S Y VW+SEIMLQQT V TV PY+++F+Q
Sbjct: 4   FASAILKWYDAYGRKNLPWQHN--------KSAYSVWLSEIMLQQTQVATVIPYYQRFLQ 55

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A+ +E+L  W GLGYY RARNL K A ++ ++Y G FP ++E +  LPGI
Sbjct: 56  RFPTVVDLANAEQDEVLHLWTGLGYYARARNLHKAAKMVAEQYHGEFPLELEQMNALPGI 115

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++        ++D N++R +SR F +            +   A   T  +  
Sbjct: 116 GRSTAAAVLSSVHKQPHAILDGNVKRTLSRAFAVEGWPGQKTVENQLWQLAEAHTPNTDV 175

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA++CT +KP C LCP+ + C    +G          KK++P++    F 
Sbjct: 176 DKYNQAMMDMGAMVCTRSKPKCTLCPVAELCQANKQGNPLDYPGKKPKKEKPVKET-WFA 234

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDT-HSAPFTANWILCNTITHTF 303
            +  +N++ L +R  + +  G+   P +  +  +                       HTF
Sbjct: 235 MLHYNNQVWLEQRPQSGIWGGLFCFPQNEHAQLEALLEKRGIKEGDIRTQKTLIAFRHTF 294

Query: 304 THFTLTLFVWKTIVPQ----IVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ L +      + +    ++   +  W++  N     L   +K+ L + 
Sbjct: 295 SHYHLDITPILLDLSKQPDMVMEASNGLWYNLANPEEVGLAAPVKQLLESL 345


>gi|312865396|ref|ZP_07725623.1| A/G-specific adenine glycosylase [Streptococcus downei F0415]
 gi|311098914|gb|EFQ57131.1| A/G-specific adenine glycosylase [Streptococcus downei F0415]
          Length = 389

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 109/373 (29%), Positives = 171/373 (45%), Gaps = 34/373 (9%)

Query: 3   QPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFK 62
           +     +  +L WYD   R LPWR +         +PY +W+SEIMLQQT V+TV PY++
Sbjct: 18  KTIESFRRTLLAWYDQEKRDLPWRRT--------KNPYPIWVSEIMLQQTQVQTVIPYYE 69

Query: 63  KFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKK 122
           +F+  +P+I  L+ A +E +L AW GLGYY+R RNL+K A  +++ + G+FP   E +  
Sbjct: 70  RFLAWFPSIKDLAQAPEERLLKAWEGLGYYSRVRNLQKGAQQVMRVFAGDFPKTYEEILS 129

Query: 123 LPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITS 180
           L GIG YTA AI +IAF+     VD N+ R+++R F++      P   K  +    ++  
Sbjct: 130 LQGIGPYTAGAIASIAFDLPEPAVDGNVMRVLARLFEVDYDIGNPSNRKIFQAIMEELID 189

Query: 181 TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG 240
             RPGDF QA+MDLG  I ++  P     PI+     +  G      I   KKK   R  
Sbjct: 190 PERPGDFNQALMDLGTDIESAKNPRPEESPIRAFNAAYLHGTYDKYPIKLPKKKPRPRHL 249

Query: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAW-------------SSTKDGNIDTHSA 287
             F+      + LL K   + LL G    P                    +     +   
Sbjct: 250 QAFVIKNGQGQFLLEKNQESGLLSGFWSFPLMENQLVARQIDLFETLKDKEILETPSLQK 309

Query: 288 PFTANWILCNT--------ITHTFTHFTLTLFVWKTIVPQIVII---PDSTWHDAQNLAN 336
            F  ++ L  +        + HTF+H    + + +  + +  ++    +  W   +    
Sbjct: 310 IFEEDYGLKPSWTKGKFPLVKHTFSHQKWQIKLVEGQLKEGALLKGDKELAWVAPEAFDA 369

Query: 337 AALPTVMKKALSA 349
             + T  KK + A
Sbjct: 370 YPMATPQKKMIEA 382


>gi|74318148|ref|YP_315888.1| A/G-specific DNA-adenine glycosylase [Thiobacillus denitrificans
           ATCC 25259]
 gi|74057643|gb|AAZ98083.1| A/G-specific adenine glycosylase MutY [Thiobacillus denitrificans
           ATCC 25259]
          Length = 344

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 108/350 (30%), Positives = 174/350 (49%), Gaps = 13/350 (3%)

Query: 6   HIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
           +   S+I+ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+ +F
Sbjct: 2   NSFASRIIQWQRCHGRHSLPWQAT--------RDPYRIWLSEIMLQQTQVATVIPYYARF 53

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           + ++P +  L++A ++E+L+ W+GLGYY+RARNL   A  ++ ++ G FP   E + +LP
Sbjct: 54  VARFPDLPALAAAHEDEVLALWSGLGYYSRARNLYAAARTVLDEHAGIFPDVPETIARLP 113

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKITSTS 182
           GIG  TA+AI A+AF     ++D N++R+++R+  I            +   A      +
Sbjct: 114 GIGRSTAAAIAALAFGRACAILDGNVKRVLARHAGINGWPGERKVELALWQLAASRLPQA 173

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
               + Q MMDLGAL+CT   P C  CP+  +C+   +G+   L     +K  P +   +
Sbjct: 174 GVETYTQGMMDLGALVCTRGVPACVRCPVSDDCVARVDGRIEQLPTPRPRKALPEKEVQM 233

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHT 302
            + +  D R+LL KR    +  G+  LP          +   H    T +      ++HT
Sbjct: 234 LLFV-EDGRLLLEKRPPRGIWGGLWSLPELPAEVDAGRHCRDHFGFRTISLRTLPRLSHT 292

Query: 303 FTHFTLTLFVWKTIV-PQIVIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
           FTHF L +   +  V P+    P   W          LP  ++K +   G
Sbjct: 293 FTHFKLHIHPVRLDVSPEGSARPGPVWLPFSAALATGLPAPVRKLVLQLG 342


>gi|281351926|gb|EFB27510.1| hypothetical protein PANDA_008126 [Ailuropoda melanoleuca]
          Length = 502

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 120/403 (29%), Positives = 172/403 (42%), Gaps = 60/403 (14%)

Query: 6   HIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
              +  +L WYD   R LPWR   + E       Y VW+SE+MLQQT V TV  Y+ ++M
Sbjct: 43  RAFRENLLRWYDREKRDLPWRRRAEGEVDLDRRAYAVWVSEVMLQQTQVATVIDYYTRWM 102

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKK-LP 124
           QKWPT+  L+SA  E +   WAGLGYY+R R L + A  +V++  G+ P   E L++ LP
Sbjct: 103 QKWPTLQDLASASLEGVNQLWAGLGYYSRGRRLHEGARKVVEELGGHVPRTAETLQQLLP 162

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDI--IKPAPLYHKTIKNYARKITSTS 182
           G+G YTA AI +IAF     VVD N+ R++ R   I     + L  + + + A+++   +
Sbjct: 163 GVGRYTAGAIASIAFGQATGVVDGNVVRVLCRVRAIGADSSSALVSQHLWSLAQQLVDPA 222

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSE---------------------- 220
           RPGD  QA M+LGA +CT   P C  CP++  C                           
Sbjct: 223 RPGDLNQAAMELGATVCTPQHPRCSQCPVRSLCRAHQRVEREQLLASRSLPGSPDVEECA 282

Query: 221 -----------------------GKSHLLGINTIKKKRPMRTGAVFIAITNDNRILLRKR 257
                                             +++                RILL +R
Sbjct: 283 PGSGQCRLCAPASEPWDPTLGVTNFPRKASRKPPREECSATCVLEQPRAVGGPRILLVQR 342

Query: 258 TNTRLLEGMDELPGSAWSST-------KDGNIDTHSAPFTA-NWILCNTITHTFTHFTLT 309
            N+ LL G+ E P      +           +   + P  A        + HTF+H  LT
Sbjct: 343 PNSGLLAGLWEFPSVTTEPSGQRQRQALLRELQRWAGPLPATRLRHLGQVVHTFSHIKLT 402

Query: 310 LFVW----KTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALS 348
             V+    +   P     P + W   +    AA+ T MKKALS
Sbjct: 403 YEVYGLALEGETPVTTAPPGARWLTREEFHTAAVSTAMKKALS 445


>gi|120556086|ref|YP_960437.1| A/G-specific adenine glycosylase [Marinobacter aquaeolei VT8]
 gi|120325935|gb|ABM20250.1| A/G-specific adenine glycosylase [Marinobacter aquaeolei VT8]
          Length = 354

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 115/357 (32%), Positives = 181/357 (50%), Gaps = 20/357 (5%)

Query: 1   MPQPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           MP        K+L WYD + R  LPW  +         + Y+VW+SEIMLQQT V TV P
Sbjct: 1   MP---DRFADKLLRWYDQHGRHDLPWHHN--------RNAYRVWVSEIMLQQTQVTTVIP 49

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF+ FM ++P +  L+SA  +++L  W+GLGYY RARNL K A  +V ++ G FP   + 
Sbjct: 50  YFEAFMARFPDVHALASAPVDDVLGHWSGLGYYARARNLHKAAKQVVDEFGGEFPADQKQ 109

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARK 177
           L+ L GIG  TA+AIVA AF   A ++D N++R+++RY  +            +  +A  
Sbjct: 110 LENLTGIGRSTAAAIVAQAFEKRATILDGNVKRVLARYHAVPGWPGQAAVLNQLWEHAES 169

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
            T  +R  D+ QA+MDLGA++CT +KP C  CP+   CL ++  +  L   +  K+++P 
Sbjct: 170 HTPEARIKDYTQAIMDLGAMVCTRSKPGCEACPLNDGCLAYARDEIRLYPGSKPKREKPE 229

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMD---ELPGSAWSSTKDGNIDTHSAPFTANWI 294
           +T  + I    + RIL+ +R  + +  G+    EL  +  S                +  
Sbjct: 230 KTTWMLILEDAEGRILMERRPPSGIWGGLWSLPELDPAYGSDELQDACARELGLNCHSPE 289

Query: 295 LCNTITHTFTHFTLTLFVWKTIVP---QIVIIPDSTWHDAQNLANAALPTVMKKALS 348
             +   HTF+H+ L +   +  V    Q+       W   +   +  LP  ++  L+
Sbjct: 290 PISGFRHTFSHYHLHIQPVRLPVAGNTQVGDSDRLRWLHREEALSLGLPAPIRTLLT 346


>gi|292491040|ref|YP_003526479.1| A/G-specific adenine glycosylase [Nitrosococcus halophilus Nc4]
 gi|291579635|gb|ADE14092.1| A/G-specific adenine glycosylase [Nitrosococcus halophilus Nc4]
          Length = 354

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 107/359 (29%), Positives = 178/359 (49%), Gaps = 15/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                   ++L W+D + R  LPW+ +P        +PY+VWISEIMLQQT V TV PY+
Sbjct: 1   MSRTAFSQRLLTWFDAHGRQDLPWKHNP--------TPYRVWISEIMLQQTQVATVIPYY 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++F++++P +  L+ A  +E+L  W GLGYY RARNL + A +  + + G  P  +E L 
Sbjct: 53  QRFIKRFPELPALAQASVDEVLGLWTGLGYYARARNLHRAAQLTWESHGGELPTTLEALI 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKIT 179
           +LPGIG  TA AI+A+A      ++D N++R+++R   I +    P   K +   + ++ 
Sbjct: 113 ELPGIGRSTAGAILALALGQRHPILDGNVKRVLARQEAIPEWPGQPKVEKQLWQRSEELL 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             +R  D+ QA+MDLGA +CT   P CP CP++K C   ++G          +K+ P+RT
Sbjct: 173 PQTRVADYTQAIMDLGATVCTRRHPRCPSCPVKKTCRAHAQGNPEAYPPPRPRKRLPLRT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + + + +   +LL +R    +  G+   P     +                 +    +
Sbjct: 233 TRMLLLLNDQGEVLLERRPPVGIWGGLWSFPECPPRTELALWSQEQLGWPIEEVMTWPPV 292

Query: 300 THTFTHFTLTLFVWKTIVP----QIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
            H FTHFTL +      +     Q++   D  W     +    LP  + + L+    ++
Sbjct: 293 RHHFTHFTLDIQPVVARIQGQRCQVMEPSDRVWCKMGTMHKRGLPAPILRLLARLREQL 351


>gi|258507671|ref|YP_003170422.1| A/G-specific adenine glycosylase [Lactobacillus rhamnosus GG]
 gi|257147598|emb|CAR86571.1| A/G-specific adenine glycosylase [Lactobacillus rhamnosus GG]
          Length = 365

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 112/369 (30%), Positives = 168/369 (45%), Gaps = 24/369 (6%)

Query: 2   PQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
           P+     Q  +LDWYD + R LPWR            PY V +SE+MLQQT V+TV PY+
Sbjct: 5   PEKVAAFQHALLDWYDHHARTLPWRQD--------HDPYHVMVSELMLQQTQVQTVIPYY 56

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FM ++PT+  L++A +  +L AW GLGYY+RAR L++ A  IV  Y G +P     L+
Sbjct: 57  NRFMAQFPTVEALAAAPEATVLKAWEGLGYYSRARRLQQAAKQIVNDYGGKWPQTAAELQ 116

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKIT 179
            L GIG YTA AI +I+F      +D N  R+ +R F +      P   K   +  R + 
Sbjct: 117 TLAGIGPYTAGAIASISFGEVVPAIDGNAFRVFARLFKVDADIARPQTRKVFDDLIRPLM 176

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              RPGDF QA+MDLG+   +++ P     P++    +F +G      + T K +  +  
Sbjct: 177 PKERPGDFNQAVMDLGSSYMSASHPDPAHSPVRAFDASFRDGVVQDYPVKTKKPRPVIHR 236

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILC--- 296
               + I +    LL +R    +L  +   P    +  +           +A +      
Sbjct: 237 Y-FALVIRSKAGYLLEQRPGKGMLADLWMFPLIDMAELEATMESEQLDEISARFADLSGM 295

Query: 297 ---------NTITHTFTHFTLTLFVWKTIVPQI-VIIPDSTWHDAQNLANAALPTVMKKA 346
                      + HTFTH    L +         +    + W   ++    ALPTV KK 
Sbjct: 296 TLTFADLGRPQVQHTFTHQRWQLTLIGADAAAAELKFMPARWVPVEDFGKMALPTVQKKL 355

Query: 347 LSAGGIKVP 355
             A G+  P
Sbjct: 356 NRALGLTEP 364


>gi|194017928|ref|ZP_03056536.1| A/G-specific adenine glycosylase [Bacillus pumilus ATCC 7061]
 gi|194010394|gb|EDW19968.1| A/G-specific adenine glycosylase [Bacillus pumilus ATCC 7061]
          Length = 366

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 112/348 (32%), Positives = 169/348 (48%), Gaps = 17/348 (4%)

Query: 8   IQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQK 67
            Q  +++WY+   R LPWR +          PY+VW+SE+MLQQT V TV PYF +FM++
Sbjct: 16  FQHDLINWYEKEQRTLPWREN--------QDPYRVWVSEVMLQQTRVDTVIPYFNRFMEQ 67

Query: 68  WPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIG 127
           +PT+  L+ A +E+++ AW GLGYY+R RNL+     + + Y G  P   E   KL G+G
Sbjct: 68  FPTVKDLALADEEKVMKAWEGLGYYSRVRNLQAAVKEVYESYGGIVPDTKEQFSKLKGVG 127

Query: 128 DYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTSRPG 185
            YT+ A+++IA+N     VD N+ R+ISR   I      P    T +    ++ S  +P 
Sbjct: 128 PYTSGAVLSIAYNKPYPAVDGNVMRVISRILSIWDDIAKPKTRNTFEFAVDQLISREKPS 187

Query: 186 DFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIA 245
           +F Q +M+LGALICT   P C +CP+  +C    EG  H L + + KKK   ++ A  + 
Sbjct: 188 EFNQGLMELGALICTPTSPACLICPVNMHCSALEEGVQHELPVKSKKKKPTAKSMAAAVL 247

Query: 246 ITNDNRILLRKRTNTRLLEGMDELPGSAW-------SSTKDGNIDTHSAPFTANWILCNT 298
             +   + + KR +T LL  + E P                  +   +        L  T
Sbjct: 248 FDDAGNLYIHKRPSTGLLANLWEFPNLETIKGRKTEKEQLMDFLKEEAGVQAELGDLEGT 307

Query: 299 ITHTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKA 346
           I H FTH    + V+   V  +           +     ALP   +K 
Sbjct: 308 IQHVFTHLIWNISVFFGRVTSVSDDTMLKKVTTEEFKAYALPVSHQKI 355


>gi|83644197|ref|YP_432632.1| A/G-specific adenine glycosylase [Hahella chejuensis KCTC 2396]
 gi|83632240|gb|ABC28207.1| A/G-specific adenine glycosylase [Hahella chejuensis KCTC 2396]
          Length = 388

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 125/359 (34%), Positives = 178/359 (49%), Gaps = 26/359 (7%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
           +   +++L W+D + R  LPW+           +PY VWISEIMLQQT V TV PYF KF
Sbjct: 29  NSFAARLLTWFDQHGRHDLPWQ--------DPRTPYHVWISEIMLQQTQVSTVIPYFIKF 80

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M+ +PT+  L+ A  + +LS WAGLGYY RARNL K A  IV+K+ G FP+ +E +++LP
Sbjct: 81  MESFPTVAALAEADQDTVLSHWAGLGYYARARNLHKAAKTIVEKFNGEFPNTLETIQELP 140

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKITSTS 182
           GIG  TA AI+++ F   A ++D N++R++ R+  I            +   A   T   
Sbjct: 141 GIGRSTAGAILSMGFGIRAPILDGNVKRVLCRHDAIEGWPGKREIETRLWELADAYTPEE 200

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
           R  D+ QA+MDLGA +CT +KP C  CP++  C   ++  +  L      KK P     V
Sbjct: 201 RVTDYTQAIMDLGATLCTRSKPACARCPMETTCQGLAQDMTDQLPTPKAGKKIPTHERFV 260

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNI---DTHSAPFTANWILCNTI 299
            +    D  ILL +R  T +  G+  LP S  +      +     H       + L +  
Sbjct: 261 LVLQNEDGHILLERRPPTGIWGGLWSLPESEKNMDLPDALQSWKEHKRLQLTQYELASPF 320

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIP---------DSTWHDAQ-NLANAALPTVMKKALS 348
            HTF+H+ L L         I             DS W D    L    LP  ++K LS
Sbjct: 321 RHTFSHYHLILKPVIASTADIERPDDLAFIVGESDSQWFDPDQELP--GLPAPIEKWLS 377


>gi|37681068|ref|NP_935677.1| A/G-specific adenine glycosylase [Vibrio vulnificus YJ016]
 gi|37199818|dbj|BAC95648.1| A/G-specific adenine glycosylase [Vibrio vulnificus YJ016]
          Length = 350

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 105/351 (29%), Positives = 175/351 (49%), Gaps = 17/351 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
             S IL WYD   R  LPW+ +         S Y VW+SEIMLQQT V TV PY+++F+Q
Sbjct: 4   FASAILKWYDAYGRKNLPWQHN--------KSAYSVWLSEIMLQQTQVATVIPYYQRFLQ 55

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A+ +E+L  W GLGYY RARNL K A ++ ++Y G FP ++E +  LPGI
Sbjct: 56  RFPTVVDLANAEQDEVLHLWTGLGYYARARNLHKAAKMVAEQYHGEFPLELEQMNALPGI 115

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++        ++D N++R +SR F +            +   A   T  +  
Sbjct: 116 GRSTAAAVLSSVHKQPHAILDGNVKRTLSRAFAVEGWPGQKTVENQLWQLAEAHTPNTDV 175

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA++CT +KP C LCP+ + C    +G          KK++P++    F 
Sbjct: 176 DKYNQAMMDMGAMVCTRSKPKCTLCPVAELCQANKQGNPLDYPGKKPKKEKPVKET-WFA 234

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDT-HSAPFTANWILCNTITHTF 303
            +  +N++ L +R  + +  G+   P +  +  +                       HTF
Sbjct: 235 MLHYNNQVWLEQRPQSGIWGGLFCFPQNEHAQLEALFEKRGIKEGDIRTQNTLIAFRHTF 294

Query: 304 THFTLTLFVWKTIVPQ----IVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ L +      + +    ++   +  W++  N     L   +K+ L + 
Sbjct: 295 SHYHLDITPILLDLSKQPDMVMEASNGLWYNLANPEEVGLAAPVKQLLESL 345


>gi|328474070|gb|EGF44875.1| A/G-specific adenine glycosylase [Vibrio parahaemolyticus 10329]
          Length = 358

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 107/358 (29%), Positives = 167/358 (46%), Gaps = 23/358 (6%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
             S IL+WYD   R  LPW+ +         + Y VW+SEIMLQQT V TV PY++ F++
Sbjct: 4   FASAILEWYDAYGRKDLPWQQN--------KTAYSVWLSEIMLQQTQVTTVIPYYQCFLE 55

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A+ +E+L  W GLGYY RARNL K A  +  KY G FP  +E +  LPGI
Sbjct: 56  RFPTVVDLANAEQDEVLHLWTGLGYYARARNLHKAAKEVAHKYCGEFPLNLEQMNALPGI 115

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++        ++D N++R +SR F +            +   A   T  +  
Sbjct: 116 GRSTAAAVLSSVHKQPHAILDGNVKRTLSRCFAVEGWPGQKKVENQLWEIAEAHTPQTDV 175

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGK---SHLLGINTIKKKRPMRTGA 241
             + QAMMD+GA++CT +KP C LCP+   C+   +G             K  +  R   
Sbjct: 176 DKYNQAMMDMGAMVCTRSKPKCTLCPVADLCVAKKQGNVLDYPGKKPKKEKPVKQTRFVM 235

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAW---SSTKDGNIDTH--SAPFTANWILC 296
           +     N + + L +R  T +  G+   P +      S  D  ++     A         
Sbjct: 236 LHHHNENGHEVWLEQRPQTGIWGGLFCFPQTEHVDVESDIDLLLEQRGIKASDINKQETL 295

Query: 297 NTITHTFTHFTLTLFVWKTIVPQ----IVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
            T  HTF+H+ L +      + +    ++      W++        L   +K  L A 
Sbjct: 296 ITFRHTFSHYHLDITPILIDLSKQPDVVMEGSKGLWYNLSQPEEVGLAAPVKLLLEAL 353


>gi|292487071|ref|YP_003529941.1| A/G-specific adenine glycosylase [Erwinia amylovora CFBP1430]
 gi|292900544|ref|YP_003539913.1| A/G-specific adenine glycosylase [Erwinia amylovora ATCC 49946]
 gi|291200392|emb|CBJ47520.1| A/G-specific adenine glycosylase [Erwinia amylovora ATCC 49946]
 gi|291552488|emb|CBA19533.1| A/G-specific adenine glycosylase [Erwinia amylovora CFBP1430]
 gi|312171175|emb|CBX79434.1| A/G-specific adenine glycosylase [Erwinia amylovora ATCC BAA-2158]
          Length = 358

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 105/347 (30%), Positives = 165/347 (47%), Gaps = 16/347 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                   ++LDWY    R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSQQVLDWYQRYGRKTLPWQ--------LEKTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++P +  L++A  +E+L  W GLGYY RARNL K A  +V K+ G FP     + 
Sbjct: 53  ERFMARFPNVSDLAAAPLDEVLHLWTGLGYYARARNLHKAAQTVVDKHGGVFPQTFAEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPG+G  TA AI+++A      ++D N++R+++R + +          K + + + ++T
Sbjct: 113 DLPGVGRSTAGAILSLALGKHFPILDGNVKRVLARCYAVAGWPARKEVEKRLWHISEEVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             +    F QAMMDLGA++CT +KP C +CP++  C+  +            K+  P RT
Sbjct: 173 PANGVSQFNQAMMDLGAMVCTRSKPKCEICPLKTGCIARAHDSWAQYPGKKPKQTIPQRT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   + +     + L +R    L  G+   P  A        +        +     N  
Sbjct: 233 G-WLLLLQQGQDVWLEQRPPVGLWGGLFCFPQYATECELRLALRA-RGVDDSKLQQMNAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVM 343
            HTF+HF L +      +P      D     W++     +  L   +
Sbjct: 291 RHTFSHFHLDIVPMWLDLPSARAAMDDGAGLWYNLAQPPSVGLAAPV 337


>gi|86748195|ref|YP_484691.1| A/G-specific adenine glycosylase [Rhodopseudomonas palustris HaA2]
 gi|86571223|gb|ABD05780.1| A/G-specific DNA-adenine glycosylase [Rhodopseudomonas palustris
           HaA2]
          Length = 357

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 141/346 (40%), Positives = 184/346 (53%), Gaps = 10/346 (2%)

Query: 10  SKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWP 69
           + +L WYD + RVLPWR            PY VW+SEIMLQQTTV+ V PYF+KFM +WP
Sbjct: 15  AALLVWYDRHRRVLPWR----PPAGVAADPYAVWLSEIMLQQTTVRAVGPYFEKFMARWP 70

Query: 70  TIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDY 129
           ++  L  A  +++L  WAGLGYY+RARNL  CA  +  ++ G FP   + L+ LPG+G Y
Sbjct: 71  SVTALGQASLDDVLRMWAGLGYYSRARNLHACAVAVATQHGGRFPDTEDGLRALPGVGPY 130

Query: 130 TASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQ 189
           TA+AI AIAF    + VD NIER++SR + +    P     I+  AR +   SR GD  Q
Sbjct: 131 TAAAIAAIAFGRQTMPVDGNIERVVSRLYAVEDEMPKAKPRIQELARTLLGPSRAGDSAQ 190

Query: 190 AMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITND 249
           A+MDLGA ICT  KP C LCPI  +C     G +        KK   +R GA F+ I  D
Sbjct: 191 ALMDLGATICTPKKPACALCPIDDDCAARRRGDAETFPRKAPKKTGALRRGAAFVVIRGD 250

Query: 250 NRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTA----NWILCNTITHTFTH 305
             +L  +     LL GM E+P S W S +D       AP              ++H FTH
Sbjct: 251 QVLLRSRV-AKGLLGGMTEVPNSDWLSDQDDAAARAQAPAVTGATRWHRKAGVVSHVFTH 309

Query: 306 FTLTLFVWKTIVPQIVIIPDS-TWHDAQNLANAALPTVMKKALSAG 350
           F L L V+    P     P    W     LA  ALP +M+K ++  
Sbjct: 310 FPLELVVYTAQAPAGTHAPKGMRWEKIATLAGEALPNLMRKVIAHA 355


>gi|118476207|ref|YP_893358.1| A/G-specific DNA-adenine glycosylase [Bacillus thuringiensis str.
           Al Hakam]
 gi|196045278|ref|ZP_03112510.1| A/G-specific adenine glycosylase [Bacillus cereus 03BB108]
 gi|225862501|ref|YP_002747879.1| A/G-specific adenine glycosylase [Bacillus cereus 03BB102]
 gi|229182844|ref|ZP_04310081.1| hypothetical protein bcere0004_4250 [Bacillus cereus BGSC 6E1]
 gi|118415432|gb|ABK83851.1| A/G-specific DNA-adenine glycosylase [Bacillus thuringiensis str.
           Al Hakam]
 gi|196023862|gb|EDX62537.1| A/G-specific adenine glycosylase [Bacillus cereus 03BB108]
 gi|225789742|gb|ACO29959.1| A/G-specific adenine glycosylase [Bacillus cereus 03BB102]
 gi|228600650|gb|EEK58233.1| hypothetical protein bcere0004_4250 [Bacillus cereus BGSC 6E1]
          Length = 365

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 114/355 (32%), Positives = 169/355 (47%), Gaps = 18/355 (5%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               Q+ ++ W++   R LPWR +          PY+VW+SEIMLQQT V+ V+PY+  F
Sbjct: 11  IEQFQNDLIGWFEKEQRDLPWRKN--------KDPYRVWVSEIMLQQTRVEAVKPYYANF 62

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M K+PT+  L++A DEE+L AW GLGYY+RARNL      + + Y G  P  V+ ++KL 
Sbjct: 63  MGKFPTLEALANADDEEVLKAWEGLGYYSRARNLHAAVKEVKEVYGGIVPSDVKKIEKLK 122

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKITSTS 182
           G+G YT  AI++IA+      VD N+ R++SR   +             +   R+I S  
Sbjct: 123 GVGPYTKGAILSIAYGIPEPAVDGNVMRVLSRILSVWDDIAKPKTRKVFEEIVREIISAK 182

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
            P  F Q +M+LGALIC    P C LCP++++C  ++EG    L + +  K   M     
Sbjct: 183 NPSYFNQGLMELGALICIPKNPACLLCPVREHCRGYAEGVQKELPVKSKAKAPTMVPIVA 242

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTIT-- 300
            +  T D R ++ KR +T LL  M E P            +         + L  +I   
Sbjct: 243 GVLQTEDGRYVINKRPSTGLLANMWEFPNVELGEGIRNQKEQLIDYMNEKFELSISIEEY 302

