>TIGR00188 rnpA ribonuclease P protein component; InterPro: IPR000100 Ribonuclease P (3.1.26.5 from EC) (RNase P) , , is a site specific endonuclease that generates mature tRNAs by cleaving-off the leader sequences at their 5'ends. In bacteria RNase P is known to be composed of two components: a large (about 400 base pairs) RNA (gene rnpB) and a small protein (119 to 133 amino acids) (gene rnpA). The RNA moiety of RNase P carries the catalytic activity; the function of the protein component is not yet clear although it may act as an electrostatic screen allowing the highly negatively charged RNA enzyme- substrate complex to fold into the catalytic conformation. The sequence of rnpA is not highly conserved, however there is, in the central part of the protein, a conserved basic region.; GO: 0004526 ribonuclease P activity, 0008033 tRNA processing.

Probab=99.28 E-value=1.4e-11 Score=84.11 Aligned_cols=109 Identities=38% Similarity=0.496 Sum_probs=91.3 Q ss_pred CCEEECCCHH--HHHHHHH-C--CCCCCCCEEEEEEE--C----CCCCCCCEEEEEEECC-CCCHHHHHHHHHHHHHHHH Q ss_conf 8613248989--9999970-9--85136857999996--6----8766773799996078-7751243668999999999 Q gi|254780482|r 2 SNICILKKRR--QFALVKK-G--ELRKGPFFSLEVLN--N----NNSNLLPRVGFTVTKK-QGCAVERNRMRRRLKEAVR 69 (123) Q Consensus 2 ~~~~rLk~~~--dF~~v~k-g--~~~~~~~~~i~~~~--~----~~~~~~~R~G~~vsKK-vg~AV~RNriKR~lRe~~R 69 (123) T Consensus 2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~ 81 (124) T TIGR00188 2 KKPRSLRLKSPIEFDKVFKQGKLLRFSNPFLLLYVLDGCNFCRLKNELDHPRVGLTVSKKKVGNAVERNRIKRLLREVFR 81 (124) T ss_pred CCCCHHHHCCHHHHHHHHHCCCHHCCCCCEEEEEEECCHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 74101221105778887630210000131001321011012102432230123221221233346788899999999999 Q ss_pred HHHHHHCCCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHH Q ss_conf 975421348833999857200379989999999999999864 Q gi|254780482|r 70 LCAEGVLKHGHDYVLIAKRDALFIPFKELCNHFVERVRRNKR 111 (123) Q Consensus 70 ~~~~~~~~~~~d~Viiar~~~~~~~~~~l~~~l~~~l~k~~~ 111 (123) T Consensus 82 ~~~~~~-~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 122 (124) T TIGR00188 82 KRLELL-EPGLDLVVIVRKGFLELTYEALEKLLLKLLLRCKR 122 (124) T ss_pred HHHHHC-CCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHH T ss_conf 877512-64420577731764000078999999998887640

HHsearch alignment for GI: 254780482 and conserved domain: TIGR00188