RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780481|ref|YP_003064894.1| 50S ribosomal protein L34 [Candidatus Liberibacter asiaticus str. psy62] (44 letters) >gnl|CDD|144166 pfam00468, Ribosomal_L34, Ribosomal protein L34. Length = 44 Score = 43.3 bits (103), Expect = 1e-05 Identities = 28/44 (63%), Positives = 35/44 (79%) Query: 1 MKRTYNPSNIVRKRRCGFLARMSTRSGIRILNRRRSKGRKRLSA 44 MKRTY PSN RKR GF ARM+T++G ++L RRR+KGRKRL+ Sbjct: 1 MKRTYQPSNRKRKRTHGFRARMATKNGRKVLKRRRAKGRKRLTV 44 >gnl|CDD|39812 KOG4612, KOG4612, KOG4612, Mitochondrial ribosomal protein L34 [Translation, ribosomal structure and biogenesis]. Length = 105 Score = 37.0 bits (85), Expect = 0.001 Identities = 21/40 (52%), Positives = 28/40 (70%) Query: 4 TYNPSNIVRKRRCGFLARMSTRSGIRILNRRRSKGRKRLS 43 Y PSN+ RKR+ GFLAR ++ G ++L RR+ KGR LS Sbjct: 65 EYQPSNLKRKRKHGFLARAKSKQGSKVLKRRKLKGRWFLS 104 >gnl|CDD|30579 COG0230, RpmH, Ribosomal protein L34 [Translation, ribosomal structure and biogenesis]. Length = 44 Score = 30.2 bits (68), Expect = 0.12 Identities = 28/44 (63%), Positives = 34/44 (77%) Query: 1 MKRTYNPSNIVRKRRCGFLARMSTRSGIRILNRRRSKGRKRLSA 44 MKRTY PS RKR GF ARM+T++G ++L RRR+KGRKRLS Sbjct: 1 MKRTYQPSKRKRKRTHGFRARMATKNGRKVLARRRAKGRKRLSV 44 >gnl|CDD|79363 cd01036, ClC_euk, Chloride channel, ClC. These domains are found in the eukaryotic halogen ion (Cl-, Br- and I-) channel proteins that perform a variety of functions including cell volume regulation, membrane potential stabilization, charge compensation necessary for the acidification of intracellular organelles, signal transduction and transepithelial transport. They are also involved in many pathophysiological processes and are responsible for a number of human diseases. These proteins belong to the ClC superfamily of chloride ion channels, which share the unique double-barreled architecture and voltage-dependent gating mechanism. The gating is conferred by the permeating anion itself, acting as the gating charge. Some proteins possess long C-terminal cytoplasmic regions containing two CBS (cystathionine beta synthase) domains of putative regulatory function.. Length = 416 Score = 24.8 bits (54), Expect = 5.1 Identities = 9/29 (31%), Positives = 13/29 (44%) Query: 16 CGFLARMSTRSGIRILNRRRSKGRKRLSA 44 CG LA + R I L RR ++ + Sbjct: 246 CGLLAALFVRLSIIFLRWRRRLLFRKTAR 274 >gnl|CDD|31163 COG0821, GcpE, Enzyme involved in the deoxyxylulose pathway of isoprenoid biosynthesis [Lipid metabolism]. Length = 361 Score = 24.4 bits (53), Expect = 6.9 Identities = 9/25 (36%), Positives = 11/25 (44%) Query: 6 NPSNIVRKRRCGFLARMSTRSGIRI 30 NP NI K R + + GI I Sbjct: 102 NPGNIGFKDRVREVVEAAKDKGIPI 126 >gnl|CDD|177039 CHL00115, rpl34, ribosomal protein L34; Reviewed. Length = 46 Score = 24.0 bits (52), Expect = 9.3 Identities = 21/41 (51%), Positives = 29/41 (70%) Query: 2 KRTYNPSNIVRKRRCGFLARMSTRSGIRILNRRRSKGRKRL 42 KRT + + + R+ GF ARM+T +G +ILN RR KGRK+L Sbjct: 3 KRTLSGTKRKKVRKSGFRARMATAAGRKILNARRRKGRKKL 43 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.329 0.136 0.388 Gapped Lambda K H 0.267 0.0752 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 516,953 Number of extensions: 16124 Number of successful extensions: 70 Number of sequences better than 10.0: 1 Number of HSP's gapped: 69 Number of HSP's successfully gapped: 11 Length of query: 44 Length of database: 6,263,737 Length adjustment: 17 Effective length of query: 27 Effective length of database: 5,896,384 Effective search space: 159202368 Effective search space used: 159202368 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (23.4 bits)