Query: 301 -----HTFTHFTLTLFVWKTIVP-QIVIIPDSTWHDAQNLANAALPTVMKKALSA 349
                HTFTH T  +FV+   V   IV      +   +           +    +
Sbjct: 303 AMNVQHTFTHRTWDIFVFYGKVTGDIVETDTLKFVSKEAFEQLPFSKSHRTIYES 357


>gi|303249010|ref|ZP_07335255.1| A/G-specific adenine glycosylase [Desulfovibrio fructosovorans JJ]
 gi|302489596|gb|EFL49536.1| A/G-specific adenine glycosylase [Desulfovibrio fructosovorans JJ]
          Length = 365

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 114/365 (31%), Positives = 167/365 (45%), Gaps = 28/365 (7%)

Query: 3   QPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFK 62
             ++     +LDW+  N R LPWR +          PY VW+SEIM QQT +  V  YF 
Sbjct: 2   TEQNAFIPLLLDWFAANKRDLPWRRAY--------DPYAVWVSEIMAQQTQMDRVVSYFN 53

Query: 63  KFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKK 122
           +FM+ +P I  L+ A ++ +L AW GLGYY+RARNL   A  I+  + G FP ++  ++ 
Sbjct: 54  RFMELFPDIAALADAPEDAVLKAWEGLGYYSRARNLHAAAKRIMTAHGGVFPGELAAIRA 113

Query: 123 LPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITS 180
           LPGIGDYTA A+ +IAF   AV VD N++R+++R  DI  P   P     +   AR +  
Sbjct: 114 LPGIGDYTAGAVASIAFGRDAVAVDANVQRVLARACDIDVPVKEPAGKTRVMEIARALLP 173

Query: 181 TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG 240
           +SR  ++ +A+M+ GAL+C    P C  CPI   C     G      + T  K       
Sbjct: 174 SSRAREYNEALMEFGALVCRPKNPDCAACPIAGACQAKHLGIVSDRPVLTKAKDITPLNV 233

Query: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKD------GNIDTHSAPFTANWI 294
           A  + +  D  I ++KR        + E PG      +             +A  T    
Sbjct: 234 ATGVLLHADR-IFIQKRLAKGAWGNLWEFPGGRIEPGETPQAAVVREFREETAFATEVAT 292

Query: 295 LCNTITHTFTHFTLTLFVWKTIV-----------PQIVIIPDSTWHDAQNLANAALPTVM 343
               I H +T F +TL  +   +           P++     S W     LA  A P   
Sbjct: 293 KLAVIRHGYTTFRVTLHCFLLRLAGESNGNALPTPELTAAQQSRWVRPDELAGYAFPAGH 352

Query: 344 KKALS 348
           +K + 
Sbjct: 353 RKLID 357


>gi|254492670|ref|ZP_05105841.1| A/G-specific adenine glycosylase [Methylophaga thiooxidans DMS010]
 gi|224462191|gb|EEF78469.1| A/G-specific adenine glycosylase [Methylophaga thiooxydans DMS010]
          Length = 347

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 109/347 (31%), Positives = 166/347 (47%), Gaps = 13/347 (3%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
               +L+WYD   R  LPW+ SP        +PY VW+SEIMLQQT V TV  Y+ +F +
Sbjct: 7   FADALLNWYDQFGRKDLPWQQSP--------TPYHVWLSEIMLQQTQVTTVIDYYLRFTR 58

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++P I  L+ AK +++L+ W+GLGYY RARNL K A I+V  + G  P  +E L  LPGI
Sbjct: 59  RFPGIRSLAQAKQDDVLAYWSGLGYYARARNLHKTAQIVVADFAGEMPKTLEQLIALPGI 118

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA AI+ +A++    ++D N++R+++R+  I            +   A ++    R 
Sbjct: 119 GRSTAGAILTLAYHQPFPILDGNVKRVLTRFDAISGWPGNKQVENKLWQRAEQLLPNRRI 178

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
            +++QA MDLGA +CT +KP C  CP+Q +C  F+ G          KK  P R     +
Sbjct: 179 ANYIQAQMDLGATLCTRSKPDCQNCPMQHHCQAFALGTPTAFPEKKPKKAVPQRQTHWLV 238

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFT 304
              + N I L +R    +  G+   P    +   D                   + H F+
Sbjct: 239 LKNDQNEIYLEQRPQQGIWGGLWSFPEIDKAEDIDVLCRQRFHINITQHQPLPHLQHVFS 298

Query: 305 HFTLTLFVWK--TIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSA 349
           HF L +           I    +  W+  ++     LP  +K  L +
Sbjct: 299 HFKLAIHPHLLQCRAEGIADKDNGNWYKIEDSLTLGLPAPVKSFLQS 345


>gi|158521530|ref|YP_001529400.1| A/G-specific adenine glycosylase [Desulfococcus oleovorans Hxd3]
 gi|158510356|gb|ABW67323.1| A/G-specific adenine glycosylase [Desulfococcus oleovorans Hxd3]
          Length = 360

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 116/360 (32%), Positives = 178/360 (49%), Gaps = 21/360 (5%)

Query: 8   IQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQK 67
            Q ++L WY  + R LPWR S         +PY +W+SE+MLQQT V TV  Y+++F+Q 
Sbjct: 9   FQRRLLRWYTAHQRDLPWRRS--------KNPYHIWVSEVMLQQTQVATVVDYYRRFLQA 60

Query: 68  WPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIG 127
           +P I  L+ A+ +++L  W GLGYY RA NL K A  IV   +   P   E   +LPG+G
Sbjct: 61  FPDIGTLAVAELQDVLKLWEGLGYYARAANLHKAARQIVAGGKKRVPRTPETFGRLPGVG 120

Query: 128 DYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIK--PAPLYHKTIKNYARKITSTSRPG 185
           DY  +A+ +IAF H   VVD N++R+++R F + +    P  H+     AR + +   PG
Sbjct: 121 DYINAAVSSIAFGHPLPVVDGNVKRVLARLFLLDEPVNRPSNHRVFLEKARLLLAFKDPG 180

Query: 186 DFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIA 245
            F QAMM+LGAL+C   +PLC  CP+   C     G+          +K P    AV + 
Sbjct: 181 TFNQAMMELGALVCKPGRPLCDQCPVASFCGAHQAGRVTDFPRRLAARKNPHHHLAVGL- 239

Query: 246 ITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWI------LCNTI 299
           +   NR L+ +R  T LL G+ E+PG      ++       A   +  +          +
Sbjct: 240 VKKGNRFLIVRRPATGLLAGLWEMPGGRVEKPENPADACCRAVLESVGLTVFPGPRLARV 299

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPDST----WHDAQNLANAALPTVMKKALSAGGIKVP 355
            H +THF +T+ ++   V    +  +      W   +++        M KA +A    +P
Sbjct: 300 AHAYTHFKITMDLFACDVVSGRVKRNGYQAHHWIRMKDIGQYPFHRAMHKAFAALAGALP 359


>gi|149693702|ref|XP_001496280.1| PREDICTED: mutY homolog (E. coli) isoform 1 [Equus caballus]
          Length = 519

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 119/401 (29%), Positives = 171/401 (42%), Gaps = 60/401 (14%)

Query: 7   IIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
           + +  +L WYD   R LPWR   + E       Y VW+SE+MLQQT V TV  Y+ ++MQ
Sbjct: 67  VFRESLLSWYDREKRDLPWRRQAEGEVDPDRRAYAVWVSEVMLQQTQVATVINYYTRWMQ 126

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKK-LPG 125
           KWPT+  L+SA  EE+   WAGLGYY+R R L + A  +V++  G+ P   E L++ LPG
Sbjct: 127 KWPTLQDLASASLEEVNQLWAGLGYYSRGRRLLQGARKVVEELGGHMPRTAETLQQLLPG 186

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDI--IKPAPLYHKTIKNYARKITSTSR 183
           +G YTA AI +IAF     VVD N+ R++ R   I     + L  + + + A+++   +R
Sbjct: 187 VGRYTAGAIASIAFGQATGVVDGNVVRVLCRVRAIGADPSSTLVSQQLWSLAQQLVDPTR 246

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVF 243
           PGDF QA MDLGA +CT  +PLC  CP+Q  C      +   L  +              
Sbjct: 247 PGDFNQAAMDLGATVCTPQRPLCSQCPLQSLCRARQRVEREQLSASQSLPGSADVEECAP 306

Query: 244 IAITNDNRIL---------------------------------------------LRKRT 258
           I                                                      L +R 
Sbjct: 307 ITGQCQLCTPPTEPWDQSLGVANFPRKASRKSLREECSATCVLEQPRALGGARILLVQRP 366

Query: 259 NTRLLEGMDELPGSAWSSTKD-------GNIDTHSAPFTA-NWILCNTITHTFTHFTLTL 310
           N+ LL G+ E P      ++          +   + P  A        + H F+H  L  
Sbjct: 367 NSGLLAGLWEFPSVTMEPSEQCQRKALLQELQNWAGPLPATRLQHLGQVVHIFSHIKLIY 426

Query: 311 FVW----KTIVPQIVIIPDSTWHDAQNLANAALPTVMKKAL 347
            V+    +   P     P + W   +    AA+ T MKK  
Sbjct: 427 QVYGLALEGQTPVTDTPPGARWLTREEFHTAAVSTAMKKVF 467


>gi|167835382|ref|ZP_02462265.1| A/G-specific adenine glycosylase [Burkholderia thailandensis
           MSMB43]
          Length = 368

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 101/352 (28%), Positives = 167/352 (47%), Gaps = 25/352 (7%)

Query: 7   IIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
                ++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+ +F+
Sbjct: 19  AFAPTLIAWQRKHGRHGLPWQNT--------RDPYRIWLSEIMLQQTQVSTVVPYYVRFL 70

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
           +++P +  L++A  +++++ WAGLGYY+RARNL +CA  +V+ + G FP   E L +LPG
Sbjct: 71  ERYPDVAALAAAPIDDVMALWAGLGYYSRARNLHRCAQAVVELHGGAFPGSPEALAELPG 130

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITS--- 180
           IG  TA+AI + AF   A ++D N++R+++R F +            +   A  +     
Sbjct: 131 IGRSTAAAIASFAFGARATILDGNVKRVLARVFGVEGFPGDKRVENEMWALAEALLPDVA 190

Query: 181 -TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             +    + Q +MDLGA +C   KP C  CP   +C+    G+   L     KK  P R 
Sbjct: 191 EQADVTAYTQGLMDLGATLCVRGKPDCARCPFAGDCVADRSGRQRELPAARPKKAVPTRR 250

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
               + + + + +LL++R    +  G+  LP +   +              A  +     
Sbjct: 251 T-WMLVLRDGDAVLLQRRPPAGIWGGLWSLPEADGDAALARRAREFGG---AALVPLAPF 306

Query: 300 THTFTHFTLTLFVWKTIVPQIVII------PDSTWHDAQNLANAALPTVMKK 345
           THTFTHF L +      +             ++ W     L    +P  ++K
Sbjct: 307 THTFTHFKLEIEPRLAELDGAAGGALQAADDETAWVALHKLDAYGVPAPVRK 358


>gi|259649018|dbj|BAI41180.1| A/G-specific DNA glycosylase [Lactobacillus rhamnosus GG]
          Length = 372

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 112/369 (30%), Positives = 168/369 (45%), Gaps = 24/369 (6%)

Query: 2   PQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
           P+     Q  +LDWYD + R LPWR            PY V +SE+MLQQT V+TV PY+
Sbjct: 12  PEKVAAFQHALLDWYDHHARTLPWRQD--------HDPYHVMVSELMLQQTQVQTVIPYY 63

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FM ++PT+  L++A +  +L AW GLGYY+RAR L++ A  IV  Y G +P     L+
Sbjct: 64  NRFMAQFPTVEALAAAPEATVLKAWEGLGYYSRARRLQQAAKQIVNDYGGKWPQTAAELQ 123

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKIT 179
            L GIG YTA AI +I+F      +D N  R+ +R F +      P   K   +  R + 
Sbjct: 124 TLAGIGPYTAGAIASISFGEVVPAIDGNAFRVFARLFKVDADIARPQTRKVFDDLIRPLM 183

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              RPGDF QA+MDLG+   +++ P     P++    +F +G      + T K +  +  
Sbjct: 184 PKERPGDFNQAVMDLGSSYMSASHPDPAHSPVRAFDASFRDGVVQDYPVKTKKPRPVIHR 243

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILC--- 296
               + I +    LL +R    +L  +   P    +  +           +A +      
Sbjct: 244 Y-FALVIRSKAGYLLEQRPGKGMLADLWMFPLIDMAELEATMESEQLDEISARFADLSGM 302

Query: 297 ---------NTITHTFTHFTLTLFVWKTIVPQI-VIIPDSTWHDAQNLANAALPTVMKKA 346
                      + HTFTH    L +         +    + W   ++    ALPTV KK 
Sbjct: 303 TLTFADLGRPQVQHTFTHQRWQLTLIGADAAAAELKFMPARWVPVEDFGKMALPTVQKKL 362

Query: 347 LSAGGIKVP 355
             A G+  P
Sbjct: 363 NRALGLTEP 371


>gi|218710638|ref|YP_002418259.1| A/G-specific adenine glycosylase [Vibrio splendidus LGP32]
 gi|218323657|emb|CAV19958.1| A/G-specific adenine glycosylase [Vibrio splendidus LGP32]
          Length = 352

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 100/351 (28%), Positives = 177/351 (50%), Gaps = 17/351 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
             + IL WYD   R  LPW+ +         + Y VW+SEIMLQQT V TV PY+++F++
Sbjct: 4   FATAILKWYDAYGRKELPWQQN--------KTAYSVWLSEIMLQQTQVATVIPYYQRFLE 55

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A+ +E+L  W GLGYY RARNL K A I+ ++Y   FP  +E +  LPGI
Sbjct: 56  RFPTVVDLANAEQDEVLHLWTGLGYYARARNLHKAAKIVAEQYGSEFPLSIEEMNALPGI 115

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++        ++D N++R ++R F +            +  +A   T     
Sbjct: 116 GRSTAAAVLSSVHKLPHAILDGNVKRTLARSFAVEGWPGQKKVENQLWEHAEAHTPNQDV 175

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA++CT +KP C LCPI+  C      +         KK++P++    F+
Sbjct: 176 DKYNQAMMDMGAMVCTRSKPKCTLCPIESMCEAKKLDRQLDFPGKKPKKEKPIKET-WFV 234

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDG-NIDTHSAPFTANWILCNTITHTF 303
            + ++N++ L +R  + +  G+   P +  +  +   ++ +     T +        HTF
Sbjct: 235 ILYHNNQVWLEQRPQSGIWGGLFCFPQNENAEIEHQLDLRSIKDNETDSIKTMIAFRHTF 294

Query: 304 THFTLTLFVWKTIVPQ----IVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ + +      + +    I+      W++        L   +K+ + + 
Sbjct: 295 SHYHIDITPVLVKLDKQPDLIMEGTKGLWYNLSKPEEIGLAAPVKQLIESL 345


>gi|70733862|ref|YP_257502.1| A/G-specific adenine glycosylase [Pseudomonas fluorescens Pf-5]
 gi|68348161|gb|AAY95767.1| A/G-specific adenine glycosylase [Pseudomonas fluorescens Pf-5]
          Length = 355

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 122/355 (34%), Positives = 176/355 (49%), Gaps = 15/355 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                  + +LDWYD + R  LPW+           +PY+VW+SEIMLQQT V TV  YF
Sbjct: 1   MRAEAFSTAVLDWYDRHGRHDLPWQQD--------INPYRVWVSEIMLQQTQVSTVLNYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +FM   PT+  L+ A ++E+L  W GLGYYTRARNL+K A I++ +Y G FP  VE L 
Sbjct: 53  DRFMASLPTVQALAEAPEDEVLHLWTGLGYYTRARNLQKTAKIVMAEYGGEFPRDVEKLT 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
           +LPGIG  TA AI +I+    A ++D N++R+++R+         P   K +   A + T
Sbjct: 113 ELPGIGLSTAGAIASISMGLRAPILDGNVKRVLARFTAQEGYPGEPKVAKQLWAAAERFT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             SR   + QAMMDLGA +CT +KP C LCP+++ C     G      I   +K+ P + 
Sbjct: 173 PHSRVNHYTQAMMDLGATLCTRSKPSCLLCPLERGCEAHMLGLETRYPIPKPRKEVPQKR 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + +    +  ILL +R ++ L  G+  LP              HS        +   +
Sbjct: 233 TLMPMLANREGAILLYRRPSSGLWGGLWSLPELDGLDDIQHLALQHSLELGQQQQMPG-L 291

Query: 300 THTFTHFTLTLFVWKTIVPQI---VIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
            HTF+HF L +  W   V +    V   D  W++        L   +K  L    
Sbjct: 292 VHTFSHFQLAIEPWLIRVEESALHVAEADWLWYNLATPPRLGLAAPVKTLLKRAA 346


>gi|52144790|ref|YP_082039.1| A/G-specific adenine glycosylase [Bacillus cereus E33L]
 gi|229154228|ref|ZP_04282349.1| hypothetical protein bcere0010_4280 [Bacillus cereus ATCC 4342]
 gi|51978259|gb|AAU19809.1| A/G-specific adenine glycosylase [Bacillus cereus E33L]
 gi|228629242|gb|EEK85948.1| hypothetical protein bcere0010_4280 [Bacillus cereus ATCC 4342]
          Length = 365

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 114/355 (32%), Positives = 169/355 (47%), Gaps = 18/355 (5%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               Q+ ++ W++   R LPWR +          PY+VW+SEIMLQQT V+ V+PY+  F
Sbjct: 11  IEQFQNDLIGWFEKEQRDLPWRKN--------KDPYRVWVSEIMLQQTRVEAVKPYYANF 62

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M K+PT+  L++A DEE+L AW GLGYY+RARNL      + + Y G  P  V+ ++KL 
Sbjct: 63  MGKFPTLEALANADDEEVLKAWEGLGYYSRARNLHAAVKEVKEVYGGIVPSDVKKIEKLK 122

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKITSTS 182
           G+G YT  AI++IA+      VD N+ R++SR   +             +   R+I S  
Sbjct: 123 GVGPYTKGAILSIAYGIPEPAVDGNVMRVLSRILSVWDDIAKPKTRKVFEEIVREIISAE 182

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
            P  F Q +M+LGALIC    P C LCP++++C  ++EG    L + +  K   M     
Sbjct: 183 NPSYFNQGLMELGALICIPKNPACLLCPVREHCRGYAEGVQKELPVKSKAKAPTMVPIVA 242

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTIT-- 300
            +  T D R ++ KR +T LL  M E P            +         + L  +I   
Sbjct: 243 GVLQTEDGRYVINKRPSTGLLANMWEFPNIELGEGIRNQKEQLIDYMKEKFELSISIEEY 302

Query: 301 -----HTFTHFTLTLFVWKTIVP-QIVIIPDSTWHDAQNLANAALPTVMKKALSA 349
                HTFTH T  +FV+   V   IV      +   +           +    +
Sbjct: 303 AMNVQHTFTHRTWDIFVFYGKVTGDIVETDTLKFVSKEAFEQLPFSKSHRTIYES 357


>gi|120612251|ref|YP_971929.1| A/G-specific DNA-adenine glycosylase [Acidovorax citrulli AAC00-1]
 gi|120590715|gb|ABM34155.1| A/G-specific DNA-adenine glycosylase [Acidovorax citrulli AAC00-1]
          Length = 363

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 101/367 (27%), Positives = 167/367 (45%), Gaps = 23/367 (6%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M +    I ++++ W   + R  LPW+ +          PY+VW+SEIMLQQT V TV  
Sbjct: 1   MKREVPDIATEVVRWQAVHGRNHLPWQQT--------RDPYRVWLSEIMLQQTQVNTVLD 52

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           Y+ +F++++P +  L++A ++++++ W+GLGYY+RARNL +CA  +V +Y G FP   E 
Sbjct: 53  YYTRFLERFPDVRALAAAPEDDVMALWSGLGYYSRARNLHRCAREVVDRYGGEFPRSAEA 112

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARK 177
           L  LPGIG  TA AI +  F     ++D N+ R+++R         +      + + A +
Sbjct: 113 LAGLPGIGRSTAGAIASFCFAERVPILDANVRRVLTRVLGFDADLAVARNERDLWDRASE 172

Query: 178 ITSTSR----PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKK 233
           +            + Q +MDLGA +CT  KP C LCP+Q  C+    G      + T K 
Sbjct: 173 LLPHDDLQEAMPRYTQGLMDLGASLCTPRKPACILCPLQPQCVAAVAGNPEDYPVRTRKL 232

Query: 234 KRPMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANW 293
            R  +     +    + R+ L++R +  +  G+   P           +    A      
Sbjct: 233 LRRAQAWWFPLLHDGEGRLWLQRRPSEGIWAGLHCPPMFDSREDALQWLAQRGA--GRTP 290

Query: 294 ILCNTITHTFTHFTLTLFVWKTIVPQIVII------PDSTWHDAQNLANAALPTVMKKAL 347
              +T+ H  TH  L L       P+           +  W+ A       LP  ++K L
Sbjct: 291 RELDTVFHVLTHRDLHLHPLLVRGPETAAPGQAEAAQEGGWYTAAQWKALGLPAPVRKLL 350

Query: 348 SAGGIKV 354
               +  
Sbjct: 351 EQLQLPA 357


>gi|240947859|ref|ZP_04752299.1| A/G-specific adenine glycosylase [Actinobacillus minor NM305]
 gi|240297821|gb|EER48257.1| A/G-specific adenine glycosylase [Actinobacillus minor NM305]
          Length = 378

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 115/371 (30%), Positives = 171/371 (46%), Gaps = 35/371 (9%)

Query: 5   EHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKK 63
           E     ++L WY    R  LPW+ +           Y VW+SE+MLQQT V TV PYF++
Sbjct: 16  EAPFAKRVLAWYQQYGRKHLPWQQNKSL--------YGVWLSEVMLQQTQVVTVIPYFER 67

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           FMQ++PT+  L++A  +E+L  W GLGYY RARNL K A  I  ++ G FP     +  L
Sbjct: 68  FMQRFPTVVDLANASIDEVLHLWTGLGYYARARNLHKAAQQIRDEFGGEFPTAFADVLAL 127

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITST 181
            G+G  TA AI++   N    ++D N++R++SRYF +            +      +T T
Sbjct: 128 SGVGRSTAGAILSSVLNAPHPILDGNVKRVLSRYFAVEGWAGEKPVENRLWALTEAVTPT 187

Query: 182 SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGA 241
           S+  DF QAMMDLGA+ICT +KP C LCP++KNC   ++           KK  P    +
Sbjct: 188 SQVADFNQAMMDLGAMICTRSKPKCSLCPLEKNCQANAQQAWADFPAKKPKKALPE-KQS 246

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITH 301
            F+ +     ILL KR    L  G+   P      T    + + +   +          H
Sbjct: 247 YFLILKRGTDILLEKREAKGLWGGLYVFPQFEDFDTLKRFVFSQNLQIS---QQLTAFRH 303

Query: 302 TFTHFTLTLFVWKTIVP----------QIVIIPD----------STWHDAQNLANAALPT 341
           TF+HF L +      +           ++               + W+D  +     L T
Sbjct: 304 TFSHFHLDITPILVELDLQKIDETLPLKVAENSGNYRPSVSSKANYWYDLTSPNEIGLAT 363

Query: 342 VMKKALSAGGI 352
            +K+ L    +
Sbjct: 364 PVKRILDELSL 374


>gi|33594689|ref|NP_882333.1| putative A/G-specific adenine glycosylase [Bordetella pertussis
           Tohama I]
 gi|33564765|emb|CAE44091.1| putative A/G-specific adenine glycosylase [Bordetella pertussis
           Tohama I]
 gi|332384100|gb|AEE68947.1| putative A/G-specific adenine glycosylase [Bordetella pertussis CS]
          Length = 358

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 107/359 (29%), Positives = 170/359 (47%), Gaps = 21/359 (5%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
             S+I  W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+++F++
Sbjct: 6   FASRITAWQARHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVATVIPYYQRFLE 57

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++P +  L++A+ E+++  WAGLGYY RARNL +CA  I+++  G FP + E +  LPGI
Sbjct: 58  RFPDVAALAAARQEDVMPYWAGLGYYARARNLHRCAQEIMQRCVGRFPPRAEEIATLPGI 117

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA-----PLYHKTIKNYARKITST 181
           G  TA+AI A A+   + ++D N++R+ +R+F I               +     +    
Sbjct: 118 GRSTAAAIAAFAYGERSPIMDGNVKRVFTRHFGIEGDPARRAVEQQLWALAAAQVQAAPD 177

Query: 182 SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGA 241
                + Q +MDLGA +CT  KP C  CP+ ++C+   +G+   L     +K  P R+  
Sbjct: 178 LDMPGYTQGLMDLGATLCTRGKPACERCPVAQSCIARRDGRQAELPTPKARKAIPERST- 236

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITH 301
             + +   + ILL  R    +  G+  LP    +               A         H
Sbjct: 237 AMLVLHGPDGILLHLRPAPGIWGGLWSLPECDPAHDPGAAARELGLQAEAPVE-LAAFAH 295

Query: 302 TFTHFTLTLFVWKTIVPQIVIIPDS---TWHDAQNLANAALPTVMKKALSAG--GIKVP 355
           TFTH+ L +  W   V    +   +    W     L   ALP  ++K L      +  P
Sbjct: 296 TFTHYRLHVRPWYLAVRGAALRQAATPERWVSPAELPATALPAPVRKLLDGLLAALPAP 354


>gi|88860286|ref|ZP_01134924.1| A/G-specific adenine glycosylase [Pseudoalteromonas tunicata D2]
 gi|88817484|gb|EAR27301.1| A/G-specific adenine glycosylase [Pseudoalteromonas tunicata D2]
          Length = 356

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 102/350 (29%), Positives = 170/350 (48%), Gaps = 17/350 (4%)

Query: 5   EHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKK 63
                 +++ WY+   R  LPW+           +PYKVW+SEIMLQQT V TV PYF++
Sbjct: 8   ATWFSEQVVAWYECYGRKTLPWQ--------LAKTPYKVWVSEIMLQQTQVATVIPYFER 59

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           FM ++PT+  L+ A ++E+L  W GLGYY RARNL K A +IV  Y G FP  ++ +  L
Sbjct: 60  FMARFPTVEELACAPEDEVLHHWTGLGYYARARNLHKTAKLIVDNYGGQFPTNIDDVIAL 119

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITST 181
           PGIG  TA AI++++      ++D N++R+++R+F +           T+   + +IT  
Sbjct: 120 PGIGRSTAGAILSLSLQQHHPILDGNVKRVLARFFMVEGWYGNKAVENTLWRLSEQITPA 179

Query: 182 SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGA 241
           +    F QAMMDLG+ +C+ ++  C  CP+  +C  +          +  KK+ P+    
Sbjct: 180 NNVTQFNQAMMDLGSSLCSRSQFDCDPCPLNTSCGAYQNQLVKQFPHSKPKKEVPL-KSC 238

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITH 301
             + +     +L+ +R N  +  G+               +  H    +  +   ++ TH
Sbjct: 239 YMLILKYQQSVLMERRPNAGIWGGLHCFFEFESEELMQAYLAQHQINDSVVYQ--DSFTH 296

Query: 302 TFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALS 348
            F+HF LT+      + +    +      W++        L T  KK + 
Sbjct: 297 VFSHFKLTINPVVVELNKQPLSINDAGQLWYNLTLQPKVGLATPTKKLIK 346


>gi|84394056|ref|ZP_00992792.1| A/G-specific adenine glycosylase [Vibrio splendidus 12B01]
 gi|84375298|gb|EAP92209.1| A/G-specific adenine glycosylase [Vibrio splendidus 12B01]
          Length = 353

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 103/351 (29%), Positives = 178/351 (50%), Gaps = 17/351 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
             + IL WYD   R  LPW+ +         + Y VW+SEIMLQQT V TV PY+++F++
Sbjct: 4   FATAILKWYDAFGRKELPWQQN--------KTAYTVWLSEIMLQQTQVATVIPYYQRFLE 55

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A+ +E+L  W GLGYY RARNL K A I+ ++Y G FP  +E +  LPGI
Sbjct: 56  RFPTVIDLANAEQDEVLHLWTGLGYYARARNLHKAAKIVAEQYGGEFPLSIEEMNALPGI 115

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++        ++D N++R ++R F +            +  +A   T     
Sbjct: 116 GRSTAAAVLSSVHKLPHAILDGNVKRTLARSFAVEGWPGQKKVENQLWEHAEAHTPNQDV 175

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA++CT +KP C LCPI+  C      K         KK++P++    F+
Sbjct: 176 DKYNQAMMDMGAMVCTRSKPKCTLCPIESMCEAKKLDKQLDFPGKKPKKEKPIKET-WFV 234

