BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780481|ref|YP_003064894.1| 50S ribosomal protein L34 [Candidatus Liberibacter asiaticus str. psy62] (44 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780481|ref|YP_003064894.1| 50S ribosomal protein L34 [Candidatus Liberibacter asiaticus str. psy62] Length = 44 Score = 84.7 bits (208), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 MKRTYNPSNIVRKRRCGFLARMSTRSGIRILNRRRSKGRKRLSA 44 MKRTYNPSNIVRKRRCGFLARMSTRSGIRILNRRRSKGRKRLSA Sbjct: 1 MKRTYNPSNIVRKRRCGFLARMSTRSGIRILNRRRSKGRKRLSA 44 >gi|254780613|ref|YP_003065026.1| adenylosuccinate synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 432 Score = 22.3 bits (46), Expect = 1.5, Method: Composition-based stats. Identities = 9/19 (47%), Positives = 12/19 (63%) Query: 12 RKRRCGFLARMSTRSGIRI 30 R+RRCG+L S R + I Sbjct: 305 RQRRCGWLDLASVRRSVII 323 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.329 0.136 0.388 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,203 Number of Sequences: 1233 Number of extensions: 470 Number of successful extensions: 2 Number of sequences better than 100.0: 2 Number of HSP's better than 100.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 44 length of database: 328,796 effective HSP length: 17 effective length of query: 27 effective length of database: 307,835 effective search space: 8311545 effective search space used: 8311545 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 31 (16.5 bits)