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDG-NIDTHSAPFTANWILCNTITHTF 303
            + ++N++ L +R  + +  G+   P +  +  +   ++ +     T +        HTF
Sbjct: 235 ILYHNNQVWLEQRPQSGIWGGLFCFPQNENAEIEHQLDLRSIKDNETDSIKTMIAFRHTF 294

Query: 304 THFTLTLFVWKTIVPQ----IVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ L +      + +    I+      W++        L   +K+ + + 
Sbjct: 295 SHYHLDITPVLVKLDKQPDLIMEGTKGLWYNLSKPEEIGLAAPVKQLIESL 345


>gi|123443637|ref|YP_001007609.1| adenine DNA glycosylase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122090598|emb|CAL13467.1| A/G-specific adenine glycosylase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|327412796|emb|CAX67802.1| A/G specific adenine glycosylase [Yersinia enterocolitica]
          Length = 362

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 104/357 (29%), Positives = 165/357 (46%), Gaps = 16/357 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                    +L+WY    R  LPW+           +PY+VW+SE+MLQQT V TV PYF
Sbjct: 1   MQAQQFAHMVLEWYQRFGRKTLPWQ--------LDKTPYQVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++P I  L++A  +E+L  W GLGYY RARNL K A  +V++++G FP   + + 
Sbjct: 53  QRFMLRFPDIRALAAAPLDEVLHLWTGLGYYARARNLHKAAQTVVERHQGEFPTTFDEIL 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLY--HKTIKNYARKIT 179
            LPGIG  TA AI++++      ++D N++R+++R + +            +   +  +T
Sbjct: 113 ALPGIGRSTAGAILSLSLGQHFPILDGNVKRVLARCYAVEGWPGKKDVEGRLWQISEDVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                G F QAMMDLGA +CT +KP C LCP+   CL ++             K+     
Sbjct: 173 PAKGVGQFNQAMMDLGATVCTRSKPKCELCPLNIGCLAYANHSWARYPGKK-PKQTIPEK 231

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
            A F+ + N  ++ L +R    L  G+   P  A     D  +        +        
Sbjct: 232 TAYFLLLQNGPQVWLEQRPPVGLWGGLFCFPQFAEQDDLDSWLQQ-RGMAASELQQLTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIK 353
            HTF+HF L +              D     W++     +  L   +++ L     +
Sbjct: 291 RHTFSHFHLDIVPMWLDTASARGCMDDGAGLWYNLAQPPSVGLAAPVERLLLQLAKE 347


>gi|324324560|gb|ADY19820.1| A/G-specific adenine glycosylase [Bacillus thuringiensis serovar
           finitimus YBT-020]
          Length = 365

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 114/355 (32%), Positives = 168/355 (47%), Gaps = 18/355 (5%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               Q+ ++ W++   R LPWR +          PY+VW+SEIMLQQT V+ V+PY+  F
Sbjct: 11  IEQFQNDLIGWFEKEQRDLPWRKN--------KDPYRVWVSEIMLQQTRVEAVKPYYANF 62

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M K+PT+  L++A DEE+L AW GLGYY+RARNL      + + Y G  P  V+ ++KL 
Sbjct: 63  MGKFPTLEALANADDEEVLKAWEGLGYYSRARNLHAAVKEVKEVYGGIVPSDVKKIEKLK 122

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKITSTS 182
           G+G YT  AI++IA+      VD N+ R++SR   +             +   R+I S  
Sbjct: 123 GVGPYTKGAILSIAYGIPEPAVDGNVMRVLSRILSVWDDIAKPKTRKVFEEIVREIISAE 182

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
            P  F Q +M+LGALIC    P C LCP++++C  ++EG    L + +  K   M     
Sbjct: 183 NPSYFNQGLMELGALICIPKNPACLLCPVREHCRGYAEGVQKELPVKSKAKAPTMVPIVA 242

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTIT-- 300
            +  T D R ++ KR +T LL  M E P                      + L  +I   
Sbjct: 243 GVLQTEDGRYVINKRPSTGLLANMWEFPNIELGEGIRNQKKQLIDYMKEKFELSISIEEY 302

Query: 301 -----HTFTHFTLTLFVWKTIVP-QIVIIPDSTWHDAQNLANAALPTVMKKALSA 349
                HTFTH T  +FV+   V   IV      +   +           +    +
Sbjct: 303 AMNVQHTFTHRTWDIFVFYGKVTGDIVETDTLKFVSKEAFEQLPFSKSHRTIYES 357


>gi|46015544|pdb|1RRQ|A Chain A, Muty Adenine Glycosylase In Complex With Dna Containing An
           A:oxog Pair
          Length = 369

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 107/351 (30%), Positives = 168/351 (47%), Gaps = 16/351 (4%)

Query: 4   PEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKK 63
           P    Q  +LDW+    R LPWR            PYKVW+SE+MLQQT V+TV PYF++
Sbjct: 12  PAREFQRDLLDWFARERRDLPWRKD--------RDPYKVWVSEVMLQQTRVETVIPYFEQ 63

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           F+ ++PT+  L+ A ++E+L AW GLGYY+R RNL      +  +Y G  P   +   +L
Sbjct: 64  FIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRL 123

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLY--HKTIKNYARKITST 181
            G+G YT  A++++A+      V+ N+ R++SR F +          K  +   R+I + 
Sbjct: 124 KGVGPYTVGAVLSLAYGVPEPAVNGNVMRVLSRLFLVTDDIAKCSTRKRFEQIVREIMAY 183

Query: 182 SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGA 241
             PG F +A+++LGAL+CT  +P C LCP+Q  C  F+EG +  L +   K        A
Sbjct: 184 ENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKMKKTAVKQVPLA 243

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAWS-----STKDGNIDTHSAPFTANWILC 296
           V +   ++ R+L+RKR +T LL  + E P             +  +              
Sbjct: 244 VAVLADDEGRVLIRKRDSTGLLANLWEFPSCETDGADGKEKLEQMVGEQYGLQVELTEPI 303

Query: 297 NTITHTFTHFTLTLFVWKTIVPQIVIIPD-STWHDAQNLANAALPTVMKKA 346
            +  H F+H    L V+   +     + +         L   A P   ++ 
Sbjct: 304 VSFEHAFSHLVWQLTVFPGRLVHGGPVEEPYRLAPEDELKAYAFPVSHQRV 354


>gi|326423848|ref|NP_760414.2| A/G-specific adenine glycosylase [Vibrio vulnificus CMCP6]
 gi|319999218|gb|AAO09941.2| A/G-specific adenine glycosylase [Vibrio vulnificus CMCP6]
          Length = 350

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 105/351 (29%), Positives = 175/351 (49%), Gaps = 17/351 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
             S IL WYD   R  LPW+ +         S Y VW+SEIMLQQT V TV PY+++F+Q
Sbjct: 4   FASAILKWYDAYGRKNLPWQHN--------KSAYSVWLSEIMLQQTQVATVIPYYQRFLQ 55

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A+ +E+L  W GLGYY RARNL K A ++ ++Y G FP ++E +  LPGI
Sbjct: 56  RFPTVVDLANAEQDEVLHLWTGLGYYARARNLHKAAKMVAEQYHGEFPLELEQMNALPGI 115

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++        ++D N++R +SR F +            +   A   T  +  
Sbjct: 116 GRSTAAAVLSSVHKQPHAILDGNVKRTLSRAFAVEGWPGQKTVENQLWQLAEAHTPNTDV 175

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA++CT +KP C LCP+ + C    +G          KK++P++    F 
Sbjct: 176 DKYNQAMMDMGAMVCTRSKPKCTLCPVAELCQANKQGNPLDYPGKKPKKEKPVKET-WFA 234

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDT-HSAPFTANWILCNTITHTF 303
            +  +N++ L +R  + +  G+   P +  +  +                       HTF
Sbjct: 235 MLHYNNQVWLEQRPQSGIWGGLFCFPQNEHAQLEALLEKRGIKEGDIRTQNTLIAFRHTF 294

Query: 304 THFTLTLFVWKTIVPQ----IVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ L +      + +    ++   +  W++  N     L   +K+ L + 
Sbjct: 295 SHYHLDITPILLDLSKQPDMVMEASNGLWYNLANPGEVGLAAPVKQLLESL 345


>gi|47567289|ref|ZP_00238003.1| A/G-specific adenine glycosylase [Bacillus cereus G9241]
 gi|47556132|gb|EAL14469.1| A/G-specific adenine glycosylase [Bacillus cereus G9241]
          Length = 365

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 114/355 (32%), Positives = 170/355 (47%), Gaps = 18/355 (5%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               Q+ ++ W++   R LPWR +          PY+VW+SEIMLQQT V+ V+PY+  F
Sbjct: 11  IEQFQNDLIGWFEKEQRDLPWRKN--------KDPYRVWVSEIMLQQTRVEAVKPYYANF 62

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M K+PT+  L++A DEE+L AW GLGYY+RARNL      + + Y G  P  V+ ++KL 
Sbjct: 63  MGKFPTLEALANADDEEVLKAWEGLGYYSRARNLHAAVKEVKEVYGGIVPSDVKKIEKLK 122

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKITSTS 182
           G+G YT  AI++IA+      VD N+ R++SR   +             +   R+I S  
Sbjct: 123 GVGPYTKGAILSIAYGIPEPAVDGNVMRVLSRILSVWDDIAKPKTRKVFEEIVREIISAE 182

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
            P  F Q +M+LGALIC    P C LCP++++C  ++EG    L + +  K   M     
Sbjct: 183 NPSYFNQGLMELGALICIPKNPACLLCPVREHCRGYAEGVQKELPVKSKAKAPTMVPIVA 242

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTIT-- 300
            +  T D R ++ KR++T LL  M E P            +         + L  +I   
Sbjct: 243 GVLQTEDGRYVINKRSSTGLLANMWEFPNIELGEGIRNQKEQLIDYMKEKFELSISIEEY 302

Query: 301 -----HTFTHFTLTLFVWKTIVP-QIVIIPDSTWHDAQNLANAALPTVMKKALSA 349
                HTFTH T  +FV+   V   IV      +   +           +    +
Sbjct: 303 AMNVQHTFTHRTWDIFVFYGKVTGDIVETDTLKFVSKEAFEQLPFSKSHRTIYES 357


>gi|258543594|ref|YP_003189027.1| DNA glycosylase A/G-specific MutY [Acetobacter pasteurianus IFO
           3283-01]
 gi|256634672|dbj|BAI00648.1| DNA glycosylase A/G-specific MutY [Acetobacter pasteurianus IFO
           3283-01]
 gi|256637728|dbj|BAI03697.1| DNA glycosylase A/G-specific MutY [Acetobacter pasteurianus IFO
           3283-03]
 gi|256640782|dbj|BAI06744.1| DNA glycosylase A/G-specific MutY [Acetobacter pasteurianus IFO
           3283-07]
 gi|256643837|dbj|BAI09792.1| DNA glycosylase A/G-specific MutY [Acetobacter pasteurianus IFO
           3283-22]
 gi|256646892|dbj|BAI12840.1| DNA glycosylase A/G-specific MutY [Acetobacter pasteurianus IFO
           3283-26]
 gi|256649945|dbj|BAI15886.1| DNA glycosylase A/G-specific MutY [Acetobacter pasteurianus IFO
           3283-32]
 gi|256652935|dbj|BAI18869.1| DNA glycosylase A/G-specific MutY [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655989|dbj|BAI21916.1| DNA glycosylase A/G-specific MutY [Acetobacter pasteurianus IFO
           3283-12]
          Length = 357

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 149/357 (41%), Positives = 195/357 (54%), Gaps = 16/357 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPY 60
           M  P       +L WYD + R LPWR        S P PY+VW+SEIMLQQTTVK V PY
Sbjct: 1   MTHPS---AHALLHWYDRHRRTLPWRV----VGQSHPDPYRVWLSEIMLQQTTVKAVAPY 53

Query: 61  FKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEIL 120
           + +F +K+PT+  L+SA  E++L+AWAGLGYY+RARNL  CA  +V      FP  V+ L
Sbjct: 54  YLRFTEKFPTVQALASADREDVLAAWAGLGYYSRARNLHACAQAVVALGG--FPQDVQGL 111

Query: 121 KKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKN----YAR 176
           + LPGIG YTA+A+ AIAF    V VD N+ER+ +R F I +P P   K +         
Sbjct: 112 RVLPGIGPYTAAAVAAIAFGVPVVPVDGNVERVTARLFAITEPLPPARKKLAQLAITLNA 171

Query: 177 KITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRP 236
              +  RP DF QA+ DLG+ +C+   P C LCP Q  C    +G +  L     K +RP
Sbjct: 172 DREAQERPSDFAQALFDLGSSLCSPRAPACGLCPWQGECAGHKQGIAAELPRKLPKAERP 231

Query: 237 MRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHS-APFTANWIL 295
           +R GA F+A     +ILLRKR    LL  M ELPG+ W        +    APF A W L
Sbjct: 232 VRYGAAFLAQDAAGQILLRKRAEKGLLAAMTELPGTEWRLENWSEAEILQVAPFAAGWKL 291

Query: 296 CNTITHTFTHFTLTLFVWKTIVPQ--IVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
              + H FTHFTL L V+   +       + D      + + + ALP+VM+K    G
Sbjct: 292 AGRVKHVFTHFTLYLDVYVAQIKHFSNQAVSDGFLVPVECVKDTALPSVMQKCFEKG 348


>gi|195977484|ref|YP_002122728.1| A/G-specific adenine glycosylase [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
 gi|225869199|ref|YP_002745147.1| A/G-specific adenine glycosylase [Streptococcus equi subsp.
           zooepidemicus]
 gi|195974189|gb|ACG61715.1| A/G-specific adenine glycosylase [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
 gi|225702475|emb|CAX00383.1| putative A/G-specific adenine glycosylase [Streptococcus equi
           subsp. zooepidemicus]
          Length = 382

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 115/365 (31%), Positives = 166/365 (45%), Gaps = 31/365 (8%)

Query: 7   IIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
             +  +L WYD   R LPWR +          PY +W+SEIMLQQT V TV PY+++F+ 
Sbjct: 19  SFRRTLLAWYDQEKRDLPWRRT--------KDPYHIWVSEIMLQQTQVVTVIPYYERFLD 70

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
            +PT+  L+ A +E +L AW GLGYY+R RN++K A  I+  + G FP     + KL GI
Sbjct: 71  WFPTVEALACADEERLLKAWEGLGYYSRVRNMQKAAQQIMTDFGGIFPSSHADITKLKGI 130

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G YTA AI +IAF+     VD N+ R+++R F+I      P   K  +     +    RP
Sbjct: 131 GPYTAGAISSIAFDLPEPAVDGNVMRVMARLFEIDYDIGDPKNRKIFQAVMEVLIDPDRP 190

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
           GDF QA+MDLG  I  +  P     P++  C  +  G      I   KKK        F+
Sbjct: 191 GDFNQALMDLGTDIEAAKNPRPDESPVRFFCAAYRHGTYDKYPIKEPKKKPRPIQVQAFV 250

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAW-----------------SSTKDGNIDTHSA 287
              +  R+LL K T  RLL G    P                      +     +     
Sbjct: 251 IRDSQGRLLLEKNTQGRLLGGFWSFPLIETDFVSQQLTLFEDKPVVLETMSQTALFEERY 310

Query: 288 PFTANWILC--NTITHTFTHFTLTLFVWKTIVPQIVIIPD--STWHDAQNLANAALPTVM 343
               +W       + HTF+H   T+ + +     + + PD    W   +++A   + T  
Sbjct: 311 GLVPDWSQATFPQVKHTFSHQKWTIELCEGFTDSMPLAPDRELVWVAIEDMAAYPMATPQ 370

Query: 344 KKALS 348
           KK L 
Sbjct: 371 KKMLE 375


>gi|322387743|ref|ZP_08061352.1| A/G-specific adenine glycosylase [Streptococcus infantis ATCC
           700779]
 gi|321141610|gb|EFX37106.1| A/G-specific adenine glycosylase [Streptococcus infantis ATCC
           700779]
          Length = 384

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 106/371 (28%), Positives = 155/371 (41%), Gaps = 35/371 (9%)

Query: 3   QPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFK 62
           +     + K+L WYD N R LPWR S         +PY +W+SEIMLQQT V TV PY++
Sbjct: 15  EKILSFRQKLLAWYDENKRDLPWRRS--------KNPYHIWVSEIMLQQTRVDTVIPYYE 66

Query: 63  KFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKK 122
           +F++ +PT+  L++A +E +L AW GLGYY+R RN++  A  I+ ++ G FP   E +  
Sbjct: 67  RFLESFPTVESLANAPEERLLKAWEGLGYYSRVRNMQTAAQQIMNEFNGEFPSTYEGISS 126

Query: 123 LPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITS 180
           L GIG YTA AI +IAFN     VD N+ R+++R F++      P   K  +     +  
Sbjct: 127 LKGIGPYTAGAISSIAFNLAQPAVDGNVMRVLARLFEVNHDIGNPSNRKIFQAMMEILID 186

Query: 181 TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG 240
             RPGDF QA+MDLG+ I     P     P++     +  G      I   KKK      
Sbjct: 187 PERPGDFNQALMDLGSDIEAPVNPRPEDSPVKDFSAAYQNGTMDRYPIKAPKKKPVPVYL 246

Query: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN--- 297
              +      + LL K  + +LL G    P                       I      
Sbjct: 247 NALVVQNAKGQFLLEKNESEKLLAGFWHFPLIEVDEFSKNEELNLFNQVAEPSIQLGPSP 306

Query: 298 --------------------TITHTFTHFTLTLFVWKTIVPQIVI--IPDSTWHDAQNLA 335
                                + H F+H    + +    V         +  W   +   
Sbjct: 307 QESFEQDYDLEVEWQDSHFEEVKHIFSHRKWHVRILSGQVHDSKEYCDKEVVWLTPEEFN 366

Query: 336 NAALPTVMKKA 346
              L    +K 
Sbjct: 367 LYPLAKPQQKI 377


>gi|89052886|ref|YP_508337.1| A/G-specific DNA-adenine glycosylase [Jannaschia sp. CCS1]
 gi|88862435|gb|ABD53312.1| A/G-specific DNA-adenine glycosylase [Jannaschia sp. CCS1]
          Length = 345

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 140/336 (41%), Positives = 189/336 (56%), Gaps = 8/336 (2%)

Query: 12  ILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPTI 71
           +LDWYD + R LPWR  P +       PY+VW+SEIMLQQTTV  V+ YF++F   WPT+
Sbjct: 1   MLDWYDVHARDLPWRVPPLS--GLDADPYRVWLSEIMLQQTTVAAVKAYFQRFTALWPTV 58

Query: 72  FCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYTA 131
             L++A+D  ++  WAGLGYY RARNL KCA ++V+++ G FP     L +LPGIG YTA
Sbjct: 59  GDLAAAEDAAVMGEWAGLGYYARARNLLKCARVVVEEHGGQFPRTEAELLELPGIGPYTA 118

Query: 132 SAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQAM 191
           +A+ +IAF   A V+D NIER+++R F +  P P     +K +A ++T   RPGD  QA+
Sbjct: 119 AAVASIAFQQPAPVMDGNIERVMARLFAVEDPLPGCKSVLKEHATRLTPNDRPGDHAQAL 178

Query: 192 MDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDNR 251
           MDLGA ICT   P C +CP+ + C     G +  L     KK +P R G V++A   D  
Sbjct: 179 MDLGATICTPKNPACGICPVMEACTAHKRGIAADLPKKAPKKAKPTRLGYVYVARQEDGS 238

Query: 252 ILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN-TITHTFTHFTLTL 310
           +LL  R    LL GM   P S WS            PF A+W      + HTFTHF L L
Sbjct: 239 VLLETREEKGLLGGMLAFPTSDWSEAPTD-----VPPFAADWHDPGLEVRHTFTHFHLRL 293

Query: 311 FVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKA 346
            +  T            +        ++LPT+M+KA
Sbjct: 294 ALRVTNAASDTSPQRGEFLPRALFKPSSLPTLMRKA 329


>gi|30260681|ref|NP_843058.1| A/G-specific adenine glycosylase [Bacillus anthracis str. Ames]
 gi|47525792|ref|YP_017141.1| A/G-specific adenine glycosylase [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49183519|ref|YP_026771.1| A/G-specific adenine glycosylase [Bacillus anthracis str. Sterne]
 gi|165870658|ref|ZP_02215311.1| A/G-specific adenine glycosylase [Bacillus anthracis str. A0488]
 gi|167634699|ref|ZP_02393018.1| A/G-specific adenine glycosylase [Bacillus anthracis str. A0442]
 gi|167640800|ref|ZP_02399059.1| A/G-specific adenine glycosylase [Bacillus anthracis str. A0193]
 gi|170688628|ref|ZP_02879834.1| A/G-specific adenine glycosylase [Bacillus anthracis str. A0465]
 gi|170707101|ref|ZP_02897557.1| A/G-specific adenine glycosylase [Bacillus anthracis str. A0389]
 gi|177655120|ref|ZP_02936750.1| A/G-specific adenine glycosylase [Bacillus anthracis str. A0174]
 gi|190568184|ref|ZP_03021093.1| A/G-specific adenine glycosylase [Bacillus anthracis
           Tsiankovskii-I]
 gi|227816606|ref|YP_002816615.1| A/G-specific adenine glycosylase [Bacillus anthracis str. CDC 684]
 gi|229601734|ref|YP_002865125.1| A/G-specific adenine glycosylase [Bacillus anthracis str. A0248]
 gi|254686910|ref|ZP_05150768.1| A/G-specific adenine glycosylase [Bacillus anthracis str.
           CNEVA-9066]
 gi|254725990|ref|ZP_05187772.1| A/G-specific adenine glycosylase [Bacillus anthracis str. A1055]
 gi|254738863|ref|ZP_05196565.1| A/G-specific adenine glycosylase [Bacillus anthracis str. Western
           North America USA6153]
 gi|254743753|ref|ZP_05201438.1| A/G-specific adenine glycosylase [Bacillus anthracis str. Kruger B]
 gi|254756292|ref|ZP_05208321.1| A/G-specific adenine glycosylase [Bacillus anthracis str. Vollum]
 gi|254762111|ref|ZP_05213960.1| A/G-specific adenine glycosylase [Bacillus anthracis str. Australia
           94]
 gi|30254049|gb|AAP24544.1| A/G-specific adenine glycosylase [Bacillus anthracis str. Ames]
 gi|47500940|gb|AAT29616.1| A/G-specific adenine glycosylase [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49177446|gb|AAT52822.1| A/G-specific adenine glycosylase [Bacillus anthracis str. Sterne]
 gi|164713492|gb|EDR19016.1| A/G-specific adenine glycosylase [Bacillus anthracis str. A0488]
 gi|167511194|gb|EDR86581.1| A/G-specific adenine glycosylase [Bacillus anthracis str. A0193]
 gi|167529773|gb|EDR92521.1| A/G-specific adenine glycosylase [Bacillus anthracis str. A0442]
 gi|170127879|gb|EDS96750.1| A/G-specific adenine glycosylase [Bacillus anthracis str. A0389]
 gi|170667488|gb|EDT18245.1| A/G-specific adenine glycosylase [Bacillus anthracis str. A0465]
 gi|172080269|gb|EDT65359.1| A/G-specific adenine glycosylase [Bacillus anthracis str. A0174]
 gi|190560676|gb|EDV14652.1| A/G-specific adenine glycosylase [Bacillus anthracis
           Tsiankovskii-I]
 gi|227006044|gb|ACP15787.1| A/G-specific adenine glycosylase [Bacillus anthracis str. CDC 684]
 gi|229266142|gb|ACQ47779.1| A/G-specific adenine glycosylase [Bacillus anthracis str. A0248]
          Length = 365

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 114/352 (32%), Positives = 168/352 (47%), Gaps = 18/352 (5%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               Q+ ++ W++   R LPWR +          PY+VW+SEIMLQQT V+ V+PY+  F
Sbjct: 11  IEQFQNDLIGWFEKEQRDLPWRKN--------KDPYRVWVSEIMLQQTRVEAVKPYYANF 62

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M K+PT+  L++A DEE+L AW GLGYY+RARNL      + + Y G  P  V+ ++KL 
Sbjct: 63  MGKFPTLEALANADDEEVLKAWEGLGYYSRARNLHAAVKEVKEVYGGIVPSDVKKIEKLK 122

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKITSTS 182
           G+G YT  AI++IA+      VD N+ R++SR   +             +   R+I S  
Sbjct: 123 GVGPYTKGAILSIAYGIPEPAVDGNVVRVLSRILSVWDDIAKPKTRKVFEEIVREIISAE 182

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
            P  F Q +M+LGALIC    P C LCP++++C  ++EG    L + +  K   M     
Sbjct: 183 NPSYFNQGLMELGALICIPKNPACLLCPVREHCRGYAEGVQKELPVKSKAKAPTMVPIVA 242

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTIT-- 300
            +  T D R ++ KR +T LL  M E P            +         + L  +I   
Sbjct: 243 GVLQTEDGRYVINKRPSTGLLANMWEFPNVELGEGIRNQKEQLIDYMKEKFELSISIEEY 302

Query: 301 -----HTFTHFTLTLFVWKTIVP-QIVIIPDSTWHDAQNLANAALPTVMKKA 346
                HTFTH T  +FV+   V   IV      +   +           +  
Sbjct: 303 AMNVQHTFTHRTWDIFVFYGKVTGDIVETDTLKFVSKEAFEQLPFSKSHRTI 354


>gi|238795061|ref|ZP_04638654.1| A/G-specific adenine glycosylase [Yersinia intermedia ATCC 29909]
 gi|238725609|gb|EEQ17170.1| A/G-specific adenine glycosylase [Yersinia intermedia ATCC 29909]
          Length = 371

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 104/359 (28%), Positives = 171/359 (47%), Gaps = 16/359 (4%)

Query: 1   MPQPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           +         ++L+WY    R  LPW+           +PY+VW+SE+MLQQT V TV P
Sbjct: 17  LMMQAQQFAHEVLEWYQRFGRKTLPWQ--------LDKTPYQVWLSEVMLQQTQVATVIP 68

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF++FM ++P I  L++A  +E+L  W GLGYY RARNL K A  +V++++G FP   + 
Sbjct: 69  YFQRFMLRFPDIRALAAAPLDEVLHLWTGLGYYARARNLHKAAQTVVERHQGEFPTTFDE 128

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARK 177
           +  LPGIG  TA AI++++      ++D N++R+++R + +            +   +  
Sbjct: 129 ILALPGIGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVKGWPGKKEVEGHLWQISED 188

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T     G F QAMMDLGA +CT +KP C LCP+   C+ ++            K+  P 
Sbjct: 189 VTPAQGVGQFNQAMMDLGATVCTRSKPKCELCPLNTGCMAYANHSWARYPGKKPKQTLPE 248

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
              A F+ + N +++ L +R    L  G+   P  A  +  +  +   S   ++      
Sbjct: 249 -KTAYFLLMQNGSQVWLEQRPPVGLWGGLFCFPQFAEQAELERWLQQQS-IASSGLQQLT 306

Query: 298 TITHTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIK 353
              HTF+HF L +              D     W++        L   +++ L     +
Sbjct: 307 AFRHTFSHFHLDIVPMWLNAASSRGCMDDGAGLWYNLAQPPAVGLAAPVERLLHQLAKQ 365


>gi|157691592|ref|YP_001486054.1| adenine glycosylase [Bacillus pumilus SAFR-032]
 gi|157680350|gb|ABV61494.1| adenine glycosylase [Bacillus pumilus SAFR-032]
          Length = 366

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 113/348 (32%), Positives = 169/348 (48%), Gaps = 17/348 (4%)

Query: 8   IQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQK 67
            Q  ++DWY+   R LPWR +          PY+VW+SE+MLQQT V TV PYF +FM++
Sbjct: 16  FQHDLIDWYEKEQRTLPWREN--------QDPYRVWVSEVMLQQTRVDTVIPYFNRFMEQ 67

Query: 68  WPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIG 127
           +PT+  L+ A +E+++ AW GLGYY+R RNL+     + + YEG  P   E   KL G+G
Sbjct: 68  FPTVKDLALADEEKVMKAWEGLGYYSRVRNLQAAVKEVYESYEGVVPDTKEQFSKLKGVG 127

Query: 128 DYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTSRPG 185
            YT+ A+++IA+N     VD N+ R+ISR   I      P      +    ++ S  +P 
Sbjct: 128 PYTSGAVLSIAYNKPYPAVDGNVMRVISRILSIWDDIAKPKTRNIFEFAVDQLISREKPS 187

Query: 186 DFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIA 245
           +F Q +M+LGALICT   P C +CP+  +C    EG  H L + + KKK   ++ A  + 
Sbjct: 188 EFNQGLMELGALICTPTSPACLICPVNMHCSALEEGVQHELPVKSKKKKPTAKSMAAAVL 247

Query: 246 ITNDNRILLRKRTNTRLLEGMDELPGSAW-------SSTKDGNIDTHSAPFTANWILCNT 298
             +   + + KR +T LL  + E P                  +   +        L  T
Sbjct: 248 FDDAGNLYIHKRPSTGLLANLWEFPNLETIKGRKTEKEQLMDFLKEEAGVQAELGDLEGT 307

Query: 299 ITHTFTHFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKA 346
           I H FTH    + V+   V  +           +     ALP   +K 
Sbjct: 308 IQHVFTHLIWNISVFFGRVTSVSDDTMLKKVTTEEFEAYALPVSHQKI 355


>gi|149367040|ref|ZP_01889073.1| A/G-specific adenine glycosylase [Yersinia pestis CA88-4125]
 gi|218928123|ref|YP_002345998.1| adenine DNA glycosylase [Yersinia pestis CO92]
 gi|229837648|ref|ZP_04457810.1| adenine DNA glycosylase [Yersinia pestis Pestoides A]
 gi|229840872|ref|ZP_04461031.1| adenine DNA glycosylase [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229842567|ref|ZP_04462722.1| adenine DNA glycosylase [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229903773|ref|ZP_04518886.1| adenine DNA glycosylase [Yersinia pestis Nepal516]
 gi|115346734|emb|CAL19618.1| A/G-specific adenine glycosylase [Yersinia pestis CO92]
 gi|149290654|gb|EDM40730.1| A/G-specific adenine glycosylase [Yersinia pestis CA88-4125]
 gi|229679543|gb|EEO75646.1| adenine DNA glycosylase [Yersinia pestis Nepal516]
 gi|229690877|gb|EEO82931.1| adenine DNA glycosylase [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229697238|gb|EEO87285.1| adenine DNA glycosylase [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229704336|gb|EEO91347.1| adenine DNA glycosylase [Yersinia pestis Pestoides A]
 gi|320013967|gb|ADV97538.1| adenine DNA glycosylase [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 371

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 104/351 (29%), Positives = 168/351 (47%), Gaps = 16/351 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                    +LDWY    R  LPW+           +PY+VW+SE+MLQQT V TV PYF
Sbjct: 1   MQAQQFAHVVLDWYQHFGRKTLPWQ--------LDKTPYQVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++P I  L++A  +++L  W GLGYY RARNL K A ++V+ ++G FP   + + 
Sbjct: 53  QRFMLRFPDIQALAAAPLDDVLHLWTGLGYYARARNLHKAAQMVVEHHQGEFPTTFDQIL 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPGIG  TA AI++++      ++D N++R+++R + +            +   +  +T
Sbjct: 113 ALPGIGRSTAGAILSLSLGQHFPILDGNVKRVLARCYAVDGWPGKKEVEGRLWQISEDVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             +  G F QAMMDLGA++CT +KP C LCP+   C+ ++            K+  P   
Sbjct: 173 PANGVGQFNQAMMDLGAMVCTRSKPKCELCPLNIGCMAYANHSWARYPGKKPKQTLPE-K 231

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
            A F+ + N +++ L +R    L  G+   P  A        +     P           
Sbjct: 232 TAWFLLMQNGSQVWLEQRPPVGLWGGLFCFPQFAEQEELIHWLQKQGIPANETQQ-LTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKAL 347
            HTF+HF L +         +    D     W++     +  L   +++ L
Sbjct: 291 RHTFSHFHLDIVPIWLNTASVRGCMDDGAGLWYNLAQPPSVGLAAPVERLL 341


>gi|238763271|ref|ZP_04624236.1| A/G-specific adenine glycosylase [Yersinia kristensenii ATCC 33638]
 gi|238698544|gb|EEP91296.1| A/G-specific adenine glycosylase [Yersinia kristensenii ATCC 33638]
          Length = 357

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 104/357 (29%), Positives = 168/357 (47%), Gaps = 16/357 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                    +L+WY +  R  LPW+           +PY+VW+SE+MLQQT V TV PYF
Sbjct: 2   MQAQQFAHVVLEWYQSFGRKTLPWQ--------LDKTPYQVWLSEVMLQQTQVATVIPYF 53

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++P I  L++A  +E+L  W GLGYY RARNL K A  +V++++G FP   + + 
Sbjct: 54  QRFMLRFPDIRALAAAPLDEVLHLWTGLGYYARARNLHKAAQTVVERHQGEFPTTFDDIL 113

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPGIG  TA AI++++      ++D N++R+++R + +            +   +  +T
Sbjct: 114 ALPGIGRSTAGAILSLSLGQHFPILDGNVKRVLARCYAVEGWPGKKEVEGRLWQISENVT 173

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                G F QAMMDLGA++CT +KP C LCP+   CL ++             K+     
Sbjct: 174 PAKEVGQFNQAMMDLGAIVCTRSKPKCELCPLNIGCLAYANHSWARYPGKK-PKQTIPEK 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
            A F+ + N  ++ L +R    L  G+   P  A   + D  +        +        
Sbjct: 233 TAYFLLLQNGPQVWLEQRPPVGLWGGLFCFPQFAERESLDSWLQQ-RGMSASELQQLTAF 291

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIK 353
            HTF+HF L +              D     W++     +  L   +++ L     +
Sbjct: 292 RHTFSHFHLDIVPMWLNTVSGRGCMDDGAGLWYNLAQPPSVGLAAPVERLLLQLAKE 348


>gi|259909624|ref|YP_002649980.1| adenine DNA glycosylase [Erwinia pyrifoliae Ep1/96]
 gi|224965246|emb|CAX56778.1| A/G-specific adenine glycosylase [Erwinia pyrifoliae Ep1/96]
 gi|283479702|emb|CAY75618.1| A/G-specific adenine glycosylase [Erwinia pyrifoliae DSM 12163]
          Length = 358

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 107/347 (30%), Positives = 166/347 (47%), Gaps = 16/347 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                   ++LDWY    R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 1   MQASQFSQQVLDWYQRYGRKTLPWQ--------LEKTPYKVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++P +  L++A  +E+L  W GLGYY RARNL K A  +V+K+ G FPH    + 
Sbjct: 53  ERFMARFPNVSDLAAAPLDEVLHLWTGLGYYARARNLHKAAQTVVEKHGGVFPHTFAEVA 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPG+G  TA AI+++A      ++D N++R+++R + +          K +   + ++T
Sbjct: 113 DLPGVGRSTAGAILSLALGKHFPILDGNVKRVLARCYAVAGWPARKEVEKRLWQISEEVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             +    F QAMMDLGA++CT +KP C +CP+   C+ ++ G          K+  P RT
Sbjct: 173 PANGVRQFNQAMMDLGAMVCTRSKPKCEICPLNTGCIAYAHGSWAQYPGKKPKQTIPQRT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G + +       + L +R    L  G+   P  A        +              N  
Sbjct: 233 GWLLLM-QQGQDVWLEQRPPVGLWGGLFCFPQYATECELRLALRA-RGVDDGQLQQMNAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVM 343
            HTF+HF L +      +P   +  D     W++        L   +
Sbjct: 291 RHTFSHFHLDIVPMWLDLPSARVAMDDGAGLWYNLAQPPAVGLAAPV 337


>gi|260574054|ref|ZP_05842059.1| HhH-GPD family protein [Rhodobacter sp. SW2]
 gi|259023520|gb|EEW26811.1| HhH-GPD family protein [Rhodobacter sp. SW2]
          Length = 349

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 146/342 (42%), Positives = 191/342 (55%), Gaps = 7/342 (2%)

Query: 11  KILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTVEPYFKKFMQKWP 69
            +L WYD   RVLPWR SP      +   PY+VW+SE+MLQQTTV  V+ YF +F  +WP
Sbjct: 12  ALLAWYDRAARVLPWRVSPGDRALGVRPDPYRVWLSEVMLQQTTVAAVQGYFHRFTTRWP 71

Query: 70  TIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDY 129
            +  L++A D E+++ WAGLGYY RARNL  CA  +V  + G FP + E L+ LPGIG Y
Sbjct: 72  DVAALAAAADAEVMAEWAGLGYYARARNLLACARAVVADHGGQFPSRREALQALPGIGPY 131

Query: 130 TASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQ 189
           TA+AI AIA +   VVVD N+ER+++R F   +P P     +   A + T   RPGD  Q
Sbjct: 132 TAAAIAAIAHDAAEVVVDGNVERVMARLFAHPEPMPAAKPALIGLAAQFTPRLRPGDHAQ 191

Query: 190 AMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITND 249
           A+MDLGA ICT   P CP CP+ + C   + G    L     K ++P+R G V+IA   D
Sbjct: 192 AVMDLGATICTPRNPTCPDCPLAEFCAACAMGLQAELPRKLAKPEKPIRQGVVWIARRAD 251

Query: 250 NRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLT 309
              LL +R    LL GM   PG+ W  +        + P  A+W     + HTFTHF LT
Sbjct: 252 GAWLLEQRPERGLLGGMLGWPGTGWDGSD------AAPPLDADWQAAGEVRHTFTHFHLT 305

Query: 310 LFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGG 351
           L V     PQ        +  A     A LPT+M+KA +A G
Sbjct: 306 LTVLHAETPQNATPDRGCFLGANAFRPADLPTLMRKAHAAIG 347


>gi|196034710|ref|ZP_03102118.1| A/G-specific adenine glycosylase [Bacillus cereus W]
 gi|196040118|ref|ZP_03107420.1| A/G-specific adenine glycosylase [Bacillus cereus NVH0597-99]
 gi|218901661|ref|YP_002449495.1| A/G-specific adenine glycosylase [Bacillus cereus AH820]
 gi|228913208|ref|ZP_04076847.1| hypothetical protein bthur0012_4520 [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228944274|ref|ZP_04106650.1| hypothetical protein bthur0007_4490 [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|229089583|ref|ZP_04220849.1| hypothetical protein bcere0021_4300 [Bacillus cereus Rock3-42]
 gi|300119081|ref|ZP_07056792.1| A/G-specific adenine glycosylase [Bacillus cereus SJ1]
 gi|195992753|gb|EDX56713.1| A/G-specific adenine glycosylase [Bacillus cereus W]
 gi|196028973|gb|EDX67578.1| A/G-specific adenine glycosylase [Bacillus cereus NVH0597-99]
 gi|218539710|gb|ACK92108.1| A/G-specific adenine glycosylase [Bacillus cereus AH820]
 gi|228693734|gb|EEL47431.1| hypothetical protein bcere0021_4300 [Bacillus cereus Rock3-42]
 gi|228815425|gb|EEM61670.1| hypothetical protein bthur0007_4490 [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228846613|gb|EEM91626.1| hypothetical protein bthur0012_4520 [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|298723697|gb|EFI64428.1| A/G-specific adenine glycosylase [Bacillus cereus SJ1]
          Length = 365

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 114/352 (32%), Positives = 168/352 (47%), Gaps = 18/352 (5%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               Q+ ++ W++   R LPWR +          PY+VW+SEIMLQQT V+ V+PY+  F
Sbjct: 11  IEQFQNDLIGWFEKEQRDLPWRKN--------KDPYRVWVSEIMLQQTRVEAVKPYYANF 62

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M K+PT+  L++A DEE+L AW GLGYY+RARNL      + + Y G  P  V+ ++KL 
Sbjct: 63  MGKFPTLEALANADDEEVLKAWEGLGYYSRARNLHAAVKEVKEVYGGIVPSDVKKIEKLK 122

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKITSTS 182
           G+G YT  AI++IA+      VD N+ R++SR   +             +   R+I S  
Sbjct: 123 GVGPYTKGAILSIAYGIPEPAVDGNVMRVLSRILSVWDDIAKPKTRKVFEEIVREIISAE 182

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
            P  F Q +M+LGALIC    P C LCP++++C  ++EG    L + +  K   M     
Sbjct: 183 NPSYFNQGLMELGALICIPKNPACLLCPVREHCRGYAEGVQKELPVKSKAKAPTMVPIVA 242

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTIT-- 300
            +  T D R ++ KR +T LL  M E P            +         + L  +I   
Sbjct: 243 GVLQTEDGRYVINKRPSTGLLANMWEFPNVELGEGIRNQKEQLIDYMKEKFELSISIEEY 302

Query: 301 -----HTFTHFTLTLFVWKTIVP-QIVIIPDSTWHDAQNLANAALPTVMKKA 346
                HTFTH T  +FV+   V   IV      +   +           +  
Sbjct: 303 AMNVQHTFTHRTWDIFVFYGKVTGDIVETDTLKFVSKEAFEQLPFSKSHRTI 354


>gi|84502794|ref|ZP_01000907.1| A/G-specific adenine glycosylase [Oceanicola batsensis HTCC2597]
 gi|84388777|gb|EAQ01647.1| A/G-specific adenine glycosylase [Oceanicola batsensis HTCC2597]
          Length = 357

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 148/352 (42%), Positives = 201/352 (57%), Gaps = 11/352 (3%)

Query: 9   QSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKW 68
              +L+WYD + R LPWR  P   +S  P PY++W+SE+MLQQTTV  V  YF++F Q W
Sbjct: 12  SDTLLEWYDRHARDLPWRVPPGAARS--PDPYRIWLSEVMLQQTTVAAVRAYFERFTQLW 69

Query: 69  PTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGD 128
           PT+  L+ A D  +++ WAGLGYY RARNL KCA ++  +++G FP + E L KLPGIG 
Sbjct: 70  PTVADLAQADDGRVMAEWAGLGYYARARNLLKCARVVAAEHQGRFPDRQEDLLKLPGIGP 129

Query: 129 YTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFV 188
           YTA+AI AIAF+  AVV+D N+ER+++R  DI  P P     +K  A  +T  +RPGD+ 
Sbjct: 130 YTAAAIAAIAFDRPAVVMDGNVERVMARLHDIHTPLPAAKPELKAEAAALTPAARPGDYA 189

Query: 189 QAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITN 248
           QA+MDLGA ICT   P C +CP +  CL  + G + +L     KK +P+R G  ++  T 
Sbjct: 190 QAVMDLGATICTPRSPACGICPWRAPCLARARGTAAVLPRKAPKKAKPVRLGIAYVGRTP 249

Query: 249 DNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN-TITHTFTHFT 307
               LL +R ++ LL GM   PGS W+ T        + P  A W        HTFTHF 
Sbjct: 250 GGDWLLERRPDSGLLGGMLGWPGSPWAET----TPAETPPVAARWCDVGAEARHTFTHFH 305

Query: 308 LT--LFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKA--LSAGGIKVP 355
           L   L V      Q+                + LPTVM+KA  L+ G ++ P
Sbjct: 306 LRLALRVAVIDPAQVPADGPLLLVPKHRFRPSDLPTVMRKAFDLAHGAMESP 357


>gi|220927383|ref|YP_002502685.1| A/G-specific adenine glycosylase [Methylobacterium nodulans ORS
           2060]
 gi|219951990|gb|ACL62382.1| A/G-specific adenine glycosylase [Methylobacterium nodulans ORS
           2060]
          Length = 405

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 152/341 (44%), Positives = 190/341 (55%), Gaps = 9/341 (2%)

Query: 9   QSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKW 68
            + +L WYD + R LPWR     E  ++P PY+VW+SEIMLQQTTV  V+PYF +F+ ++
Sbjct: 13  AADLLVWYDRHRRALPWR----AEAGAVPDPYRVWLSEIMLQQTTVAAVKPYFARFLDRF 68

Query: 69  PTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGD 128
           PTI  L++A +E ++SAWAGLGYY+RARNL  CA  +V      FP  VE L+KLPGIG 
Sbjct: 69  PTIAALAAAPEEAVMSAWAGLGYYSRARNLHACAKAVVAAGG--FPDTVEGLRKLPGIGA 126

Query: 129 YTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFV 188
           YTA AI AIAF+     VD N+ER+ISR F I  P P     I+  A  +    RPGDF 
Sbjct: 127 YTAGAIAAIAFDRREAAVDGNVERVISRLFAIETPLPAAKPEIRTLAESLVPARRPGDFA 186

Query: 189 QAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAIT- 247
           QA+MDLGA ICT  +P C LCP    C   +EG          K+   +R GA F+A+  
Sbjct: 187 QAVMDLGATICTPKRPACALCPWMPPCRARAEGLQETFPRKLRKEPGLLRKGAAFVAVRA 246

Query: 248 NDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILC-NTITHTFTHF 306
            D  ILLR R    LL  M E P SAW+   D       AP  A W      + HTFTHF
Sbjct: 247 GDEAILLRTRPPEGLLGSMAEPPTSAWTPDYDPARGLLDAPLDARWKRLPGVVRHTFTHF 306

Query: 307 TLTLFVWKTIVPQIVIIPDS-TWHDAQNLANAALPTVMKKA 346
            L L V+   V    + P+   +     L    LP  MKK 
Sbjct: 307 PLELTVFLARVSAATVAPEGMRFTPRAELDGEPLPGAMKKV 347


>gi|46015547|pdb|1RRS|A Chain A, Muty Adenine Glycosylase In Complex With Dna Containing An
           Abasic Site
 gi|62738158|pdb|1VRL|A Chain A, Muty Adenine Glycosylase In Complex With Dna And Soaked
           Adenine Free Base
          Length = 369

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 108/351 (30%), Positives = 169/351 (48%), Gaps = 16/351 (4%)

Query: 4   PEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKK 63
           P    Q  +LDW+    R LPWR            PYKVW+SE+MLQQT V+TV PYF++
Sbjct: 12  PAREFQRDLLDWFARERRDLPWRKD--------RDPYKVWVSEVMLQQTRVETVIPYFEQ 63

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           F+ ++PT+  L+ A ++E+L AW GLGYY+R RNL      +  +Y G  P   +   +L
Sbjct: 64  FIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRL 123

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITST 181
            G+G YT  A++++A+      V+ N+ R++SR F +      P   K  +   R+I + 
Sbjct: 124 KGVGPYTVGAVLSLAYGVPEPAVNGNVMRVLSRLFLVTDDIAKPSTRKRFEQIVREIMAY 183

Query: 182 SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGA 241
             PG F +A+++LGAL+CT  +P C LCP+Q  C  F+EG +  L +   K        A
Sbjct: 184 ENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKMKKTAVKQVPLA 243

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAWS-----STKDGNIDTHSAPFTANWILC 296
           V +   ++ R+L+RKR +T LL  + E P             +  +              
Sbjct: 244 VAVLADDEGRVLIRKRDSTGLLANLWEFPSCETDGADGKEKLEQMVGEQYGLQVELTEPI 303

Query: 297 NTITHTFTHFTLTLFVWKTIVPQIVIIPD-STWHDAQNLANAALPTVMKKA 346
            +  H F+H    L V+   +     + +         L   A P   ++ 
Sbjct: 304 VSFEHAFSHLVWQLTVFPGRLVHGGPVEEPYRLAPEDELKAYAFPVSHQRV 354


>gi|224371723|ref|YP_002605887.1| MutY [Desulfobacterium autotrophicum HRM2]
 gi|223694440|gb|ACN17723.1| MutY [Desulfobacterium autotrophicum HRM2]
          Length = 364

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 110/353 (31%), Positives = 169/353 (47%), Gaps = 21/353 (5%)

Query: 7   IIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
            IQ+ +L WY T+HR LPWR +         +PY +W+SE+MLQQT VKTV PY+ +FM+
Sbjct: 3   EIQTALLKWYHTHHRELPWRKTA--------NPYSIWVSEVMLQQTQVKTVVPYYGRFME 54

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
            +PT+  L+ A  E++L  W GLGYY RARN  K    +    +G  P  ++  K LPG+
Sbjct: 55  AFPTVASLARADLEQVLKLWEGLGYYARARNFHKACQTVTTDLKGIIPRDLKGFKALPGV 114

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYF--DIIKPAPLYHKTIKNYARKITSTSRP 184
           GDY A+A+++IAFN    VVD N++R+++R F  D        HK  +  A  I   S P
Sbjct: 115 GDYIAAAVLSIAFNIPLAVVDGNVKRVLARVFTMDDPVNHGPSHKKFQAKADLILDRSCP 174

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
           G F QA+M+LGAL+C+   P C +CP+ + C            +    K  P    A  +
Sbjct: 175 GAFNQAVMELGALVCSPRNPGCTICPLGQYCRALESDSVDKYPLRNKTKPVPTVHIAAGV 234

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDG------NIDTHSAPFTANWILCNT 298
               D  ++  ++    LL G+ E PG    + +         +   +    A       
Sbjct: 235 VKKGDKLLITLRKP-EGLLGGLWEFPGGKVKTGEQASSACVRELAEETGLRVAVTSHLAR 293

Query: 299 ITHTFTHFTLTLFVWKTI----VPQIVIIPDSTWHDAQNLANAALPTVMKKAL 347
           + H +THF + + ++         ++    D  W     +     P    K +
Sbjct: 294 VKHAYTHFKIEMDIFNCQYISGNVRLNGPVDHRWIFPHEIRQYPFPKANLKFI 346


>gi|86146423|ref|ZP_01064747.1| A/G-specific adenine glycosylase [Vibrio sp. MED222]
 gi|85835902|gb|EAQ54036.1| A/G-specific adenine glycosylase [Vibrio sp. MED222]
          Length = 352

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 102/351 (29%), Positives = 178/351 (50%), Gaps = 17/351 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
             + IL WYD   R  LPW+ +         + Y VW+SEIMLQQT V TV PY+++F++
Sbjct: 4   FATAILKWYDAFGRKELPWQQN--------KTAYTVWLSEIMLQQTQVATVIPYYQRFLE 55

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A+ +E+L  W GLGYY RARNL K A I+ ++Y G FP  +E +  LPGI
Sbjct: 56  RFPTVIDLANAEQDEVLHLWTGLGYYARARNLHKAAKIVTEQYGGEFPLSIEEMNALPGI 115

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++        ++D N++R ++R F +            +  +A   T     
Sbjct: 116 GRSTAAAVLSSVHKLPHAILDGNVKRTLARSFAVEGWPGQKKVENQLWEHAEAHTPNQDV 175

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA++CT +KP C LCPI+  C      +         KK++P++    F+
Sbjct: 176 DKYNQAMMDMGAMVCTRSKPKCTLCPIESMCEAKKLDRQLDFPGKKPKKEKPIKET-WFV 234

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDG-NIDTHSAPFTANWILCNTITHTF 303
            + ++N++ L +R  + +  G+   P +  +  +   ++ +     T +        HTF
Sbjct: 235 ILYHNNQVWLEQRPQSGIWGGLFCFPQNENAEIEHQLDLRSIKDNETDSIKTMIAFRHTF 294

Query: 304 THFTLTLFVWKTIVPQ----IVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ L +      + +    I+      W++        L   +K+ + + 
Sbjct: 295 SHYHLDITPVLVKLDKQPDLIMEGTKGLWYNLSKPEEIGLAAPVKQLIESL 345


>gi|229015843|ref|ZP_04172816.1| hypothetical protein bcere0030_4300 [Bacillus cereus AH1273]
 gi|229022050|ref|ZP_04178605.1| hypothetical protein bcere0029_4160 [Bacillus cereus AH1272]
 gi|228739253|gb|EEL89694.1| hypothetical protein bcere0029_4160 [Bacillus cereus AH1272]
 gi|228745442|gb|EEL95471.1| hypothetical protein bcere0030_4300 [Bacillus cereus AH1273]
          Length = 365

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 112/352 (31%), Positives = 167/352 (47%), Gaps = 18/352 (5%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               Q+ ++ W++   R LPWR +          PY+VW+SEIMLQQT V+ V+PY+  F
Sbjct: 11  IEQFQNDLIGWFEKEQRDLPWRKN--------KDPYRVWVSEIMLQQTRVEAVKPYYANF 62

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M K+PT+  L++A DEE+L AW GLGYY+RARNL      + + Y G  P  V+ ++KL 
Sbjct: 63  MGKFPTLEALANADDEEVLKAWEGLGYYSRARNLHTAVKEVKEVYGGIVPSDVKKIEKLK 122

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKITSTS 182
           G+G YT  AI++IA+      VD N+ R++SR   +             +   R+I S  
Sbjct: 123 GVGPYTKGAILSIAYGIPEPAVDGNVMRVLSRILSVWDDIAKPKTRKVFEEIVREIISAK 182

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
            P  F Q +M+LGALIC    P C LCP++++C  ++EG    L + +  K   M     
Sbjct: 183 NPSYFNQGLMELGALICIPKNPSCLLCPVREHCRGYAEGVQKELPVKSKAKAPTMVPIVA 242

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSA-------WSSTKDGNIDTHSAPFTANWIL 295
            +  T D R ++ KR +T LL  M E P +                +        +    
Sbjct: 243 GVLQTEDGRYVINKRPSTGLLANMWEFPNAELGEGIRNQKEQLTDYMKEKFELSISIEEY 302

Query: 296 CNTITHTFTHFTLTLFVWKTIVP-QIVIIPDSTWHDAQNLANAALPTVMKKA 346
              + HTFTH T  +FV+   V   IV      +   +           +  
Sbjct: 303 AMNVQHTFTHRTWDIFVFYGRVTGDIVETDTLKFVSKEAFEQLPFSKSHRTI 354


>gi|108806309|ref|YP_650225.1| adenine DNA glycosylase [Yersinia pestis Antiqua]
 gi|108813310|ref|YP_649077.1| adenine DNA glycosylase [Yersinia pestis Nepal516]
 gi|145597869|ref|YP_001161945.1| adenine DNA glycosylase [Yersinia pestis Pestoides F]
 gi|165925102|ref|ZP_02220934.1| A/G-specific adenine glycosylase [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165937335|ref|ZP_02225899.1| A/G-specific adenine glycosylase [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166010275|ref|ZP_02231173.1| A/G-specific adenine glycosylase [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166212877|ref|ZP_02238912.1| A/G-specific adenine glycosylase [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|167400094|ref|ZP_02305612.1| A/G-specific adenine glycosylase [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167421991|ref|ZP_02313744.1| A/G-specific adenine glycosylase [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167426696|ref|ZP_02318449.1| A/G-specific adenine glycosylase [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|270487555|ref|ZP_06204629.1| A/G-specific adenine glycosylase [Yersinia pestis KIM D27]
 gi|294502885|ref|YP_003566947.1| A/G-specific adenine glycosylase [Yersinia pestis Z176003]
 gi|108776958|gb|ABG19477.1| A/G-specific DNA-adenine glycosylase [Yersinia pestis Nepal516]
 gi|108778222|gb|ABG12280.1| A/G-specific DNA-adenine glycosylase [Yersinia pestis Antiqua]
 gi|145209565|gb|ABP38972.1| A/G-specific DNA-adenine glycosylase [Yersinia pestis Pestoides F]
 gi|165914809|gb|EDR33422.1| A/G-specific adenine glycosylase [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165923302|gb|EDR40453.1| A/G-specific adenine glycosylase [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165990761|gb|EDR43062.1| A/G-specific adenine glycosylase [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166206169|gb|EDR50649.1| A/G-specific adenine glycosylase [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|166960128|gb|EDR56149.1| A/G-specific adenine glycosylase [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167050802|gb|EDR62210.1| A/G-specific adenine glycosylase [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167054299|gb|EDR64118.1| A/G-specific adenine glycosylase [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|262360920|gb|ACY57641.1| A/G-specific adenine glycosylase [Yersinia pestis D106004]
 gi|262364861|gb|ACY61418.1| A/G-specific adenine glycosylase [Yersinia pestis D182038]
 gi|270336059|gb|EFA46836.1| A/G-specific adenine glycosylase [Yersinia pestis KIM D27]
 gi|294353344|gb|ADE63685.1| A/G-specific adenine glycosylase [Yersinia pestis Z176003]
          Length = 372

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 104/351 (29%), Positives = 168/351 (47%), Gaps = 16/351 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                    +LDWY    R  LPW+           +PY+VW+SE+MLQQT V TV PYF
Sbjct: 2   MQAQQFAHVVLDWYQHFGRKTLPWQ--------LDKTPYQVWLSEVMLQQTQVATVIPYF 53

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++P I  L++A  +++L  W GLGYY RARNL K A ++V+ ++G FP   + + 
Sbjct: 54  QRFMLRFPDIQALAAAPLDDVLHLWTGLGYYARARNLHKAAQMVVEHHQGEFPTTFDQIL 113

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPGIG  TA AI++++      ++D N++R+++R + +            +   +  +T
Sbjct: 114 ALPGIGRSTAGAILSLSLGQHFPILDGNVKRVLARCYAVDGWPGKKEVEGRLWQISEDVT 173

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             +  G F QAMMDLGA++CT +KP C LCP+   C+ ++            K+  P   
Sbjct: 174 PANGVGQFNQAMMDLGAMVCTRSKPKCELCPLNIGCMAYANHSWARYPGKKPKQTLPE-K 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
            A F+ + N +++ L +R    L  G+   P  A        +     P           
Sbjct: 233 TAWFLLMQNGSQVWLEQRPPVGLWGGLFCFPQFAEQEELIHWLQKQGIPANETQQ-LTAF 291

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKAL 347
            HTF+HF L +         +    D     W++     +  L   +++ L
Sbjct: 292 RHTFSHFHLDIVPIWLNTASVRGCMDDGAGLWYNLAQPPSVGLAAPVERLL 342


>gi|301052174|ref|YP_003790385.1| A/G-specific adenine glycosylase [Bacillus anthracis CI]
 gi|300374343|gb|ADK03247.1| A/G-specific adenine glycosylase [Bacillus cereus biovar anthracis
           str. CI]
          Length = 365

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 114/352 (32%), Positives = 168/352 (47%), Gaps = 18/352 (5%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               Q+ ++ W++   R LPWR +          PY+VW+SEIMLQQT V+ V+PY+  F
Sbjct: 11  IEQFQNDLIGWFEKEQRDLPWRKN--------KDPYRVWVSEIMLQQTRVEAVKPYYANF 62

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M K+PT+  L++A DEE+L AW GLGYY+RARNL      + + Y G  P  V+ ++KL 
Sbjct: 63  MGKFPTLEALANADDEEVLKAWEGLGYYSRARNLHAAVKEVKEVYGGIVPSDVKKIEKLK 122

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKITSTS 182
           G+G YT  AI++IA+      VD N+ R++SR   +             +   R+I S  
Sbjct: 123 GVGPYTKGAILSIAYGIPEPAVDGNVMRVLSRILSVWDDIAKPKTRKVFEEVVREIISAE 182

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
            P  F Q +M+LGALIC    P C LCP++++C  ++EG    L + +  K   M     
Sbjct: 183 NPSYFNQGLMELGALICIPKNPACLLCPVREHCRGYAEGVQKELPVKSKAKAPTMVPIVA 242

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTIT-- 300
            +  T D R ++ KR +T LL  M E P            +         + L  +I   
Sbjct: 243 GVLQTEDGRYVINKRPSTGLLANMWEFPNVELGEGIRNQKEQLIDYMKEKFELSISIEEY 302

Query: 301 -----HTFTHFTLTLFVWKTIVP-QIVIIPDSTWHDAQNLANAALPTVMKKA 346
                HTFTH T  +FV+   V   IV      +   +           +  
Sbjct: 303 AMNVQHTFTHRTWDIFVFYGKVTGDIVETDTLKFVSKEAFEQLPFSKSHRTI 354


>gi|85374543|ref|YP_458605.1| hypothetical protein ELI_08580 [Erythrobacter litoralis HTCC2594]
 gi|84787626|gb|ABC63808.1| hypothetical protein ELI_08580 [Erythrobacter litoralis HTCC2594]
          Length = 347

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 135/335 (40%), Positives = 186/335 (55%), Gaps = 11/335 (3%)

Query: 12  ILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWPTI 71
           +LDWYD + R LPWR  P    +    PY+VW+SEIMLQQTTV  V+PYF +F + WPT+
Sbjct: 16  LLDWYDRHARDLPWRAQPGEPAA---DPYRVWLSEIMLQQTTVAAVKPYFARFTEVWPTV 72

Query: 72  FCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDYTA 131
             L+ A +E++++AWAGLGYY+RARNL   A  +       FP     L++LPG+G+YTA
Sbjct: 73  EALAEASEEDVMAAWAGLGYYSRARNLLMAAKAVGDLGG--FPETEAELRRLPGVGEYTA 130

Query: 132 SAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQAM 191
           +AI AIAF   AVVVD N+ER++SR F I +P P   + I+ +A  IT   R GDF QAM
Sbjct: 131 AAIAAIAFGRRAVVVDANVERVVSRLFAIEEPLPKARRAIRAHADAITPDRRAGDFAQAM 190

Query: 192 MDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITNDNR 251
           MDLG+ +CT+  P C LCP+ + C   ++           K K           I  +  
Sbjct: 191 MDLGSQVCTTRAPQCLLCPLARFCEARTQEPERFPVKPPRKAKP--LRKGRAFWIEREGT 248

Query: 252 ILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTHFTLTLF 311
           + L +R  + +L GM  LP   WS+  DG+ +    P    W    ++ H FTHF L L 
Sbjct: 249 VWLVRREGSGMLGGMRSLPDDGWSARSDGSGEL---PLAGEWENAGSVFHVFTHFALELT 305

Query: 312 VWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKA 346
           V +    +     +  W    +L  A LPT+  KA
Sbjct: 306 VLRHGGAEHPTG-EGEWWPLDDLGKAGLPTLFAKA 339


>gi|51597534|ref|YP_071725.1| adenine DNA glycosylase [Yersinia pseudotuberculosis IP 32953]
 gi|51590816|emb|CAH22462.1| A/G-specific adenine glycosylase [Yersinia pseudotuberculosis IP
           32953]
          Length = 371

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 106/351 (30%), Positives = 169/351 (48%), Gaps = 16/351 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                    +LDWY    R  LPW+           +PY+VW+SE+MLQQT V TV PYF
Sbjct: 1   MQAQQFAHVVLDWYQHFGRKTLPWQ--------LDKTPYQVWLSEVMLQQTQVATVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++P I  L++A  +E+L  W GLGYY RARNL K A ++V+ ++G FP   + + 
Sbjct: 53  QRFMLRFPDIQALAAAPLDEVLHLWTGLGYYARARNLHKAAQMVVEHHQGEFPTTFDQIL 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPGIG  TA AI++++      ++D N++R+++R + +            +   +  +T
Sbjct: 113 ALPGIGRSTAGAILSLSLGQHFPILDGNVKRVLARCYAVDGWPGKKEVEGRLWQISEDVT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             +R G F QAMMDLGA++CT +KP C LCP+   C+ ++            K+  P   
Sbjct: 173 PANRVGQFNQAMMDLGAMVCTRSKPKCELCPLNIGCMAYANHSWARYPGKKPKQTLPE-K 231

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
            A F+ + N +++ L +R    L  G+   P  A        +     P           
Sbjct: 232 TAWFLLMQNGSQVWLEQRPPVGLWGGLFCFPQFAEQEELIHWLQKQGIPANETQQ-LTAF 290

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKAL 347
            HTF+HF L +         +    D     W++     +  L   +++ L
Sbjct: 291 RHTFSHFHLDIVPIWLNTASVRGCMDDGAGLWYNLAQPPSVGLAAPVERLL 341


>gi|228931950|ref|ZP_04094844.1| hypothetical protein bthur0009_4350 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228827735|gb|EEM73475.1| hypothetical protein bthur0009_4350 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
          Length = 365

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 114/352 (32%), Positives = 168/352 (47%), Gaps = 18/352 (5%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               Q+ ++ W++   R LPWR +          PY+VW+SEIMLQQT V+ V+PY+  F
Sbjct: 11  IEQFQNDLIGWFEKEQRDLPWRKN--------KDPYRVWVSEIMLQQTRVEAVKPYYANF 62

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M K+PT+  L++A DEE+L AW GLGYY+RARNL      + + Y G  P  V+ ++KL 
Sbjct: 63  MGKFPTLEALANADDEEVLKAWEGLGYYSRARNLHAAVKEVKEVYGGIVPSDVKKIEKLK 122

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKITSTS 182
           G+G YT  AI++IA+      VD N+ R++SR   +             +   R+I S  
Sbjct: 123 GVGPYTKGAILSIAYGIPEPAVDGNVMRVLSRILSVWDDIAKPKTRKVFEEIVREIISAE 182

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
            P  F Q +M+LGALIC    P C LCP++++C  ++EG    L + +  K   M     
Sbjct: 183 NPSYFNQGLMELGALICIPKNPACLLCPVREHCRGYAEGVQKELPVKSKAKAPTMVPIVA 242

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTIT-- 300
            +  T D R ++ KR +T LL  M E P            +         + L  +I   
Sbjct: 243 GVLQTEDGRYVINKRPSTGLLANMWEFPNVELGEGIRNQKEQLIDYMKEKFELSISIEEY 302

Query: 301 -----HTFTHFTLTLFVWKTIVP-QIVIIPDSTWHDAQNLANAALPTVMKKA 346
                HTFTH T  +FV+   V   IV      +   +           +  
Sbjct: 303 AMNVQHTFTHRTWDIFVFYGKVTGDIVETDTLKFVSKEAFEQLPFSKSHRTI 354


>gi|222094257|ref|YP_002528314.1| a/g-specific adenine glycosylase [Bacillus cereus Q1]
 gi|221238312|gb|ACM11022.1| A/G-specific adenine glycosylase [Bacillus cereus Q1]
          Length = 365

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 112/352 (31%), Positives = 166/352 (47%), Gaps = 18/352 (5%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               Q+ ++ W++   R LPWR +          PY+VW+SEIMLQQT V+ V+PY+  F
Sbjct: 11  IEQFQNDLIGWFEKEQRDLPWRKN--------KDPYRVWVSEIMLQQTRVEAVKPYYANF 62

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M K+PT+  L++A DEE+L AW GLGYY+RARNL      + + Y G  P  V+ ++KL 
Sbjct: 63  MGKFPTLEALANADDEEVLKAWEGLGYYSRARNLHAAVKEVKEVYGGIVPSDVKKIEKLK 122

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKITSTS 182
           G+G YT  AI++IA+      VD N+ R++SR   +             +   R+I S  
Sbjct: 123 GVGPYTKGAILSIAYGIPEPAVDGNVMRVLSRILSVWDDIAKPKTRKVFEEIVREIISAE 182

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
            P  F Q +M+LGALIC    P C LCP++++C  ++EG    L + +  K   M     
Sbjct: 183 NPSYFNQGLMELGALICIPKNPACLLCPVREHCRGYAEGVQKELPVKSKAKAPTMVPIVA 242

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSA-------WSSTKDGNIDTHSAPFTANWIL 295
            +  T D R ++ KR +T LL  M E P                  +        +    
Sbjct: 243 GVLQTEDGRYVINKRPSTGLLANMWEFPNIELGEGIRSQKEQLTDYMKEKFELSISIDEY 302

Query: 296 CNTITHTFTHFTLTLFVWKTIVP-QIVIIPDSTWHDAQNLANAALPTVMKKA 346
              + HTFTH T  +FV+   V   IV      +   +           +  
Sbjct: 303 AMNVQHTFTHRTWDIFVFYGKVTGDIVETDTLKFVSKEAFEQLPFSKSHRTI 354


>gi|313202269|ref|YP_004040927.1| a/g-specific adenine glycosylase [Methylovorus sp. MP688]
 gi|312441585|gb|ADQ85691.1| A/G-specific adenine glycosylase [Methylovorus sp. MP688]
          Length = 373

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 110/350 (31%), Positives = 176/350 (50%), Gaps = 15/350 (4%)

Query: 7   IIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
              SK++ W     R  LPW+ +          PY VW+SEIMLQQT V  V  Y+++FM
Sbjct: 25  SFASKLISWQKRYGRHDLPWQQT--------RDPYAVWVSEIMLQQTQVAAVIGYYQRFM 76

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
           Q++PTI  L+ A  ++++  W+GLGYY+RARNL K A  +++ + G FP  +E ++ LPG
Sbjct: 77  QRFPTIASLAMATQDDVMQHWSGLGYYSRARNLHKAAQQVMEVHGGVFPQTLEAIQALPG 136

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTSR 183
           IG  TASAI + AF     ++D N++R+ +R+F I      P   + +   A ++     
Sbjct: 137 IGRSTASAIASFAFEAPHPILDGNVKRVFARHFAIEGWPGLPRVEQQMWALAERLQPAQE 196

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVF 243
            G + QA+MD+GA +CT ++P C  CP+Q  CL + EG++  L   +  +K         
Sbjct: 197 HGPYAQALMDMGATLCTRSRPRCDACPLQTTCLAYREGRTRELPA-SKPRKAIPEKSTTM 255

Query: 244 IAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTF 303
           + + +DN+++L KR  + +  G+  LP    +              T       T+TH F
Sbjct: 256 LILLHDNQVMLEKRPGSGIWGGLWSLPEVDSTLDAQQAAVERYGFQTQKLPPFGTLTHVF 315

Query: 304 THFTLTLFVWKTIVPQIVII---PDSTWHDAQNLANAALPTVMKKALSAG 350
           +HF L +      V   +     PD  W   +    A +P  ++  L   
Sbjct: 316 SHFKLHILPQPLAVEAALTANQTPDIQWLTLEAAVQAGIPAPVRVLLEQL 365


>gi|254487387|ref|ZP_05100592.1| A/G-specific adenine glycosylase [Roseobacter sp. GAI101]
 gi|214044256|gb|EEB84894.1| A/G-specific adenine glycosylase [Roseobacter sp. GAI101]
          Length = 354

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 139/347 (40%), Positives = 193/347 (55%), Gaps = 3/347 (0%)

Query: 6   HIIQSKILDWYDTNHRVLPWRTSPKTEKSSLP-SPYKVWISEIMLQQTTVKTVEPYFKKF 64
             +   +L+WYD + R +PWR  P   K+ L   PY++W+SE+MLQQTTV TV  YF++F
Sbjct: 8   STLPRILLEWYDVHARAMPWRVGPTDRKAGLRPDPYRIWLSEVMLQQTTVATVRDYFQRF 67

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
             +WPT+  L++A+D +++  WAGLGYY RARNL KCA  +V ++ G FP     L KLP
Sbjct: 68  TARWPTVADLAAAQDADVMGEWAGLGYYARARNLLKCARAVVDQHGGEFPADHAALLKLP 127

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRP 184
           GIG YTA+A+ +IAF+    V+D N+ER+++R ++I  P P     +   A  +T   RP
Sbjct: 128 GIGPYTAAAVSSIAFDLPHAVLDGNVERVMARLYEIHTPLPAAKPEMMARAEALTPRVRP 187

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
           GD+ QA+MDLGA ICT   P C +CP +  C     G +  L   T K  +P+R G V++
Sbjct: 188 GDYAQAVMDLGATICTPKSPACGICPWRAPCAARQAGTAAELPKKTPKTPKPVRHGTVYL 247

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILC-NTITHTF 303
           A   D   LL  R +  LL GM   PGS W           + P  A+W +    + HTF
Sbjct: 248 AQREDGAWLLETRPDKGLLGGMLGWPGSDWI-DSGAPRPQGTPPVDADWQVLPGEVRHTF 306

Query: 304 THFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           THF L L V    VP  +      +        + LPTVM+KA    
Sbjct: 307 THFHLMLTVIYASVPSDLSPDTGEFFAPDRFRPSDLPTVMRKAFDLA 353


>gi|229519742|ref|ZP_04409185.1| A/G-specific adenine glycosylase [Vibrio cholerae RC9]
 gi|229344431|gb|EEO09406.1| A/G-specific adenine glycosylase [Vibrio cholerae RC9]
          Length = 374

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 102/343 (29%), Positives = 166/343 (48%), Gaps = 17/343 (4%)

Query: 8   IQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
               IL WYD   R  LPW+ +         + Y+VW+SEIMLQQT V TV PYF++F++
Sbjct: 29  FAQAILTWYDAYGRKNLPWQQN--------KNAYRVWLSEIMLQQTQVATVIPYFERFLE 80

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A  +E+L  W GLGYY RARNL K A ++V +Y G FP  +E +  LPG+
Sbjct: 81  RFPTVHALAAAPQDEVLHFWTGLGYYARARNLHKAAQMVVSEYGGEFPTDLEQMNALPGV 140

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+A+++  +     ++D N++R ++R F +            + +YA   T     
Sbjct: 141 GRSTAAAVLSSVYKKPHAILDGNVKRTLARCFAVEGWPGQKSVENQLWHYAEMHTPKVDV 200

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA+ICT +KP C LCP++  CL   +G          K  +       F+
Sbjct: 201 DKYNQAMMDMGAMICTRSKPKCSLCPVESFCLAKQQGNPQEYPGKKPKTDK-PVKATWFV 259

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPF-TANWILCNTITHTF 303
            + +DN + L +R  + +  G+   P S  ++ +              +        HTF
Sbjct: 260 MLYHDNAVWLEQRPQSGIWGGLYCFPQSEIANIQTTIDQRAIGDSTITSQKTLIAFRHTF 319

Query: 304 THFTLTLFVWKTIVPQIV----IIPDSTWHDAQNLANAALPTV 342
           +H+ L +      + +            W++  +     L   
Sbjct: 320 SHYHLDITPILLQLSRKPDIVMEGSKGLWYNLSHPDEIGLAAP 362


>gi|228925711|ref|ZP_04088797.1| hypothetical protein bthur0010_4370 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|229120119|ref|ZP_04249371.1| hypothetical protein bcere0016_4360 [Bacillus cereus 95/8201]
 gi|228663357|gb|EEL18945.1| hypothetical protein bcere0016_4360 [Bacillus cereus 95/8201]
 gi|228833933|gb|EEM79484.1| hypothetical protein bthur0010_4370 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
          Length = 365

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 114/352 (32%), Positives = 168/352 (47%), Gaps = 18/352 (5%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               Q+ ++ W++   R LPWR +          PY+VW+SEIMLQQT V+ V+PY+  F
Sbjct: 11  IEQFQNDLIGWFEKEQRDLPWRKN--------KDPYRVWVSEIMLQQTRVEAVKPYYANF 62

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M K+PT+  L++A DEE+L AW GLGYY+RARNL      + + Y G  P  V+ ++KL 
Sbjct: 63  MGKFPTLEALANADDEEVLKAWEGLGYYSRARNLHAAVKEVKEVYGGIVPSDVKKIEKLK 122

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKITSTS 182
           G+G YT  AI++IA+      VD N+ R++SR   +             +   R+I S  
Sbjct: 123 GVGPYTKGAILSIAYGIPEPAVDGNVMRVLSRILSVWDDIAKPKTRKVFEEIVREIISAE 182

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
            P  F Q +M+LGALIC    P C LCP++++C  ++EG    L + +  K   M     
Sbjct: 183 NPSYFNQGLMELGALICIPKNPACLLCPVREHCRGYAEGVQKELPVKSKAKAPTMVPIVA 242

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTIT-- 300
            +  T D R ++ KR +T LL  M E P            +         + L  +I   
Sbjct: 243 GVLQTEDGRYVINKRPSTGLLANMWEFPNVELGEGIRNQKEQLIDYMKGKFELSISIEEY 302

Query: 301 -----HTFTHFTLTLFVWKTIVP-QIVIIPDSTWHDAQNLANAALPTVMKKA 346
                HTFTH T  +FV+   V   IV      +   +           +  
Sbjct: 303 AMNVQHTFTHRTWDIFVFYGKVTGDIVETDTLKFVSKEAFEQLPFSKSHRTI 354


>gi|162418954|ref|YP_001604780.1| adenine DNA glycosylase [Yersinia pestis Angola]
 gi|162351769|gb|ABX85717.1| A/G-specific adenine glycosylase [Yersinia pestis Angola]
          Length = 372

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 105/351 (29%), Positives = 168/351 (47%), Gaps = 16/351 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                    +LDWY    R  LPW+           +PY+VW+SE+MLQQT V TV PYF
Sbjct: 2   MQAQQFAHVVLDWYQHFGRKTLPWQ--------LDKTPYQVWLSEVMLQQTQVATVIPYF 53

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++P I  L++A  +++L  W GLGYY RARNL K A ++V+ ++G FP   + + 
Sbjct: 54  QRFMLRFPDIQALAAAPLDDVLHLWTGLGYYARARNLHKAAQMVVEHHQGEFPTTFDQIL 113

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKIT 179
            LPGIG  TA AI++++      ++D NI+R+++R + +            +   +  +T
Sbjct: 114 ALPGIGRSTAGAILSLSLGQHFPILDGNIKRVLARCYAVDGWPGKKEVEGRLWQISEDVT 173

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             +  G F QAMMDLGA++CT +KP C LCP+   C+ ++            K+  P   
Sbjct: 174 PANGVGQFNQAMMDLGAMVCTRSKPKCELCPLNIGCMAYANHSWARYPGKKPKQTLPE-K 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
            A F+ + N +++ L +R    L  G+   P  A        +     P           
Sbjct: 233 TAWFLLMQNGSQVWLEQRPPVGLWGGLFCFPQFAEQEELIHWLQKQGIPANETQQ-LTAF 291

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKAL 347
            HTF+HF L +         +    D     W++     +  L   +++ L
Sbjct: 292 RHTFSHFHLDIVPIWLNTASVRGCMDDGAGLWYNLAQPPSVGLAAPVERLL 342


>gi|329113635|ref|ZP_08242413.1| Putative A/G-specific adenine glycosylase YfhQ [Acetobacter pomorum
           DM001]
 gi|326697042|gb|EGE48705.1| Putative A/G-specific adenine glycosylase YfhQ [Acetobacter pomorum
           DM001]
          Length = 378

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 146/349 (41%), Positives = 194/349 (55%), Gaps = 13/349 (3%)

Query: 9   QSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKW 68
              +L WYD + R LPWR        S P PY+VW+SEIMLQQTTVK V PY+ +F +K+
Sbjct: 27  AHALLHWYDRHRRTLPWRV----VGQSHPDPYRVWLSEIMLQQTTVKAVAPYYLRFTEKF 82

Query: 69  PTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGD 128
           PT+  L+SA  E++L+AWAGLGYY+RARNL  CA  +V      FP  V+ L+ LPGIG 
Sbjct: 83  PTVQALASADREDVLAAWAGLGYYSRARNLHACAQAVVALDG--FPQDVQGLRALPGIGP 140

Query: 129 YTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKN----YARKITSTSRP 184
           YTA+A+ AIAF    V VD N+ER+ +R F I  P P   K +            +  RP
Sbjct: 141 YTAAAVAAIAFGVPVVPVDGNVERVTARLFAITAPLPPARKKLAQLAITLNADREAQERP 200

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
            DF QA+ DLG+ +C+   P C LCP    C  + +G +  L     K +RP+R GA F+
Sbjct: 201 SDFAQALFDLGSSLCSPRAPACGLCPWLGECAAYKQGIAAELPRKLPKAERPVRFGAAFL 260

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNID-THSAPFTANWILCNTITHTF 303
           A     +ILLRKR    LL  M ELPG+ W        +   +APFTA W L   + H F
Sbjct: 261 ARDAAGQILLRKRAEKGLLAAMTELPGTEWRLKNWNETEILQAAPFTAEWTLAGRVKHVF 320

Query: 304 THFTLTLFVWKTIVPQ--IVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           THFTL L V+   +       + D      + + + ALP++M+K    G
Sbjct: 321 THFTLYLDVYVAQIKHFSNQAVSDGFLVPMECVKDTALPSIMQKCFEKG 369


>gi|261404713|ref|YP_003240954.1| A/G-specific adenine glycosylase [Paenibacillus sp. Y412MC10]
 gi|261281176|gb|ACX63147.1| A/G-specific adenine glycosylase [Paenibacillus sp. Y412MC10]
          Length = 382

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 125/386 (32%), Positives = 180/386 (46%), Gaps = 45/386 (11%)

Query: 1   MPQPEHI--IQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVE 58
           M   EH      ++LDWY+ N R LPWR            PY +W+SEIMLQQT V TV 
Sbjct: 1   MHNTEHKRYFSQELLDWYEINKRDLPWRR--------HRDPYYIWVSEIMLQQTRVDTVI 52

Query: 59  PYFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVE 118
           PYF +F++++PTI  L+ A ++++L  W GLGYY+RARNL+  A  + ++Y+G  P   +
Sbjct: 53  PYFHRFIERFPTIQSLADAPEDDVLKCWEGLGYYSRARNLQAAARQVTEQYDGVMPSGKD 112

Query: 119 ILKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYAR 176
            +  L GIG YT+ AI +IAFN  A  VD N+ R++SRYF I +          +++   
Sbjct: 113 EVSGLKGIGPYTSGAIRSIAFNIPAAAVDGNVMRVLSRYFLIEEDIMKVKTRTKMEDLVL 172

Query: 177 KITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRP 236
            +    R  DF QA+M+LGALICT   P C +CP+ ++C    EGK   L I T  K   
Sbjct: 173 TLVPDGRASDFTQALMELGALICTPKSPKCLVCPVMEHCSARLEGKEESLPIKTKAKPPR 232

Query: 237 MRTGAVFIAITNDNR---ILLRKRTNTRLLEGMDELPG---------SAWSSTKDGNIDT 284
                  I          IL+RKR    LL GM ELP             +  ++  +  
Sbjct: 233 PEYRLTAIVEGTGVHEGKILIRKRPAAGLLAGMWELPHVIVPADRSSVPAAMPEETAMVR 292

Query: 285 HSAPFTANWILCNTI------THTFTHFTLTLFVWKTIVPQIVI---------------I 323
                    +    I       HTF+H    + V++     +                  
Sbjct: 293 LRDALLEEGVPVQPIGHVMDAEHTFSHIQWNMGVYRCKWQDVPPAALQAAESAAAYETGE 352

Query: 324 PDSTWHDAQNLANAALPTVMKKALSA 349
            +  W   Q++   A P V  + L+A
Sbjct: 353 ENFRWIHVQDMERYAFPNVFIRILNA 378


>gi|229095174|ref|ZP_04226167.1| hypothetical protein bcere0020_4310 [Bacillus cereus Rock3-29]
 gi|229114116|ref|ZP_04243541.1| hypothetical protein bcere0017_4210 [Bacillus cereus Rock1-3]
 gi|228669386|gb|EEL24803.1| hypothetical protein bcere0017_4210 [Bacillus cereus Rock1-3]
 gi|228688255|gb|EEL42140.1| hypothetical protein bcere0020_4310 [Bacillus cereus Rock3-29]
          Length = 365

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 113/355 (31%), Positives = 169/355 (47%), Gaps = 18/355 (5%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               Q+ ++ W++   R LPWR +          PY+VW+SEIMLQQT V+ V+PY+  F
Sbjct: 11  IEQFQNDLIGWFEKEQRDLPWRKN--------KDPYRVWVSEIMLQQTRVEAVKPYYANF 62

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M K+PT+  L++A DEE+L AW GLGYY+RARNL      + + Y G  P  V+ ++KL 
Sbjct: 63  MGKFPTLEALANADDEEVLKAWEGLGYYSRARNLHTAVKEVKEVYGGIVPSDVKKIEKLK 122

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKITSTS 182
           G+G YT  AI++IA+      VD N+ R++SR   +             +   R+I S  
Sbjct: 123 GVGPYTKGAILSIAYGIPEPAVDGNVMRVLSRILSVWDDIAKPKTRKVFEEIVREIISAE 182

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
            P  F Q +M+LGALIC    P C LCP++++C  ++EG    L + +  K   M     
Sbjct: 183 NPSYFNQGLMELGALICIPKNPACLLCPVREHCRGYAEGVQKELPVKSKAKAPTMVPLVA 242

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI--- 299
            +  T D R ++ KR ++ LL  M E P            +         + L  +I   
Sbjct: 243 GVLQTEDGRYVINKRPSSGLLANMWEFPNIELGEGIRSQKEQLIDYMKEKFELSISIDEY 302

Query: 300 ----THTFTHFTLTLFVWKTIVP-QIVIIPDSTWHDAQNLANAALPTVMKKALSA 349
                HTFTH T  +FV+   V   IV      +   +           +    +
Sbjct: 303 AMNVQHTFTHRTWDIFVFYGKVTGDIVETDTLKFVSKEAFEQLPFSKSHRTIYES 357


>gi|206974327|ref|ZP_03235244.1| A/G-specific adenine glycosylase [Bacillus cereus H3081.97]
 gi|217958059|ref|YP_002336603.1| A/G-specific adenine glycosylase [Bacillus cereus AH187]
 gi|229137325|ref|ZP_04265940.1| hypothetical protein bcere0013_4590 [Bacillus cereus BDRD-ST26]
 gi|206747567|gb|EDZ58957.1| A/G-specific adenine glycosylase [Bacillus cereus H3081.97]
 gi|217067255|gb|ACJ81505.1| A/G-specific adenine glycosylase [Bacillus cereus AH187]
 gi|228646144|gb|EEL02363.1| hypothetical protein bcere0013_4590 [Bacillus cereus BDRD-ST26]
          Length = 365

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 113/352 (32%), Positives = 169/352 (48%), Gaps = 18/352 (5%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               Q+ ++ W++   R LPWR +          PY+VW+SEIMLQQT V+ V+PY+  F
Sbjct: 11  IEQFQNDLIGWFEKEQRDLPWRKN--------KDPYRVWVSEIMLQQTRVEAVKPYYANF 62

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M K+PT+  L++A DEE+L AW GLGYY+RARNL      + + Y G  P  ++ ++KL 
Sbjct: 63  MGKFPTLEALANADDEEVLKAWEGLGYYSRARNLHAAVKEVKEVYGGIVPSDIKKIEKLK 122

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKITSTS 182
           G+G YT  AI++IA+      VD N+ R++SR   +             +   R+I S  
Sbjct: 123 GVGPYTKGAILSIAYGIPEPAVDGNVMRVLSRILSVWDDIAKPKTRKVFEEIVREIISAE 182

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
            P  F Q +M+LGALIC    P C LCP++++C  ++EG    L + +  K   M     
Sbjct: 183 NPSYFNQGLMELGALICIPKNPACLLCPVREHCRGYAEGVQKELPVKSKAKAPTMVPIVA 242

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI--- 299
            +  T D R ++ KR +T LL  M E P            +  +      + L  +I   
Sbjct: 243 GVLQTEDGRYVINKRPSTGLLANMWEFPNIELGEGIRSQKEQLTDYMKEKFELSISIDEY 302

Query: 300 ----THTFTHFTLTLFVWKTIVP-QIVIIPDSTWHDAQNLANAALPTVMKKA 346
                HTFTH T  +FV+   V   IV      +   +           +  
Sbjct: 303 AMNVQHTFTHRTWDIFVFYGKVTGDIVETDTLKFVSKEAFEQLPFSKSHRTI 354


>gi|306825160|ref|ZP_07458502.1| A/G-specific adenine glycosylase [Streptococcus sp. oral taxon 071
           str. 73H25AP]
 gi|304432596|gb|EFM35570.1| A/G-specific adenine glycosylase [Streptococcus sp. oral taxon 071
           str. 73H25AP]
          Length = 388

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 108/373 (28%), Positives = 166/373 (44%), Gaps = 36/373 (9%)

Query: 2   PQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
            +     + K+L+WYD N R LPWR S         +PY +W+SEIMLQQT V TV PY+
Sbjct: 14  EEKIISFREKLLNWYDENKRDLPWRRS--------KNPYHIWVSEIMLQQTRVDTVIPYY 65

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++F+  +PT+  L++A +E +L AW GLGYY+R RN++  A  I+  + G FP+  E + 
Sbjct: 66  ERFLDWFPTVESLANAPEERLLKAWEGLGYYSRVRNMQAAAQQIISDFGGQFPNTHEGIS 125

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            L GIG YTA AI +IAFN     VD N+ R+++R F++      P   K  +     + 
Sbjct: 126 GLKGIGPYTAGAISSIAFNLPEPAVDGNVMRVLARLFEVNYDIGVPSNRKIFQAIMEILI 185

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              RPGDF QA+MDLG+ I +   P     P+++    +  G      I   KKK     
Sbjct: 186 DPKRPGDFNQALMDLGSDIESPVNPRPEESPVKEFSAAYQNGTMDRYPIKEPKKKPLPIY 245

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWS------------------------ 275
               +   +  + LL K  + +LL G    P                             
Sbjct: 246 LKALVVCNDRGQYLLEKNESEKLLAGFWHFPLIEVEDFYSDDNQIDLFSQVKEESRAFGP 305

Query: 276 STKDGNIDTHSAPFTANWILCNTITHTFTHFTLTLFVWKTIVPQIVIIPD--STWHDAQN 333
           S ++     +      +  + + + H F+H    + +    V       D    W   Q 
Sbjct: 306 SPQENFEQDYDLEVNWSQQVFDQVKHVFSHRKWHIQILAGQVTDSKQFSDREVRWVSPQE 365

Query: 334 LANAALPTVMKKA 346
            ++  L    +K 
Sbjct: 366 FSDYPLAKPQQKI 378


>gi|229074386|ref|ZP_04207423.1| hypothetical protein bcere0024_4160 [Bacillus cereus Rock4-18]
 gi|228708748|gb|EEL60884.1| hypothetical protein bcere0024_4160 [Bacillus cereus Rock4-18]
          Length = 365

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 113/355 (31%), Positives = 169/355 (47%), Gaps = 18/355 (5%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               Q+ ++ W++   R LPWR +          PY+VW+SEIMLQQT V+ V+PY+  F
Sbjct: 11  IEQFQNDLIGWFEKEQRDLPWRKN--------KDPYRVWVSEIMLQQTRVEAVKPYYANF 62

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M K+PT+  L++A DEE+L AW GLGYY+RARNL      + + Y G  P  V+ ++KL 
Sbjct: 63  MGKFPTLEALANADDEEVLKAWEGLGYYSRARNLHTAVKEVKEVYGGIVPSDVKKIEKLK 122

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKITSTS 182
           G+G YT  AI++IA+      VD N+ R++SR   +             +   R+I S  
Sbjct: 123 GVGPYTKGAILSIAYGIPEPAVDGNVMRVLSRILSVWDDIAKPKTRKVFEEIVREIISAE 182

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
            P  F Q +M+LGALIC    P C LCP++++C  ++EG    L + +  K   M     
Sbjct: 183 NPSYFNQGLMELGALICIPKNPACLLCPVREHCRGYAEGVQKELPVKSKAKAPTMVPLVA 242

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI--- 299
            +  T D R ++ KR ++ LL  M E P            +         + L  +I   
Sbjct: 243 GVLQTEDGRYVINKRPSSGLLANMWEFPNIELGEGIRSQKEQLIDYMKEKFELSISIDEY 302

Query: 300 ----THTFTHFTLTLFVWKTIVP-QIVIIPDSTWHDAQNLANAALPTVMKKALSA 349
                HTFTH T  +FV+   V   IV      +   +           +    +
Sbjct: 303 AMNVQHTFTHRTWDIFVFYGKVTGDIVETDTLKFVSKEAFEQLPFSKSHRTIYES 357


>gi|255261658|ref|ZP_05341000.1| A/G-specific adenine glycosylase [Thalassiobium sp. R2A62]
 gi|255103993|gb|EET46667.1| A/G-specific adenine glycosylase [Thalassiobium sp. R2A62]
          Length = 352

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 138/346 (39%), Positives = 191/346 (55%), Gaps = 7/346 (2%)

Query: 11  KILDWYDTNHRVLPWRTSPKTEKSS-LPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKWP 69
           ++L WYD + R +PWR  P    +   P PY++W+SE+MLQQTTV  V+ YF +F  +WP
Sbjct: 9   ELLAWYDLHARGMPWRVMPADRAAGVQPDPYRIWMSEVMLQQTTVAAVKEYFLRFTNRWP 68

Query: 70  TIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGDY 129
           T+  L++A D +++  WAGLGYY RARNL KCA +I  ++ G FP+  + L  LPGIG Y
Sbjct: 69  TVSDLANAADADVMGEWAGLGYYARARNLLKCARVIAAEHGGVFPNTYDGLIALPGIGPY 128

Query: 130 TASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPGDFVQ 189
           TASAI +IA++    V+D N+ER++SR +DI  P P     +  +A  +T   R GD+ Q
Sbjct: 129 TASAISSIAYDLPETVLDGNVERVMSRLYDIHTPLPAAKPELMTHAVALTPQQRAGDYAQ 188

Query: 190 AMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIAITND 249
           A+MDLGA ICT   P C +CP +  C     G +  L   T KK +P R G  ++A   D
Sbjct: 189 AVMDLGATICTPKSPACGICPWRDPCKARVAGTTAELPKKTPKKPKPTRYGIAYVARRAD 248

Query: 250 NRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN-TITHTFTHFTL 308
              LL  R +  LL GM   PGS W+            P +A+W   N    HTFTHF L
Sbjct: 249 GAWLLETRPDKGLLGGMLGWPGSEWNEAP-----VEDDPISADWQTLNSEARHTFTHFHL 303

Query: 309 TLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
            L +   ++P         +  A     + LPTVM+KA       +
Sbjct: 304 ILEIRTAVLPIEAKPARGDFMPAPQFRPSDLPTVMRKAYDLAAETL 349


>gi|327438705|dbj|BAK15070.1| A/G-specific DNA glycosylase [Solibacillus silvestris StLB046]
          Length = 352

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 103/348 (29%), Positives = 159/348 (45%), Gaps = 15/348 (4%)

Query: 6   HIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
              +  ++ W+    R LPWR +          PY++W+SE+MLQQT V TV PY+ +F+
Sbjct: 7   KQFRQALVQWFLEEQRDLPWRRT--------KEPYQIWVSEVMLQQTRVDTVIPYYNRFI 58

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
           +K+PT   L+ + +EE+L  W GLGYY+R RNL+     +V+ Y G  P     + KL G
Sbjct: 59  EKYPTAESLAYSPEEELLKMWEGLGYYSRVRNLQAGVREVVEVYGGKVPDNRVDISKLKG 118

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTSR 183
           +G YTA AI++IA+      VD N+ R++SR  +I      P   K  +    ++     
Sbjct: 119 VGPYTAGAILSIAYGKPEHAVDGNVMRVLSRVLNIDADIALPKTKKIFEQAVTELIDHEN 178

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVF 243
              F Q +M+LGALICT   P C LCP++  C  F EG    L + + K K       V+
Sbjct: 179 ASSFNQGLMELGALICTPTSPKCLLCPVRDYCTAFHEGDPSSLPVKSKKLKTKNIEYDVY 238

Query: 244 IAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT----I 299
           I      R L+ KR    LL  M +       + ++                        
Sbjct: 239 IIRDQQGRFLMEKRPQAGLLANMWQFIMIERQADENSLTKVEKQYNVTLEHNSKETILSF 298

Query: 300 THTFTHFTLTLFVWKTI-VPQIVIIPDSTWHDAQNLANAALPTVMKKA 346
           +H F+H    +  +    V       ++ +   + +AN  +P  M K 
Sbjct: 299 SHVFSHLKWHIDSYLVDAVETNANPENTAYFTKEQIANLPMPVPMLKI 346


>gi|307704961|ref|ZP_07641849.1| A/G-specific adenine glycosylase [Streptococcus mitis SK597]
 gi|307621471|gb|EFO00520.1| A/G-specific adenine glycosylase [Streptococcus mitis SK597]
          Length = 391

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 107/372 (28%), Positives = 157/372 (42%), Gaps = 35/372 (9%)

Query: 2   PQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
            +     + K+L WYD N R LPWR S         +PY +W+SEIMLQQT V TV PY+
Sbjct: 14  ERKIVSFRKKLLTWYDENKRDLPWRRS--------RNPYHIWVSEIMLQQTRVDTVIPYY 65

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++F+  +PT+  L++A +E +L AW GLGYY+R RN++  A  I+  + G FP+  + + 
Sbjct: 66  ERFLDWFPTVESLANAPEERLLKAWEGLGYYSRVRNMQAAAQQIMTDFGGQFPNTYKGIS 125

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKIT 179
            L GIG YTA AI +IAFN     VD N+ R+++R F++      P   K  +     + 
Sbjct: 126 SLKGIGPYTAGAISSIAFNLPEPAVDGNVMRVLARLFEVNHDIGIPSNRKIFQAMMEILI 185

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              RPGDF QA+MDLG+ I     P     P++     +  G      I   KKK     
Sbjct: 186 DPERPGDFNQALMDLGSDIEAPVNPRPEESPVKDFSAAYQNGSMDRYPIKAPKKKPIPIY 245

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN-- 297
               +      + LL K  + +LL G    P        +              +     
Sbjct: 246 LKALVVKNTQGQFLLEKNESEKLLAGFWHFPLVEVDGFSEEEQFDLFHQVAEESVNFGPS 305

Query: 298 ---------------------TITHTFTHFTLTLFVWKTIVPQIVIIPD--STWHDAQNL 334
                                T+ H F+H    + +    V       D    W   +  
Sbjct: 306 PEESFQQDYDLDVDWLDVYFDTVKHVFSHRKWHVQIVAGQVTDFHEFSDREVRWLSPKEF 365

Query: 335 ANAALPTVMKKA 346
            N  L    +K 
Sbjct: 366 KNYPLAKPQQKI 377


>gi|304383448|ref|ZP_07365911.1| A/G-specific adenine glycosylase [Prevotella marshii DSM 16973]
 gi|304335412|gb|EFM01679.1| A/G-specific adenine glycosylase [Prevotella marshii DSM 16973]
          Length = 350

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 117/355 (32%), Positives = 179/355 (50%), Gaps = 17/355 (4%)

Query: 2   PQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
           P       S +LDW+  N R LPWR +          PY VW+SE++LQQT +     Y+
Sbjct: 6   PTDVKRFTSALLDWFTHNRRELPWRETT--------DPYAVWLSEVILQQTRIAQGRDYW 57

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM+++P +  L++A ++E+L  W GLGYY+RARNL   A  I  +    FP   E LK
Sbjct: 58  ERFMRRFPRVEDLAAATEDEVLRLWQGLGYYSRARNLHTAARQIAARGN--FPDTYEELK 115

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLY--HKTIKNYARKIT 179
           KL G+GDYTA+A+ +IAF H   VVD N+ R++SRYF I  P       KT    A+++ 
Sbjct: 116 KLKGVGDYTAAAVASIAFGHPVAVVDGNVYRVLSRYFGIETPINSTQGKKTFAALAQELL 175

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
               P  F QAMMD GA+ CT   P C LCP+  +C+  SEG+   L +   K K   R 
Sbjct: 176 PPDAPSAFNQAMMDFGAIQCTPQSPRCLLCPLSGSCVALSEGRIDKLPVKLRKLKIQTRR 235

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAW---SSTKDGNIDTHSAPFTANWILC 296
              +I +       +R+R++  + +G+ E P       S   D  +     P     +L 
Sbjct: 236 L-TYIYVRCQGFTAIRRRSSGDIWQGLWEPPVPQALGLSEKADAALSLSPLPMGKLTMLH 294

Query: 297 NTITHTFTHFTLTLFVWKTIVP-QIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
             + H  TH  L    +      +  + P+  W    ++ + A+P ++++ L + 
Sbjct: 295 RNVKHVLTHRILLADFYLLETEVRPTLPPEYIWISESDIDDYAVPRLIERLLESL 349


>gi|49476824|ref|YP_034784.1| A/G-specific adenine glycosylase [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|49328380|gb|AAT59026.1| A/G-specific adenine glycosylase [Bacillus thuringiensis serovar
           konkukian str. 97-27]
          Length = 365

 Score =  239 bits (609), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 114/352 (32%), Positives = 168/352 (47%), Gaps = 18/352 (5%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               Q+ ++ W++   R LPWR +          PY+VW+SEIMLQQT V+ V+PY+  F
Sbjct: 11  IEQFQNDLIGWFEKEQRDLPWRKN--------KDPYRVWVSEIMLQQTRVEAVKPYYANF 62

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M K+PT+  L++A DEE+L AW GLGYY+RARNL      + + Y G  P  V+ ++KL 
Sbjct: 63  MGKFPTLEALANADDEEVLKAWEGLGYYSRARNLHAAVKEVKEVYGGIVPSDVKKIEKLK 122

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKITSTS 182
           G+G YT  AI++IA+      VD N+ R++SR   +             +   R+I S  
Sbjct: 123 GVGPYTKGAILSIAYGIPEPAVDGNVMRVLSRILSVWDDIAKPKTRKVFEEIVREIISAE 182

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
            P  F Q +M+LGALIC    P C LCP++++C  ++EG    L + +  K   M     
Sbjct: 183 NPSYFNQGLMELGALICIPKNPACLLCPVREHCRGYAEGVQKELPVKSKAKAPTMVPIVA 242

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTIT-- 300
            +  T D R ++ KR +T LL  M E P            +         + L  +I   
Sbjct: 243 GVLQTEDGRYVINKRPSTGLLANMWEFPNVELGEGIRNQKEQLIDYMKEKFELSISIEEY 302

Query: 301 -----HTFTHFTLTLFVWKTIVP-QIVIIPDSTWHDAQNLANAALPTVMKKA 346
                HTFTH T  +FV+   V   IV      +   +           +  
Sbjct: 303 AMNVQHTFTHRTWDIFVFYGKVIGDIVETDTLKFVSKEAFEQLPFSKSHRTI 354


>gi|289168020|ref|YP_003446289.1| A/G-specific adenine glycosylase [Streptococcus mitis B6]
 gi|288907587|emb|CBJ22424.1| A/G-specific adenine glycosylase [Streptococcus mitis B6]
          Length = 393

 Score =  239 bits (609), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 105/371 (28%), Positives = 155/371 (41%), Gaps = 35/371 (9%)

Query: 3   QPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFK 62
           +     + K+L WYD N R LPWR S         +PY +W+SEIMLQQT V TV PY++
Sbjct: 5   EKIVSFRKKLLAWYDENKRDLPWRRS--------KNPYHIWVSEIMLQQTRVDTVIPYYE 56

Query: 63  KFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKK 122
           +F+  +PT+  L++A +E +L AW GLGYY+R RN++  A  I+  + G FP+  E +  
Sbjct: 57  RFLDWFPTVESLANAPEERLLKAWEGLGYYSRVRNMQTAAQQIMTDFGGQFPNTYEGISS 116

Query: 123 LPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITS 180
           L GIG YTA AI +IAFN     VD N+ R+++R F++      P   K  +     +  
Sbjct: 117 LKGIGPYTAGAISSIAFNLTEPAVDGNVMRVLARLFEVNHDIGIPSNRKIFQAMMEILID 176

Query: 181 TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG 240
             +PGDF QA+MDLG+ I     P     P++     +  G      I   KK       
Sbjct: 177 PEKPGDFNQALMDLGSDIEAPVNPRPEESPVKDFSAAYQNGTMDSYPIKVPKKNPVSIYL 236

Query: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNT-- 298
              +      + LL K  + +LL G    P     +                 +      
Sbjct: 237 KALVVKNTQGQFLLEKNESEKLLAGFWHFPLIEVDNFSQEEQFDLFHQIAEESVNSGPSP 296

Query: 299 ---------------------ITHTFTHFTLTLFVWKTIVPQIVIIPD--STWHDAQNLA 335
                                + H F+H    + +    V       D    W   +   
Sbjct: 297 EESFQQDYGLDVDWLDAYFKMVKHVFSHRKWHVQIVAGQVSDFHDFSDREVRWLSPEEFK 356

Query: 336 NAALPTVMKKA 346
           N  L    +K 
Sbjct: 357 NYPLAKPQQKI 367


>gi|320547494|ref|ZP_08041780.1| A/G-specific adenine glycosylase [Streptococcus equinus ATCC 9812]
 gi|320447839|gb|EFW88596.1| A/G-specific adenine glycosylase [Streptococcus equinus ATCC 9812]
          Length = 381

 Score =  239 bits (609), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 116/369 (31%), Positives = 170/369 (46%), Gaps = 31/369 (8%)

Query: 3   QPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFK 62
           +     +  +L+WYD   R LPWR +         +PY +WISEIMLQQT V TV PY++
Sbjct: 15  EKIASFRRTLLNWYDNKKRDLPWRRT--------KNPYHIWISEIMLQQTQVVTVIPYYE 66

Query: 63  KFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKK 122
           +F+  +PTI  L++A +E+IL AW GLGYY+R RN++K A  I++ + G FP   + +  
Sbjct: 67  RFLDCFPTIESLANAPEEKILKAWEGLGYYSRVRNMQKAAQEIMENFGGVFPDNHKDILS 126

Query: 123 LPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITS 180
           L GIG YTA AI +IAF      VD N+ R+++R F++      P   K  +     +  
Sbjct: 127 LKGIGPYTAGAIASIAFGLPEPAVDGNVMRVMARLFEVNYDIGDPKNRKIFQAIMEVLID 186

Query: 181 TSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTG 240
             RPGDF QA+MDLG  I ++  P     PI+     +  G      I   KKK      
Sbjct: 187 PERPGDFNQALMDLGTDIESAKNPRPDESPIRFFSAAYLHGTYDKYPIKLPKKKPKPIQI 246

Query: 241 AVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWS---------STKDGNIDT--HSAPF 289
             F+   +D   L+ K  + RLL G    P                 +  + T    A F
Sbjct: 247 QAFVIRNSDGDFLMEKNLDGRLLGGFWSFPIMETDVIGQQLDLFEKNNAALQTISQKARF 306

Query: 290 TANWILCNT--------ITHTFTHFTLTLFVWKTIVPQI--VIIPDSTWHDAQNLANAAL 339
             ++ L           + HTF+H   T+ + +  V         +  W     L+   +
Sbjct: 307 KEDYHLKPNWTSKTFPAVKHTFSHQKWTIELIEGNVTTTDFTATKELRWIPQDQLSQYPM 366

Query: 340 PTVMKKALS 348
            T  KK L 
Sbjct: 367 ATPQKKMLK 375


>gi|327395119|dbj|BAK12541.1| A/G-specific adenine glycosylase MutY [Pantoea ananatis AJ13355]
          Length = 393

 Score =  239 bits (609), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 104/360 (28%), Positives = 168/360 (46%), Gaps = 19/360 (5%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                   ++LDWY    R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 34  MQAPQFAQQVLDWYQRFGRKTLPWQ--------LEKTPYKVWLSEVMLQQTQVATVIPYF 85

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++P +  L++A  +E+L  W GLGYY RARNL K A  +V  + G FP   + + 
Sbjct: 86  ERFMARFPDVSDLAAAPLDEVLHLWTGLGYYARARNLHKAAKQVVDLHGGEFPRHYDEVA 145

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLY--HKTIKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +          K +   + ++T
Sbjct: 146 ALPGVGRSTAGAILSLSLGLHFPILDGNVKRVLARCYAVGGWPGKKDVEKRLWQISEEVT 205

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT ++P C +CP+   C   +            K+  P R+
Sbjct: 206 PAQGVSQFNQAMMDLGAMVCTRSRPKCDICPLNSGCEARANNSWASYPGKKPKQTLPERS 265

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  + L +R    L  G+   P           +  H+    A        
Sbjct: 266 GWFLMMQHGDK-VWLEQRPPVGLWGGLFCFPQFTTEEAMTDWL--HARGIHAKPQQLTAF 322

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVPQ 356
            HTF+HF L +       P    ++      W++     +  L   +++ L    ++ PQ
Sbjct: 323 RHTFSHFHLDIVPMWLSWPSAGALMDEAGGLWYNLTLPPSVGLAAPVERLL--HELRHPQ 380


>gi|254784589|ref|YP_003072017.1| A/G-specific adenine glycosylase [Teredinibacter turnerae T7901]
 gi|237686175|gb|ACR13439.1| A/G-specific adenine glycosylase [Teredinibacter turnerae T7901]
          Length = 352

 Score =  239 bits (609), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 112/352 (31%), Positives = 180/352 (51%), Gaps = 16/352 (4%)

Query: 6   HIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
                ++L W+D + R  LPW+           +PY+VW+SEIMLQQT V+TV PYF++F
Sbjct: 2   SSFADRLLAWFDDHGRKNLPWQHP--------ITPYRVWLSEIMLQQTQVETVIPYFERF 53

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           + K+     L+ A  +E+L  W GLGYY RARNL +CA  +V ++ G+ P  +  L++LP
Sbjct: 54  VAKFSGFASLAEAPLDEVLHLWTGLGYYARARNLHRCAQQVVAQHGGDMPSDMAELEQLP 113

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPL--YHKTIKNYARKITSTS 182
           GIG  TA+AI +IAF     ++D N++R+++RY  +         H T+  +A K     
Sbjct: 114 GIGRSTAAAIASIAFEQPCAILDGNVKRVLARYHAVEGWPGKSSVHDTLWQFAEKHMPRE 173

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
           R  D+ QA+MDLGA +CT   P C +CP+++ C     G+         +K  P++T  +
Sbjct: 174 RCRDYTQAIMDLGATLCTRANPQCEVCPMRRGCKAKKTGQPQSFPGKKPRKILPVKTVQM 233

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHT 302
            I      ++LL +R  T +  G+   P     S  + +I         +      + HT
Sbjct: 234 LIMRNPQGQVLLLQRPPTGIWGGLWSFPEIETGSDCENHIAAQFGR-VQHLTRWPVMRHT 292

Query: 303 FTHFTLTLFVWKTIV---PQIVIIPDST-WHDAQNLANAALPTVMKKALSAG 350
           F+H+ L +      +   PQ +   DS  W++ ++     L   +KK L+  
Sbjct: 293 FSHYHLDIAPVVADLLPRPQNIAEADSRVWYNLKSPPALGLAAPVKKLLTLL 344


>gi|325689676|gb|EGD31680.1| A/G-specific adenine glycosylase [Streptococcus sanguinis SK115]
 gi|327489669|gb|EGF21460.1| A/G-specific adenine glycosylase [Streptococcus sanguinis SK1058]
          Length = 386

 Score =  239 bits (609), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 108/372 (29%), Positives = 154/372 (41%), Gaps = 34/372 (9%)

Query: 4   PEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKK 63
                + K+L WYD N R LPWR +         +PY +W+SEIMLQQT V TV PY+++
Sbjct: 16  KIASFREKLLTWYDKNKRDLPWRRT--------NNPYHIWVSEIMLQQTRVDTVIPYYER 67

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           F+  +PT+  L+ A ++ +L AW GLGYY+R RN++K A  I+  + G FP   E +  L
Sbjct: 68  FLDLFPTVADLAQAPEDRLLKAWEGLGYYSRVRNMQKAAQQIMTDFAGKFPDSYEGIASL 127

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYF--DIIKPAPLYHKTIKNYARKITST 181
            GIG YTA AI +IAF      VD N+ R++SR F  D+    P   K  +     +   
Sbjct: 128 KGIGPYTAGAIASIAFGLAEPAVDGNVMRVLSRLFEVDLDIGQPSNRKVFQAMMEILIDP 187

Query: 182 SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGA 241
            RPGDF QA+MDLG+ I     P     P+++    +  G      I   KKK       
Sbjct: 188 DRPGDFNQALMDLGSDIEAPVNPHPEDSPVKEFSAAYLHGTMDKYPIKAPKKKPVPVYLQ 247

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSS----------------------TKD 279
             I        LL K     LL G    P                             ++
Sbjct: 248 GLIIENEQGEFLLEKNEAAGLLSGFWHFPLIEIEEFQTENQMSLFEVAENQSSLDLSPQE 307

Query: 280 GNIDTHSAPFTANWILCNTITHTFTHFTLTLFVWKTIVPQIVIIPDST--WHDAQNLANA 337
                +           + + H F+H    + +    V       D    W   ++  N 
Sbjct: 308 SFEQDYDLIVDWQQQSFSKVQHVFSHRKWHIQLAYGRVKDSQHAADGEVLWLHPEDFGNY 367

Query: 338 ALPTVMKKALSA 349
                 +K   A
Sbjct: 368 PFAKPQQKMWEA 379


>gi|306829565|ref|ZP_07462755.1| A/G-specific adenine glycosylase [Streptococcus mitis ATCC 6249]
 gi|304428651|gb|EFM31741.1| A/G-specific adenine glycosylase [Streptococcus mitis ATCC 6249]
          Length = 386

 Score =  239 bits (609), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 108/373 (28%), Positives = 165/373 (44%), Gaps = 36/373 (9%)

Query: 2   PQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
            +     + K+L+WYD N R LPWR S         +PY +W+SEIMLQQT V TV PY+
Sbjct: 14  EEKIFSFREKLLNWYDENKRDLPWRRS--------KNPYHIWVSEIMLQQTRVDTVIPYY 65

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++F+  +PT+  L++A +E +L AW GLGYY+R RN++  A  I+  +EG FP+  E + 
Sbjct: 66  ERFLDWFPTVESLANAPEERLLKAWEGLGYYSRVRNMQAAAQQIMTDFEGKFPNTYEGIS 125

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            L GIG YTA AI +IAFN     VD N+ R+++R F++      P   K  +     + 
Sbjct: 126 SLKGIGPYTAGAISSIAFNLPEPAVDGNVMRVLARLFEVNYDIGVPSNRKIFQAMMEILI 185

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              RPGDF QA+MDLG+ I +   P     P+++    +  G      I   KKK     
Sbjct: 186 DPERPGDFNQALMDLGSDIESPVNPRPEESPVKEFSAAYQNGTMDRYPIKEPKKKPLPIY 245

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSS----------------------- 276
               +   +  + LL K  + +LL G    P                             
Sbjct: 246 LKALVVRNDRGQYLLEKNESEKLLAGFWHFPLIEVEEFSREDDQLDLFSQVKEESRAFGP 305

Query: 277 -TKDGNIDTHSAPFTANWILCNTITHTFTHFTLTLFVWKTIVPQIVIIPD--STWHDAQN 333
             ++     +      +      + H F+H    + +    V  +    D    W   Q 
Sbjct: 306 SPQESFEQDYDLEVDWSHQTFEQVKHVFSHRKWHIQILSGQVTGLKQFSDREIRWVSPQE 365

Query: 334 LANAALPTVMKKA 346
            ++  L    +K 
Sbjct: 366 FSDYPLAKPQQKI 378


>gi|238028663|ref|YP_002912894.1| A/G-specific adenine glycosylase MutY [Burkholderia glumae BGR1]
 gi|237877857|gb|ACR30190.1| A/G-specific adenine glycosylase MutY [Burkholderia glumae BGR1]
          Length = 369

 Score =  239 bits (609), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 108/363 (29%), Positives = 177/363 (48%), Gaps = 26/363 (7%)

Query: 2   PQPEH-IIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           P P H     +++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV P
Sbjct: 14  PTPLHASFARRLIAWQREHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVVP 65

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           Y+++F+ ++P +  L++A  +++++ WAGLGYYTRARNL +CA ++V+++ G FP   + 
Sbjct: 66  YYQRFLARFPEVAALAAAPADDVMALWAGLGYYTRARNLHRCAQVVVEQHGGRFPQTPDA 125

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKIT 179
           L +LPGIG  TA+AI + AF   A ++D N++R+++R F +             +    T
Sbjct: 126 LAELPGIGRSTAAAIASFAFGARAPILDGNVKRVLARVFGVEGFPGEKRVENDMWVLAET 185

Query: 180 ------STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKK 233
                   +    + Q +MDLGA +C   KP C  CP   +C+  + G+   L     KK
Sbjct: 186 LFPRDEDDAGISAYTQGLMDLGATLCGRGKPDCQRCPFAPDCVANATGRQRELPAARPKK 245

Query: 234 KRPMRTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANW 293
             P R     + + + + +LL +R    +  G+  LP +   +     +    A    + 
Sbjct: 246 AVPTRRT-WMLVLRDGDAVLLERRPPAGVWGGLWSLPEADGDA---AALQRVRAFGADSV 301

Query: 294 ILCNTITHTFTHFTLTLFVWKTIVPQIVIIP------DSTWHDAQNLANAALPTVMKKAL 347
           I     THTFTHF L +      V +           D+ W     L    +P  ++K L
Sbjct: 302 ISLAPFTHTFTHFRLEIEPRIAEVGRASGGQAGAADADTEWVPLARLDAYGVPAPVRKLL 361

Query: 348 SAG 350
            + 
Sbjct: 362 DSL 364


>gi|323493570|ref|ZP_08098691.1| A/G-specific adenine glycosylase [Vibrio brasiliensis LMG 20546]
 gi|323312093|gb|EGA65236.1| A/G-specific adenine glycosylase [Vibrio brasiliensis LMG 20546]
          Length = 351

 Score =  239 bits (609), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 105/351 (29%), Positives = 180/351 (51%), Gaps = 17/351 (4%)

Query: 8   IQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
             + IL+WYD   R  LPW+ +         S Y VW+SEIMLQQT V TV PY+++F++
Sbjct: 4   FANAILEWYDNYGRKSLPWQQN--------KSAYSVWLSEIMLQQTQVATVIPYYQRFLE 55

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A+ +E+L  W GLGYY RARNL K A ++ ++Y G FP  +E +  LPGI
Sbjct: 56  RFPTVIDLANAEQDEVLHLWTGLGYYARARNLHKAAKVVTEQYGGEFPLNIEEMNALPGI 115

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+AI++  +     ++D N++R ++R F +            +  YA++ T +   
Sbjct: 116 GRSTAAAILSSVYKQPHAILDGNVKRTLARSFAVEGWPGQKKVENQLWQYAQEHTPSVDV 175

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA++CT +KP C LCP++  C+   +G          KK++P++    F+
Sbjct: 176 DKYNQAMMDMGAMVCTRSKPKCTLCPVESYCVAKKQGNPLDYPGKKPKKEKPVKQA-WFV 234

Query: 245 AITNDNRILLRKRTNTRLLEGMDELP-GSAWSSTKDGNIDTHSAPFTANWILCNTITHTF 303
            + ++NR+ L +R  + +  G+   P  S        +    +              HTF
Sbjct: 235 MLHHNNRVWLEQRPQSGIWGGLFCFPENSDSQIAHQLDSRNVTEATIKRQTQLIAFRHTF 294

Query: 304 THFTLTLFVWKTIVPQ----IVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ L +      + +    ++      W++        L   +K+ L + 
Sbjct: 295 SHYHLDITPILVDLSKQPNVVMEGSKGLWYNLSQPEEIGLAAPVKQLLESL 345


>gi|114799676|ref|YP_760615.1| A/G-specific adenine glycosylase [Hyphomonas neptunium ATCC 15444]
 gi|114739850|gb|ABI77975.1| A/G-specific adenine glycosylase [Hyphomonas neptunium ATCC 15444]
          Length = 347

 Score =  239 bits (609), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 138/345 (40%), Positives = 186/345 (53%), Gaps = 13/345 (3%)

Query: 6   HIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
             + + +L W+D N RVLPWR    T+      PY+VW++EIMLQQTTV    PYF+ F 
Sbjct: 8   RELAAILLAWFDQNARVLPWRAPIGTK----RDPYRVWLAEIMLQQTTVPHAAPYFEAFT 63

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
           ++WPT+  L++A+DEE++ AWAGLGYY RARNL KCA  +  +    FP     L++LPG
Sbjct: 64  RRWPTVEDLAAAQDEEVMRAWAGLGYYARARNLLKCAREVAARGG--FPETSAGLRELPG 121

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTIKNYARKITSTSRPG 185
           IG YTA AI AIAF   A  VD N++R+ +R   +        K I      +    RPG
Sbjct: 122 IGPYTAGAIAAIAFGERAAAVDGNVDRVFARLLALKGEWAAEKKRIAAEVAALVPEERPG 181

Query: 186 DFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFIA 245
           DF +A+MDLGA ICT   P C +CP+   C   +EG+     +   K  +P+R G  ++ 
Sbjct: 182 DFAEALMDLGATICTPTSPNCMICPLTGLCKARAEGRPAEYPVKPAKTAKPVRHGHAWVY 241

Query: 246 ITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFTH 305
           +  D  + L +R    LL GM  LP   W   K+G     + P  A+W     + H FTH
Sbjct: 242 VKKDK-VWLVRRPPEGLLGGMLALPSGVW---KEGAAQEPAPPSDADWQPAGEVRHVFTH 297

Query: 306 FTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           FTL L VW+  V       + TW D        LPTV  KAL+  
Sbjct: 298 FTLRLAVWRANVSNSPAG-EGTWADPSE--ETGLPTVFAKALALA 339


>gi|326403695|ref|YP_004283777.1| A/G-specific DNA-adenine glycosylase [Acidiphilium multivorum
           AIU301]
 gi|325050557|dbj|BAJ80895.1| A/G-specific DNA-adenine glycosylase [Acidiphilium multivorum
           AIU301]
          Length = 358

 Score =  239 bits (608), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 145/346 (41%), Positives = 188/346 (54%), Gaps = 20/346 (5%)

Query: 9   QSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQKW 68
              +L WY  + R+LPWR  P +    LP PY VW+SEIMLQQT V TV PYF +F++++
Sbjct: 19  AENLLRWYHVHRRILPWRAGPGS----LPDPYHVWLSEIMLQQTVVATVIPYFHRFIERF 74

Query: 69  PTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGIGD 128
           PTI  L+ A D+EIL  WAGLGYY RARNL +CA  + +     FP  ++ L+ LPGIG 
Sbjct: 75  PTISDLAVAADDEILGLWAGLGYYARARNLIRCARAVAEAGG--FPVTLDGLRALPGIGP 132

Query: 129 YTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAP----LYHKTIKNYARKITSTSRP 184
           YTA+AI AIAF+   V VD N+ER+ +R F I +  P               +  + SRP
Sbjct: 133 YTAAAIGAIAFDIPVVPVDGNVERVTARMFAIEEALPAAKDAIAVAAARLGAQAAAQSRP 192

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
           GDF QA+ DLGA +CT   P C +CP +  C   + G S  L     +  RP+R G VF+
Sbjct: 193 GDFAQALFDLGATVCTPRSPSCMVCPWRDGCAAHARGLSADLPRKAKRAARPVRRGTVFV 252

Query: 245 AITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITHTFT 304
                  I LR+R    LL GM E+PG+ W    +        P  A+W+   TI H FT
Sbjct: 253 MQDRSGMIGLRRRPPRGLLGGMLEVPGTDW----EATAPPPVPPCAAHWLDAGTIVHVFT 308

Query: 305 HFTLTLFVWKTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           HF L L V    V     +P           +  LPTVM+KAL AG
Sbjct: 309 HFELRLTVKVGRV---AALPGGI---VAAPPDTPLPTVMRKALEAG 348


>gi|301768150|ref|XP_002919493.1| PREDICTED: A/G-specific adenine DNA glycosylase-like isoform 2
           [Ailuropoda melanoleuca]
          Length = 533

 Score =  239 bits (608), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 117/402 (29%), Positives = 169/402 (42%), Gaps = 60/402 (14%)

Query: 6   HIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
              +  +L WYD   R LPWR   + E       Y VW+SE+MLQQT V TV  Y+ ++M
Sbjct: 77  RAFRENLLRWYDREKRDLPWRRRAEGEVDLDRRAYAVWVSEVMLQQTQVATVIDYYTRWM 136

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKK-LP 124
           QKWPT+  L+SA  E +   WAGLGYY+R R L + A  +V++  G+ P   E L++ LP
Sbjct: 137 QKWPTLQDLASASLEGVNQLWAGLGYYSRGRRLHEGARKVVEELGGHVPRTAETLQQLLP 196

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDI--IKPAPLYHKTIKNYARKITSTS 182
           G+G YTA AI +IAF     VVD N+ R++ R   I     + L  + + + A+++   +
Sbjct: 197 GVGRYTAGAIASIAFGQATGVVDGNVVRVLCRVRAIGADSSSALVSQHLWSLAQQLVDPA 256

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSE---------------------- 220
           RPGD  QA M+LGA +CT   P C  CP++  C                           
Sbjct: 257 RPGDLNQAAMELGATVCTPQHPRCSQCPVRSLCRAHQRVEREQLLASRSLPGSPDVEECA 316

Query: 221 -----------------------GKSHLLGINTIKKKRPMRTGAVFIAITNDNRILLRKR 257
                                             +++                RILL +R
Sbjct: 317 PGSGQCRLCAPASEPWDPTLGVTNFPRKASRKPPREECSATCVLEQPRAVGGPRILLVQR 376

Query: 258 TNTRLLEGMDELPGSAWSST-------KDGNIDTHSAPFTA-NWILCNTITHTFTHFTLT 309
            N+ LL G+ E P      +           +   + P  A        + HTF+H  LT
Sbjct: 377 PNSGLLAGLWEFPSVTTEPSGQRQRQALLRELQRWAGPLPATRLRHLGQVVHTFSHIKLT 436

Query: 310 LFVW----KTIVPQIVIIPDSTWHDAQNLANAALPTVMKKAL 347
             V+    +   P     P + W   +    AA+ T MKK  
Sbjct: 437 YEVYGLALEGETPVTTAPPGARWLTREEFHTAAVSTAMKKVF 478


>gi|228919383|ref|ZP_04082751.1| hypothetical protein bthur0011_4100 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228840256|gb|EEM85529.1| hypothetical protein bthur0011_4100 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 365

 Score =  239 bits (608), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 114/352 (32%), Positives = 168/352 (47%), Gaps = 18/352 (5%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               Q+ ++ W++   R LPWR +          PY+VW+SEIMLQQT V+ V+PY+  F
Sbjct: 11  IEQFQNDLIGWFEEEQRDLPWRKN--------KDPYRVWVSEIMLQQTRVEAVKPYYANF 62

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M K+PT+  L++A DEE+L AW GLGYY+RARNL      + + Y G  P  V+ ++KL 
Sbjct: 63  MGKFPTLEALANADDEEVLKAWEGLGYYSRARNLHAAVKEVKEVYGGVVPSDVKKIEKLK 122

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKITSTS 182
           G+G YT  AI++IA+      VD N+ R++SR   +             +   R+I ST 
Sbjct: 123 GVGPYTKGAILSIAYGIPEPAVDGNVMRVLSRILSVWDDIAKPKTRKVFEEIVREIISTE 182

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
            P  F Q +M+LGALIC    P C LCP++++C  ++EG    L + +  K   M     
Sbjct: 183 NPSYFNQGLMELGALICIPKNPACLLCPVREHCRGYAEGVQKELPVKSKAKAPTMVPLVA 242

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWIL------- 295
            +  T D R ++ KR +T LL  M E P            +         + L       
Sbjct: 243 GVLQTEDGRYVINKRPSTGLLANMWEFPNIELGEGIRNQKEQLIDYMKEKFELGVSIDEY 302

Query: 296 CNTITHTFTHFTLTLFVWKTIVP-QIVIIPDSTWHDAQNLANAALPTVMKKA 346
              + HTFTH T  +FV+   V   IV      +   +           +  
Sbjct: 303 AMNVQHTFTHRTWDIFVFYGKVTGNIVDTDTLKFVSKEAFEQLPFSKSHRTI 354


>gi|85860977|ref|YP_463179.1| a/g-specific DNA glycosylase [Syntrophus aciditrophicus SB]
 gi|85724068|gb|ABC79011.1| a/g-specific DNA glycosylase [Syntrophus aciditrophicus SB]
          Length = 373

 Score =  239 bits (608), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 115/361 (31%), Positives = 179/361 (49%), Gaps = 20/361 (5%)

Query: 2   PQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
            Q    I + +  WY+ N R+LPWR++          PY +W+SEIMLQQT V+ V PY+
Sbjct: 19  EQNAQRIATLLTAWYEKNKRLLPWRST--------SDPYAIWLSEIMLQQTQVEAVIPYY 70

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++F++++PTI  L+ A  E +L  W  +GYY+RAR+L   A +I++ + G FP     L 
Sbjct: 71  RRFLEQFPTIEELARAPLEAVLKVWEKMGYYSRARHLHATARLILESHGGRFPANPVDLM 130

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            LPGIG YT+ AI++IAF      VD N++R++SR F +  P       + +   A K+ 
Sbjct: 131 ALPGIGSYTSGAILSIAFGKSVPAVDGNVKRVLSRLFFVDSPVDLTSTRRLLSALAEKLV 190

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              +PG F QA+M+LGA++C    PLC  CP+Q  CL ++    H L ++  + KRP R 
Sbjct: 191 PARQPGRFNQALMELGAVLCRPKTPLCSDCPLQSICLAYAGSGQHFLPVSRKRTKRPHRE 250

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTK------DGNIDTHSAPFTANW 293
               +   ++ R+L+ +R     L G+   PG   +  +      +           A  
Sbjct: 251 AVAAVIRDSEQRLLVIRRPAAGFLGGLWTFPGGMLNPGEIVTEAVERRCREGLNITVAAG 310

Query: 294 ILCNTITHTFTHFTLTLFVWKTI----VPQIVIIPDSTWHDAQNLANAALPTVMKKALSA 349
               T+  T+THF LTL V+       VP      +  W    ++ N        + L  
Sbjct: 311 DSLMTLQQTYTHFHLTLHVFAGTILDGVPDSPQKDNWRWVSPGDIRNLPFSRAELRILET 370

Query: 350 G 350
            
Sbjct: 371 L 371


>gi|322385563|ref|ZP_08059207.1| A/G-specific adenine glycosylase [Streptococcus cristatus ATCC
           51100]
 gi|321270301|gb|EFX53217.1| A/G-specific adenine glycosylase [Streptococcus cristatus ATCC
           51100]
          Length = 390

 Score =  239 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 108/374 (28%), Positives = 154/374 (41%), Gaps = 34/374 (9%)

Query: 2   PQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
            +     + K+L WYD + R LPWR S         +PY +W+SEIMLQQT V TV PY+
Sbjct: 17  EEKIASFRKKLLTWYDEHKRDLPWRRS--------NNPYHIWVSEIMLQQTRVDTVIPYY 68

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++F+  +PT+  L+ A +E +L AW GLGYY+R RN++K A  I+  + G FP   E + 
Sbjct: 69  ERFLDWFPTVADLARAPEERLLKAWEGLGYYSRVRNMQKAAQQIMANFAGKFPGSYEEIA 128

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYF--DIIKPAPLYHKTIKNYARKIT 179
            L GIG YTA AI +IAF      VD N+ R++SR F  D+    P   K  +     + 
Sbjct: 129 SLKGIGPYTAGAIASIAFGLPEPAVDGNVMRVLSRLFEVDLDIGQPSNRKVFQAMMEILI 188

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              RPGDF QA+MDLG+ I     P     P+++    +  G      I   KKK     
Sbjct: 189 DPDRPGDFNQALMDLGSDIEAPVNPHPEDSPVKEFSAAYLHGTMDKYPIKAPKKKPVPVY 248

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSS----------------------T 277
               I      + LL K     LL G    P                             
Sbjct: 249 LQGLIIENEQGQFLLEKNEAAGLLSGFWHFPLIEVEEFQSDNQMSLFEVAENQPSMDLSP 308

Query: 278 KDGNIDTHSAPFTANWILCNTITHTFTHFTLTLFVWKTIVPQIVIIPDST--WHDAQNLA 335
           ++     +             + H F+H    + +    V       +    W D +   
Sbjct: 309 QESFEQDYDLIVNWQQQSFPKVQHVFSHRKWHIQLVYGRVKDSQHEAEGEVLWLDPEEFE 368

Query: 336 NAALPTVMKKALSA 349
                   +K   A
Sbjct: 369 KYPFAKPQQKMWEA 382


>gi|300114678|ref|YP_003761253.1| A/G-specific adenine glycosylase [Nitrosococcus watsonii C-113]
 gi|299540615|gb|ADJ28932.1| A/G-specific adenine glycosylase [Nitrosococcus watsonii C-113]
          Length = 354

 Score =  239 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 106/359 (29%), Positives = 173/359 (48%), Gaps = 15/359 (4%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
             E      +L W+D+  R  LPW+ +P          Y++WISEIMLQQT V TV PY+
Sbjct: 1   MNEDDFSQHLLAWFDSYGRKDLPWQQNPTL--------YRIWISEIMLQQTQVATVIPYY 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++F++++P +  L+ A  +E+L  W GLGYY RAR L + A I+ + +EG  P  +E L 
Sbjct: 53  QRFIKRFPDLPALACASVDEVLGLWTGLGYYARARRLHQAARIVWETHEGKLPTTLEALM 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKIT 179
           +LPGIG  T  A++A+A +    ++D N++R++ R   I      P   K +   A  + 
Sbjct: 113 ELPGIGRSTGGAMLALALDQRHPILDGNVKRVLIRQEAIEHWPGQPKVEKQLWQRATTLL 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
             +R  D+ QA+MDLGA +CT  +P CP CP+++ C    +           +K+ P+RT
Sbjct: 173 PQTRLADYTQAIMDLGATVCTRYRPRCPSCPVKETCQAHLQANPEAYPQPRPRKRLPLRT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
             + I + +   +LL +R  T +  G+   P     +                     ++
Sbjct: 233 TCMLILLNDQGEVLLERRPPTGIWGGLWSFPECPSQTEAAPWCQEQLGWPLGEVQNWPSL 292

Query: 300 THTFTHFTLTLFVWKTIV----PQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKV 354
            H FTHFTL +      +     Q++      W+  + L    LP  + + L     + 
Sbjct: 293 RHHFTHFTLDIQPVVARIRGESRQVMEPNGRVWYKMEPLYKRGLPAPILRLLKRLREQS 351


>gi|330818347|ref|YP_004362052.1| A/G-specific adenine glycosylase MutY [Burkholderia gladioli BSR3]
 gi|327370740|gb|AEA62096.1| A/G-specific adenine glycosylase MutY [Burkholderia gladioli BSR3]
          Length = 371

 Score =  239 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 104/365 (28%), Positives = 174/365 (47%), Gaps = 27/365 (7%)

Query: 5   EHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKK 63
           E    ++++ W   + R  LPW+ +          PY++W+SEIMLQQT V TV PY+++
Sbjct: 18  EASFATRLIAWQREHGRHDLPWQNT--------RDPYRIWLSEIMLQQTQVSTVVPYYQR 69

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           F++ +P +  L++A  +++++ WAGLGYYTRARNL +CA +++ ++ G+FP   E L +L
Sbjct: 70  FLEHFPDVAALAAAPADQVMALWAGLGYYTRARNLHRCAQVVMAEHGGHFPESPEALAEL 129

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKTI------KNYARK 177
           PGIG  TA+AI + AF   A ++D N++R+++R F +                 +    +
Sbjct: 130 PGIGRSTAAAISSFAFGARAPILDGNVKRVLARVFGVEGFPGEKRVENGMWALAERLFPR 189

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
               +    + Q +MDLGA +C   KP C  CP   +C+  + G+   L     KK  P 
Sbjct: 190 EADDAGISAYTQGLMDLGATLCGRGKPDCKRCPFAADCVANTTGRQRELPAARPKKAVPT 249

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
           R     + + + + +LL +R  T +  G+  LP +   +     +           I   
Sbjct: 250 RRT-WMLVLRDGDTVLLERRPPTGIWGGLWSLPEADGDA---AALQRVREFGAEAVIPLA 305

Query: 298 TITHTFTHFTLTLFVWKTIVPQI--------VIIPDSTWHDAQNLANAALPTVMKKALSA 349
             TH FTHF L +      +               D+ W     L    LP  ++K L +
Sbjct: 306 PFTHVFTHFRLEIEPRIADIGAAQAAGGMLVAASADTEWVPLARLDAYGLPAPVRKLLDS 365

Query: 350 GGIKV 354
               +
Sbjct: 366 LSGPL 370


>gi|88797897|ref|ZP_01113485.1| A/G-specific adenine glycosylase [Reinekea sp. MED297]
 gi|88779574|gb|EAR10761.1| A/G-specific adenine glycosylase [Reinekea sp. MED297]
          Length = 353

 Score =  239 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 110/361 (30%), Positives = 184/361 (50%), Gaps = 21/361 (5%)

Query: 1   MPQPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEP 59
           M       ++ +L WYD + R  LPW+        +  + Y+VW+SE+MLQQT V TV P
Sbjct: 1   MHCSVTWFRNAVLAWYDRHGRKDLPWQ--------TGKTAYRVWLSEVMLQQTQVTTVIP 52

Query: 60  YFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEI 119
           YF+ F +++P +  L+ A  +E+L  W GLGYY RARNL K A  ++  + G FP   E 
Sbjct: 53  YFQAFTERFPDVAALAEADIDEVLHLWTGLGYYARARNLHKAAKAVMDSFGGEFPADPEA 112

Query: 120 LKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARK 177
           L+ LPG+G  TA+AIV+  F+  A ++D N++R++SR+F + +        K +  ++  
Sbjct: 113 LETLPGVGRSTAAAIVSSVFDRRAAILDGNVKRVLSRFFALEEWPGSTAAQKQLWAWSEA 172

Query: 178 ITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPM 237
           +T  +R  D+ Q MMDLGAL+C  ++P C  CP+ + CL      +  L  +  KK +P+
Sbjct: 173 LTPQTRVADYNQVMMDLGALVCKRSRPACAECPLSEECLAHRHDLTSELPKSKPKKAKPV 232

Query: 238 RTGAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN 297
           RT  + +  + + ++LL++R  + +  G+   P  +     +  +D+ +     +W    
Sbjct: 233 RTCFMVLQQSPEGQVLLQQRPASGIWGGLYSFPEFSDEGALEHYLDSIAIEKQEHW---T 289

Query: 298 TITHTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLAN----AALPTVMKKALSAG 350
              HTF+H+ L +             V      W +   L +      LP  +K+ L   
Sbjct: 290 PFRHTFSHYHLDIAPIVVHQQTAVPGVAESGHLWFNPHLLDDAEQAIGLPAPVKQLLIKL 349

Query: 351 G 351
            
Sbjct: 350 A 350


>gi|258538839|ref|YP_003173338.1| A/G-specific adenine glycosylase [Lactobacillus rhamnosus Lc 705]
 gi|257150515|emb|CAR89487.1| A/G-specific adenine glycosylase [Lactobacillus rhamnosus Lc 705]
          Length = 365

 Score =  239 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 113/369 (30%), Positives = 170/369 (46%), Gaps = 24/369 (6%)

Query: 2   PQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
           P+     Q  +LDWYD + R LPWR            PY V +SE+MLQQT V+TV PY+
Sbjct: 5   PEKIAAFQHALLDWYDHHARALPWRQD--------HDPYHVMVSELMLQQTQVQTVIPYY 56

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           K+FM ++PT+  L++A +  +L AW GLGYY+RAR L++ A  IV  Y+G +P     L+
Sbjct: 57  KRFMAQFPTVEALAAAPEATVLKAWEGLGYYSRARRLQQAAKQIVNDYDGKWPKTAAELQ 116

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKIT 179
            L GIG YTA AI +I+F      +D N  R+ +R F +      P   K   +  R + 
Sbjct: 117 TLAGIGPYTAGAIASISFGEVVPAIDGNAFRVFARLFKVDADIARPQTRKVFDDLIRPLM 176

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              RPGDF QA+MDLG+   +++ P     P++    +F +G      + T K +  +  
Sbjct: 177 PKKRPGDFNQAVMDLGSSYMSASHPDPAHSPVRAFDASFRDGVVQDYPVKTKKPRPVIHR 236

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILC--- 296
               + I +    LL +R    +L  +   P    +  +           +A +      
Sbjct: 237 Y-FALVIRSKAGYLLEQRPGKGMLADLWMFPLIDIADLEATMESEQLDEISARFADLSGM 295

Query: 297 ---------NTITHTFTHFTLTLFVWKTIVPQI-VIIPDSTWHDAQNLANAALPTVMKKA 346
                      + HTFTH    L +         +    + W   ++    ALPTV KK 
Sbjct: 296 TLTFADLGRPQVQHTFTHQRWQLTLIGADAAAAELKFMPARWVPVEDFGKMALPTVQKKL 355

Query: 347 LSAGGIKVP 355
             A G+  P
Sbjct: 356 NRALGLTEP 364


>gi|329929447|ref|ZP_08283181.1| A/G-specific adenine glycosylase [Paenibacillus sp. HGF5]
 gi|328936335|gb|EGG32782.1| A/G-specific adenine glycosylase [Paenibacillus sp. HGF5]
          Length = 382

 Score =  239 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 125/386 (32%), Positives = 179/386 (46%), Gaps = 45/386 (11%)

Query: 1   MPQPEHI--IQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVE 58
           M   EH      ++LDWY+ N R LPWR            PY +W+SEIMLQQT V TV 
Sbjct: 1   MHNTEHKRYFSLELLDWYEINKRDLPWRR--------HRDPYYIWVSEIMLQQTRVDTVI 52

Query: 59  PYFKKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVE 118
           PYF +F++++PTI  L+ A ++++L  W GLGYY+RARNL+  A  + ++Y+G  P   +
Sbjct: 53  PYFHRFIERFPTIQSLADAPEDDVLKCWEGLGYYSRARNLQAAARQVTEQYDGVMPSGKD 112

Query: 119 ILKKLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYAR 176
            +  L GIG YT+ AI +IAFN  A  VD N+ R++SRYF I +          ++    
Sbjct: 113 EVSGLKGIGPYTSGAIRSIAFNIPAAAVDGNVMRVLSRYFLIEEDIMKVKTRTKMEELVL 172

Query: 177 KITSTSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRP 236
            +    R  DF QA+M+LGALICT   P C +CP+ ++C    EGK   L I T  K   
Sbjct: 173 TLVPDGRASDFTQALMELGALICTPKSPKCLVCPVMEHCSARLEGKEESLPIKTKAKPPR 232

Query: 237 MRTGAVFIAITNDNR---ILLRKRTNTRLLEGMDELPG---------SAWSSTKDGNIDT 284
                  I          IL+RKR    LL GM ELP             +  ++  +  
Sbjct: 233 PEYRLTAIVEGTGVHEGKILIRKRPAAGLLAGMWELPHVIVPADGSSVPAAMPEETAMVR 292

Query: 285 HSAPFTANWILCNTI------THTFTHFTLTLFVWKTIVPQIVI---------------I 323
                    +    I       HTF+H    + V++     +                  
Sbjct: 293 LRDALLEEGVPVQPIGHVMDAEHTFSHIQWNMGVYRCKWQDVPPAALQAAESAAAYETGE 352

Query: 324 PDSTWHDAQNLANAALPTVMKKALSA 349
            +  W   Q++   A P V  + L+A
Sbjct: 353 ENFRWIHVQDMERYAFPNVFIRILNA 378


>gi|307708759|ref|ZP_07645221.1| A/G-specific adenine glycosylase [Streptococcus mitis NCTC 12261]
 gi|307615125|gb|EFN94336.1| A/G-specific adenine glycosylase [Streptococcus mitis NCTC 12261]
          Length = 391

 Score =  239 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 112/380 (29%), Positives = 159/380 (41%), Gaps = 35/380 (9%)

Query: 2   PQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
            +     + K+L WYD N R LPWR S         +PY +W+SEIMLQQT V TV PY+
Sbjct: 14  EEKIISFREKLLAWYDENKRDLPWRRS--------KNPYHIWVSEIMLQQTRVDTVIPYY 65

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++F+  +PT+  L +A +E +L AW GLGYY+R RNL+  A  I+  + G FP+  E + 
Sbjct: 66  ERFLDWFPTVESLENAPEERLLKAWEGLGYYSRVRNLQAAAQQIMTDFGGQFPNTYEGIS 125

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKIT 179
            L GIG YTA AI +IAFN     VD N+ R+++R F++      P   K  +     + 
Sbjct: 126 SLKGIGPYTAGAISSIAFNLPEPAVDGNVMRVLARLFEVNHDIGIPSNRKIFQAMMEILI 185

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              RPGDF QA+MDLG+ I     P     P++     +  G      I   KKK     
Sbjct: 186 DPERPGDFNQALMDLGSDIEAPVNPRPEESPVKDFSAAYQNGTMDRYPIKAPKKKPVPIY 245

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN-- 297
               +      + LL K  + +LL G    P     +   G             +     
Sbjct: 246 LKALVVKNTQGQFLLEKNESEKLLAGFWHFPLIEVDNFSQGEQFDLFHQVAEESVNFGPS 305

Query: 298 ---------------------TITHTFTHFTLTLFVWKTIVPQIVIIPD--STWHDAQNL 334
                                T+ H F+H    + +    V      PD    W   +  
Sbjct: 306 PEESFQQDYDLDVDWLDIYFETVKHIFSHRKWHVQIVAGQVSDYNDFPDREVRWLSPEEF 365

Query: 335 ANAALPTVMKKALSAGGIKV 354
            N  L    +K   A     
Sbjct: 366 KNYPLAKPQQKIWQAYAQAN 385


>gi|257464774|ref|ZP_05629145.1| A/G-specific adenine glycosylase [Actinobacillus minor 202]
 gi|257450434|gb|EEV24477.1| A/G-specific adenine glycosylase [Actinobacillus minor 202]
          Length = 378

 Score =  239 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 115/371 (30%), Positives = 170/371 (45%), Gaps = 35/371 (9%)

Query: 5   EHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKK 63
           E      +L WY    R  LPW+ +           Y VW+SE+MLQQT V TV PYF++
Sbjct: 16  EAPFAKSVLAWYQQYGRKHLPWQQNKSL--------YGVWLSEVMLQQTQVVTVIPYFER 67

Query: 64  FMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKL 123
           FMQ++PT+  L++A  +E+L  W GLGYY RARNL K A  I  ++ G FP     +  L
Sbjct: 68  FMQRFPTVVDLANASIDEVLHLWTGLGYYARARNLHKAAQQIRDEFGGEFPTSFADVLVL 127

Query: 124 PGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITST 181
            G+G  TA AI++   N    ++D N++R++SRYF +            +      +T T
Sbjct: 128 SGVGRSTAGAILSSVLNAPHPILDGNVKRVLSRYFAVEGWAGEKPIENRLWALTEAVTPT 187

Query: 182 SRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGA 241
           S+  DF QAMMDLGA+ICT +KP C LCP++KNC   ++           KK  P    +
Sbjct: 188 SQVADFNQAMMDLGAMICTRSKPKCSLCPLEKNCQANAQQAWADFPAKKPKKALPE-KQS 246

Query: 242 VFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTITH 301
            F+ +     ILL KR    L  G+   P      T    + + +   +          H
Sbjct: 247 YFLILKRGTDILLEKREAKGLWGGLYVFPQFEDFDTLKRFVFSQNLQIS---QQLTAFRH 303

Query: 302 TFTHFTLTLFVWKTIVP----------QIVIIPD----------STWHDAQNLANAALPT 341
           TF+HF L +      +           ++               + W+D  +     L T
Sbjct: 304 TFSHFHLDITPILVELDLQKIDETLPLKVAENSGNYRPSVSSKANYWYDLTSPNEIGLAT 363

Query: 342 VMKKALSAGGI 352
            +K+ L    +
Sbjct: 364 PVKRILDELSL 374


>gi|238787380|ref|ZP_04631179.1| A/G-specific adenine glycosylase [Yersinia frederiksenii ATCC
           33641]
 gi|238724642|gb|EEQ16283.1| A/G-specific adenine glycosylase [Yersinia frederiksenii ATCC
           33641]
          Length = 352

 Score =  239 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 107/357 (29%), Positives = 171/357 (47%), Gaps = 16/357 (4%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                   ++L+WY    R  LPW+           +PY+VW+SE+MLQQT V TV PYF
Sbjct: 2   MQAQQFAHQVLEWYQRFGRKTLPWQ--------LDKTPYQVWLSEVMLQQTQVATVIPYF 53

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FMQ +P I  L++A  +E+L  W GLGYY RARNL K A  +V++++G FP   + + 
Sbjct: 54  QRFMQHFPDIRALAAAPLDEVLHLWTGLGYYARARNLHKAAQTVVERHQGEFPTTFDEIL 113

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLY--HKTIKNYARKIT 179
            LPGIG  TA AI++++      ++D N++R+++R + +            +   +  IT
Sbjct: 114 ALPGIGRSTAGAILSLSLGQHFPILDGNVKRVLARCYAVEGWPGKKDVEGRLWQISEDIT 173

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                G F QAMMDLGA++CT +KP C LCP+   CL ++            K+  P   
Sbjct: 174 PAKGVGQFNQAMMDLGAIVCTRSKPKCELCPLNLGCLAYANHSWASYPGKKPKQTIPE-K 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
            A F+ + ND+++ L +R    L  G+   P  A     +  +        ++       
Sbjct: 233 TAYFLLMQNDSQVWLDQRPPVGLWGGLFCFPQFAEQEELNNWLQQ-RGLAPSDLQQLTAF 291

Query: 300 THTFTHFTLTLFVWKTIVPQIVIIPD---STWHDAQNLANAALPTVMKKALSAGGIK 353
            HTF+HF L +              D     W++     +  L   +++ L     +
Sbjct: 292 RHTFSHFHLDIVPMWLDTASNRGCMDDGAGLWYNLAQPPSVGLAAPVERLLHQLAKQ 348


>gi|95928413|ref|ZP_01311161.1| A/G-specific adenine glycosylase [Desulfuromonas acetoxidans DSM
           684]
 gi|95135684|gb|EAT17335.1| A/G-specific adenine glycosylase [Desulfuromonas acetoxidans DSM
           684]
          Length = 358

 Score =  239 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 108/358 (30%), Positives = 172/358 (48%), Gaps = 18/358 (5%)

Query: 2   PQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
           P    + Q ++L WYD   R LPWR            PY++W+SE+MLQQT V+ V PYF
Sbjct: 4   PVNAAVFQQRLLAWYDRCGRELPWR--------LSRDPYRIWLSEVMLQQTGVQAVIPYF 55

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++F+ ++P +  L+SA  + ++  WAGLGYY+RARNL   A  + + ++G FPH V+ L 
Sbjct: 56  ERFVDQFPDVESLASAPLDAVIELWAGLGYYSRARNLHAAAQKVCEAFQGQFPHSVDALM 115

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDI--IKPAPLYHKTIKNYARKIT 179
            LPG+G  TA AI AIAF+ + V++D N+ R + R F       +    K +  +A ++T
Sbjct: 116 TLPGVGRSTAGAIRAIAFDRYGVILDGNVRRGLCRLFAWQDDPRSSAAEKQLWQWAAQLT 175

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                 D+ QA+MD GA +CT  +P C  CP+   C  + +G    L     +K  P+R 
Sbjct: 176 PQQHCHDYAQAIMDFGATLCTPRQPNCVACPMISLCQGYQQGIQDQLPRKRQRKTVPLRQ 235

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDG-----NIDTHSAPFTANWI 294
               + + ++ R  +R+R  T +L G+ E P  ++   +                     
Sbjct: 236 EVAVL-VEHNGRFAVRQRPLTGMLAGLWEFPSQSFKQPQSAQQLVNQARILIGNEDQPLQ 294

Query: 295 LCNTITHTFTHFTLTLFVWK--TIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
               + H ++HF + +  +     VP         W     L +  L    KK +   
Sbjct: 295 TLGVVRHVYSHFRVDVTTFYLQADVPLAESFSSCRWLTEAELTDWPLHGSHKKIVETL 352


>gi|90417411|ref|ZP_01225335.1| adenine glycosylase [marine gamma proteobacterium HTCC2207]
 gi|90330745|gb|EAS46020.1| adenine glycosylase [marine gamma proteobacterium HTCC2207]
          Length = 350

 Score =  239 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 116/356 (32%), Positives = 171/356 (48%), Gaps = 19/356 (5%)

Query: 3   QPEHIIQSKILDWYDTNHR-VLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                 Q  +LDW+D   R  LPW+             Y VW+SEIMLQQT V TV PYF
Sbjct: 1   MRPAQFQKAVLDWFDQYGRTNLPWQQDTG--------AYPVWVSEIMLQQTQVSTVIPYF 52

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FMQ +PT+  L+SA  + +L  W GLGYY RARNL K A  +V + +G FP  V  L 
Sbjct: 53  ERFMQSFPTVHDLASAPLDNVLHHWTGLGYYARARNLHKTAQHVVTELDGQFPDNVTQLI 112

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYH--KTIKNYARKIT 179
           +LPGIG  TA AI +IAF + A ++D N++R+++R+             + +   A   T
Sbjct: 113 ELPGIGRSTAGAISSIAFKNQASILDGNVKRVLARFSATEGWPGKREVVEQLWLIAETFT 172

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
              R  D+ QAMMDLGA +CT + P C  CP+  NC+ + +G          KKK P++T
Sbjct: 173 PLDRIADYTQAMMDLGATLCTRSSPNCSECPLMGNCIAYKQGNPKDYPGKKPKKKLPVKT 232

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
               +       +LL +     L  G+   P           +         +  +    
Sbjct: 233 SYFLMLRNEFGELLLEQNPPVGLWGGLWIFPQCETKEDL-AELYARLGVEPDSEQILEVK 291

Query: 300 THTFTHFTLTLFVWKTIVP-------QIVIIPDSTWHDAQNLANAALPTVMKKALS 348
            HTF+HF L     ++ +        Q+   P+  W++ QN  +  +P  +K  L+
Sbjct: 292 RHTFSHFHLDYQPVQSEISSAGLSALQVAESPNQVWYNPQNPLSLGMPAPIKALLA 347


>gi|291618788|ref|YP_003521530.1| MutY [Pantoea ananatis LMG 20103]
 gi|291153818|gb|ADD78402.1| MutY [Pantoea ananatis LMG 20103]
          Length = 393

 Score =  239 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 104/360 (28%), Positives = 167/360 (46%), Gaps = 19/360 (5%)

Query: 3   QPEHIIQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
                   ++LDWY    R  LPW+           +PYKVW+SE+MLQQT V TV PYF
Sbjct: 34  MQAPQFAQQVLDWYQRFGRKTLPWQ--------LEKTPYKVWLSEVMLQQTQVATVIPYF 85

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++FM ++P +  L++A  +E+L  W GLGYY RARNL K A  +V  + G FP   + + 
Sbjct: 86  ERFMARFPDVSDLAAAPLDEVLHLWTGLGYYARARNLHKAAKQVVDLHGGEFPRHYDEVA 145

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLY--HKTIKNYARKIT 179
            LPG+G  TA AI++++      ++D N++R+++R + +          K +   + ++T
Sbjct: 146 ALPGVGRSTAGAILSLSLGLHFPILDGNVKRVLARCYAVGGWPGKKDVEKRLWQISEEVT 205

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
                  F QAMMDLGA++CT ++P C +CP+   C   +            K+  P R+
Sbjct: 206 PAQGVSQFNQAMMDLGAMVCTRSRPKCDICPLNSGCEARANNSWASYPGKKPKQTLPERS 265

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCNTI 299
           G   +    D  + L +R    L  G+   P           +  H+    A        
Sbjct: 266 GWFLMMQHGDK-VWLEQRPPVGLWGGLFCFPQFTTEEAMTDWL--HARGIHAKPQQLTAF 322

Query: 300 THTFTHFTLTLFVWKTIVPQ---IVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVPQ 356
            HTF+HF L +       P    ++      W++        L   +++ L    ++ PQ
Sbjct: 323 RHTFSHFHLDIVPMWLSWPSAGALMDEAGGLWYNLTLPPPVGLAAPVERLL--HELRHPQ 380


>gi|146318706|ref|YP_001198418.1| A/G-specific DNA glycosylase [Streptococcus suis 05ZYH33]
 gi|146320915|ref|YP_001200626.1| A/G-specific DNA glycosylase [Streptococcus suis 98HAH33]
 gi|145689512|gb|ABP90018.1| A/G-specific DNA glycosylase [Streptococcus suis 05ZYH33]
 gi|145691721|gb|ABP92226.1| A/G-specific DNA glycosylase [Streptococcus suis 98HAH33]
 gi|292558386|gb|ADE31387.1| A/G-specific adenine glycosylase MutY [Streptococcus suis GZ1]
 gi|319758168|gb|ADV70110.1| A/G-specific DNA glycosylase [Streptococcus suis JS14]
          Length = 410

 Score =  239 bits (608), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 108/368 (29%), Positives = 158/368 (42%), Gaps = 31/368 (8%)

Query: 2   PQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
            +     +  +LDWYD N R LPWR +          PY +W+SEIMLQQT V TV PY+
Sbjct: 38  EEKIQAFRKALLDWYDANKRDLPWRRT--------KDPYAIWVSEIMLQQTRVDTVIPYY 89

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
           ++F+   PTI  L+ A +E IL  W GLGYY+R RN++K A  +V+ ++G FP     + 
Sbjct: 90  ERFLHHLPTISDLAQAPEEVILKLWEGLGYYSRVRNMQKAAQQMVEDFDGQFPTTHAAIS 149

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKIT 179
            L GIG YTA AI +IAFN     VD N+ R++SR F++      P   K  +     + 
Sbjct: 150 SLKGIGPYTAGAISSIAFNLPEPAVDGNVMRVLSRLFEVDYDIGLPANRKIFQAMMELLI 209

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
            + RPGDF QA+MDLG+ I +   P     P++     +  G      I   KKK     
Sbjct: 210 DSERPGDFNQALMDLGSDIESPVNPRPQDSPVKAFSAAYLNGTMDKYPIKAPKKKPIPVA 269

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNI----------------- 282
              F+    DN+ LL K     LL G    P     +  D  +                 
Sbjct: 270 YQGFLIRNKDNQFLLEKNNEAGLLSGFWSFPLLEKGAIVDKQVSLFEVAEEVVQPDIRQS 329

Query: 283 --DTHSAPFTANWILCNTITHTFTHFTLTLFVW--KTIVPQIVIIPDSTWHDAQNLANAA 338
             + +             + H F+H    + +         +    +  W   ++     
Sbjct: 330 FTELYGLTVDWQEQEFGIVQHIFSHRKWQIEMVEGVAETLNLPESKELKWVSVEDFPTYP 389

Query: 339 LPTVMKKA 346
                +K 
Sbjct: 390 FAKPQQKM 397


>gi|329116556|ref|ZP_08245273.1| A/G-specific adenine glycosylase [Streptococcus parauberis NCFD
           2020]
 gi|326906961|gb|EGE53875.1| A/G-specific adenine glycosylase [Streptococcus parauberis NCFD
           2020]
          Length = 381

 Score =  239 bits (608), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 117/372 (31%), Positives = 181/372 (48%), Gaps = 31/372 (8%)

Query: 2   PQPEHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYF 61
           P+     +  +L+W+D   R LPWR +         +PY +W+SEIMLQQT V+TV PY+
Sbjct: 16  PEKIQSFRRTLLNWHDQEKRDLPWRRT--------KNPYFIWVSEIMLQQTQVQTVIPYY 67

Query: 62  KKFMQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILK 121
            +F++ +PTI  L+SA + ++L AW GLGYY+R RN++K A  I+ +++G FP + E + 
Sbjct: 68  HRFIEWFPTIEELASAPEHKLLKAWEGLGYYSRVRNMQKAARQIMTEFDGTFPSRFEDIS 127

Query: 122 KLPGIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKIT 179
           +L GIG YTA AI +IAFN     VD NI R+++R F++      P   K  +    ++ 
Sbjct: 128 ELKGIGPYTAGAIASIAFNQAQPAVDGNIMRVMARLFEVEYDIGNPKNRKIFQAIMEELI 187

Query: 180 STSRPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRT 239
            + RPGDF QA+MDLG  I ++  P     PI+  C  +  G      I   KKK     
Sbjct: 188 DSERPGDFNQALMDLGTDIESAKNPRPDDSPIKFFCAAYLHGTYDKYPIKLPKKKPRPMV 247

Query: 240 GAVFIAITNDNRILLRKRTNTRLLEGMDELPGSAWS-------------------STKDG 280
              F+    + + L+ K     LL G    P    S                   S KD 
Sbjct: 248 IQAFVIRNAEGKYLIEKNNAGPLLGGFWTFPIIETSFQAKQIDLFGDAQEILETLSQKDA 307

Query: 281 NIDTHSAPFTANWILCNTITHTFTHFTLTLFVWKTIV--PQIVIIPDSTWHDAQNLANAA 338
             + +         +   +THTF+H   T+ +++  V   Q+    +  W   ++  N  
Sbjct: 308 FQEQYQLYPIWQDTVHKKVTHTFSHQKWTIELFEGRVSDNQLPEGLELQWLSLEDFENFP 367

Query: 339 LPTVMKKALSAG 350
           + T  KK ++  
Sbjct: 368 MATPQKKMIAQL 379


>gi|261250155|ref|ZP_05942731.1| A/G-specific adenine glycosylase [Vibrio orientalis CIP 102891]
 gi|260939271|gb|EEX95257.1| A/G-specific adenine glycosylase [Vibrio orientalis CIP 102891]
          Length = 351

 Score =  239 bits (608), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 105/351 (29%), Positives = 172/351 (49%), Gaps = 17/351 (4%)

Query: 8   IQSKILDWYDTNHRV-LPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
             S IL+WY+   R  LPW+ +         + Y VW+SEIMLQQT V TV PY+++F++
Sbjct: 4   FASAILEWYENYGRKSLPWQQN--------KTAYSVWLSEIMLQQTQVATVIPYYQRFLE 55

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPGI 126
           ++PT+  L++A+ +E+L  W GLGYY RARNL K A ++ K+Y+G FP  +E +  LPGI
Sbjct: 56  RFPTVIDLANAEQDEVLHLWTGLGYYARARNLHKAAKVVAKQYDGKFPLNIEEMNALPGI 115

Query: 127 GDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKP--APLYHKTIKNYARKITSTSRP 184
           G  TA+AI++  +     ++D N++R ++R F +            +  +A + T     
Sbjct: 116 GRSTAAAILSSVYKQPHAILDGNVKRTLARSFAVEGWPGQKKVENQLWQFAEEHTPAVDV 175

Query: 185 GDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVFI 244
             + QAMMD+GA++CT +KP C LCP++  C+   +            KK      A FI
Sbjct: 176 DKYNQAMMDMGAMVCTRSKPKCTLCPVESFCVANKQNNPLDYPG-KKPKKEKPIKEAWFI 234

Query: 245 AITNDNRILLRKRTNTRLLEGMDELP-GSAWSSTKDGNIDTHSAPFTANWILCNTITHTF 303
            +    ++ L +R  + +  G+   P  S        +I   S              HTF
Sbjct: 235 MLHYQGQVWLEQRPQSGIWGGLFCFPENSDADLAHQIDIRGVSEADIRAQTQLIAFRHTF 294

Query: 304 THFTLTLFVWKTIVPQ----IVIIPDSTWHDAQNLANAALPTVMKKALSAG 350
           +H+ L +      + +    I+      W++        L   +K+ L + 
Sbjct: 295 SHYHLDITPILVDLSKQPNVIMEAGKGLWYNLSQPEEIGLAAPVKQLLESL 345


>gi|228963604|ref|ZP_04124757.1| hypothetical protein bthur0004_4830 [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228796122|gb|EEM43577.1| hypothetical protein bthur0004_4830 [Bacillus thuringiensis serovar
           sotto str. T04001]
          Length = 365

 Score =  239 bits (608), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 113/352 (32%), Positives = 168/352 (47%), Gaps = 18/352 (5%)

Query: 5   EHIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKF 64
               Q+ ++ W++   R LPWR +          PY+VW+SEIMLQQT V+ V+PY+  F
Sbjct: 11  IEQFQNDLIGWFEEEQRDLPWRKN--------KDPYRVWVSEIMLQQTRVEAVKPYYANF 62

Query: 65  MQKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLP 124
           M K+PT+  L++A DEE+L AW GLGYY+RARNL      + + Y G  P  V+ ++KL 
Sbjct: 63  MGKFPTLEALANADDEEVLKAWEGLGYYSRARNLHAAVKEVKEVYGGVVPSDVKKIEKLK 122

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPAPLYHKT--IKNYARKITSTS 182
           G+G YT  AI++IA+      VD N+ R++SR   +             +   R+I S  
Sbjct: 123 GVGPYTKGAILSIAYGIPEPAVDGNVMRVLSRILSVWDDIAKPKTRKVFEEIVREIISVE 182

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAV 242
            P  F Q +M+LGALIC    P C LCP++++C  ++EG    L + +  K   M     
Sbjct: 183 NPSYFNQGLMELGALICIPKNPSCLLCPVREHCRGYAEGVQKELPVKSKAKAPKMVPIVA 242

Query: 243 FIAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWIL------- 295
            +  T D R ++ KR +T LL  M E P +          +         + L       
Sbjct: 243 GVLQTEDGRYVINKRPSTGLLANMWEFPNAELGEGIRNQKEQLIDYMKEKFELAVSIDEY 302

Query: 296 CNTITHTFTHFTLTLFVWKTIVP-QIVIIPDSTWHDAQNLANAALPTVMKKA 346
              + HTFTH T  +FV+   V   IV      +   +           +  
Sbjct: 303 AMNVQHTFTHRTWDIFVFYGKVTGNIVDTDTLKFVSKEAFEQLPFSKSHRTI 354


>gi|67972268|dbj|BAE02476.1| unnamed protein product [Macaca fascicularis]
          Length = 522

 Score =  239 bits (608), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 121/409 (29%), Positives = 176/409 (43%), Gaps = 60/409 (14%)

Query: 7   IIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFMQ 66
             +  +L WYD   R LPWR   + E       Y VW+SE+MLQQT V TV  Y+  +MQ
Sbjct: 67  AFRRSLLSWYDQEKRDLPWRRRAEDEVDPDRRAYAVWVSEVMLQQTQVATVINYYTGWMQ 126

Query: 67  KWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKK-LPG 125
           KWPT+  L+SA  EE+   WAGLGYY+R R L++ A  +V++  G+ P   E L++ LPG
Sbjct: 127 KWPTLQDLASASLEEVNQLWAGLGYYSRGRRLQEGARKVVEELGGHMPRTAETLQQLLPG 186

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDI--IKPAPLYHKTIKNYARKITSTSR 183
           +G YTA AI +IAF     VVD N+ R++ R   I     + L  + +   A+++   +R
Sbjct: 187 VGRYTAGAIASIAFGQATGVVDGNVARVLCRVRAIGADPSSTLVSQRLWGLAQQLVDPAR 246

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSE----------------------- 220
           PGDF QA M+LGA +CT  +PLC  CP+Q  C                            
Sbjct: 247 PGDFNQAAMELGATVCTPQRPLCSQCPVQSLCRARQRVEREQLLASRSLSGNPDVEECAL 306

Query: 221 ----------------------GKSHLLGINTIKKKRPMRTGAVFIAITNDNRILLRKRT 258
                                            +++                +ILL +R 
Sbjct: 307 NTGQCQLCLPASEPWDQTLGVVNFPRKASRKPPREESSATCVLEQPEALGGAQILLVQRP 366

Query: 259 NTRLLEGMDELPGSAWSSTKD-------GNIDTHSAPFTA-NWILCNTITHTFTHFTLTL 310
           N+ LL G+ E P   W  ++          +   + P  A        + HTF+H  LT 
Sbjct: 367 NSGLLAGLWEFPSVTWEPSEQLQRKALLQELQQWAGPLPATRLRHLGEVVHTFSHIKLTY 426

Query: 311 FVW----KTIVPQIVIIPDSTWHDAQNLANAALPTVMKKALSAGGIKVP 355
            V+    +   P   +   + W   +    AA+ T MKK       + P
Sbjct: 427 QVYGLALEGQTPVTTVPAGARWLTQEEFHTAAVSTAMKKVFRVYQGQQP 475


>gi|56963081|ref|YP_174808.1| A/G-specific adenine DNA glycosylase [Bacillus clausii KSM-K16]
 gi|56909320|dbj|BAD63847.1| A/G-specific adenine DNA glycosylase [Bacillus clausii KSM-K16]
          Length = 385

 Score =  239 bits (608), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 110/350 (31%), Positives = 172/350 (49%), Gaps = 14/350 (4%)

Query: 6   HIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
              + ++++WY  + R LPWR S          PY +W+SEIMLQQT V TV PY+++FM
Sbjct: 37  SDFRRQLIEWYQAHKRELPWRES--------NDPYHIWVSEIMLQQTRVDTVIPYYEQFM 88

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKKLPG 125
           +K+P +  L+ A++EEIL  W GLGYY+R RNL+     +V+ Y    P   + +++L G
Sbjct: 89  RKFPEMEDLAYAEEEEILKVWEGLGYYSRVRNLQAAVREVVEHYGSVVPDTRKEIEQLKG 148

Query: 126 IGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDIIKPA--PLYHKTIKNYARKITSTSR 183
           +G YTA AI++IA+      VD N+ R++SR F +      P   K  +    ++   S 
Sbjct: 149 VGPYTAGAILSIAYAKAEPAVDGNVMRVLSRVFCMEDDIGKPQTRKKHEAILYELIDKSD 208

Query: 184 PGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSEGKSHLLGINTIKKKRPMRTGAVF 243
           P  F Q +M+LGAL+CT   P C LCP++  CL +  G+   L I   KKK        F
Sbjct: 209 PSSFNQGLMELGALVCTPTSPGCLLCPVRTQCLAYERGQQERLPIKMKKKKAKSIELESF 268

Query: 244 IAITNDNRILLRKRTNTRLLEGMDELPGSAWSSTKDGNIDTHSAPFTANWILCN---TIT 300
           +  T    +L+ KR +  LL G+ +LP               +  +            + 
Sbjct: 269 LLKTEKGELLIEKRPDKGLLAGLWQLPVLEGRFDPGERQQKLAEKYHIEAEPSAANFQVK 328

Query: 301 HTFTHFTLTLFVWKTIVPQIVIIP-DSTWHDAQNLANAALPTVMKKALSA 349
           H F+H    + ++     +   +P +     A+ L   A P   +K L+ 
Sbjct: 329 HIFSHLIWEIELYVGRANRNGELPANCRIIKAEELEQYAFPVSQQKLLNH 378


>gi|301768148|ref|XP_002919492.1| PREDICTED: A/G-specific adenine DNA glycosylase-like isoform 1
           [Ailuropoda melanoleuca]
          Length = 522

 Score =  238 bits (607), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 117/402 (29%), Positives = 169/402 (42%), Gaps = 60/402 (14%)

Query: 6   HIIQSKILDWYDTNHRVLPWRTSPKTEKSSLPSPYKVWISEIMLQQTTVKTVEPYFKKFM 65
              +  +L WYD   R LPWR   + E       Y VW+SE+MLQQT V TV  Y+ ++M
Sbjct: 66  RAFRENLLRWYDREKRDLPWRRRAEGEVDLDRRAYAVWVSEVMLQQTQVATVIDYYTRWM 125

Query: 66  QKWPTIFCLSSAKDEEILSAWAGLGYYTRARNLKKCADIIVKKYEGNFPHKVEILKK-LP 124
           QKWPT+  L+SA  E +   WAGLGYY+R R L + A  +V++  G+ P   E L++ LP
Sbjct: 126 QKWPTLQDLASASLEGVNQLWAGLGYYSRGRRLHEGARKVVEELGGHVPRTAETLQQLLP 185

Query: 125 GIGDYTASAIVAIAFNHFAVVVDTNIERIISRYFDI--IKPAPLYHKTIKNYARKITSTS 182
           G+G YTA AI +IAF     VVD N+ R++ R   I     + L  + + + A+++   +
Sbjct: 186 GVGRYTAGAIASIAFGQATGVVDGNVVRVLCRVRAIGADSSSALVSQHLWSLAQQLVDPA 245

Query: 183 RPGDFVQAMMDLGALICTSNKPLCPLCPIQKNCLTFSE---------------------- 220
           RPGD  QA M+LGA +CT   P C  CP++  C                           
Sbjct: 246 RPGDLNQAAMELGATVCTPQHPRCSQCPVRSLCRAHQRVEREQLLASRSLPGSPDVEECA 305

Query: 221 -----------------------GKSHLLGINTIKKKRPMRTGAVFIAITNDNRILLRKR 257
                                             +++                RILL +R
Sbjct: 306 PGSGQCRLCAPASEPWDPTLGVTNFPRKASRKPPREECSATCVLEQPRAVGGPRILLVQR 365

Query: 258 TNTRLLEGMDELPGSAWSST-------KDGNIDTHSAPFTA-NWILCNTITHTFTHFTLT 309
            N+ LL G+ E P      +           +   + P  A        + HTF+H  LT
Sbjct: 366 PNSGLLAGLWEFPSVTTEPSGQRQRQALLRELQRWAGPLPATRLRHLGQVVHTFSHIKLT 425

Query: 310 LFVW----KTIVPQIVIIPDSTWHDAQNLANAALPTVMKKAL 347
             V+    +   P     P + W   +    AA+ T MKK  
Sbjct: 426 YEVYGLALEGETPVTTAPPGARWLTREEFHTAAVSTAMKKVF 467


>gi|228937756|ref|ZP_04100389.1| hypothetical protein bthur0008_4340 [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228970635|ref|ZP_04131283.1| hypothetical protein bthur0003_4260 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228977214|ref|ZP_04137613.1| hypothetical protein bthur0002_4310 [Bacillus thuringiensis Bt407]
 gi|228782523|gb|EEM30702.1| hypothet