HHsearch alignment for GI: 254780483 and conserved domain: COG0706

>COG0706 YidC Preprotein translocase subunit YidC [Intracellular trafficking and secretion].
Probab=100.00  E-value=0  Score=568.11  Aligned_cols=291  Identities=40%  Similarity=0.772  Sum_probs=263.4

Q ss_pred             CCCEEEEEECEEEEEEEECCCCCEEEEEEECCCCCCCEEEEEECCCCCCCCC--CEEEEEEEEEEECHHHHHHHHHHCCC
Q ss_conf             4635787311058999607898415899831676641022220244445788--60367899885000278876322014
Q gi|254780483|r  248 SNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPG--KSITTTNFLFAGAKEFPTIHHYEKDL  325 (581)
Q Consensus       248 ~~~Wva~~qkYF~salIP~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~i~pg--~~~~~~~~lY~GPk~~~~L~~~~~~l  325 (581)
T Consensus         4 ~~~~~~~~~~y~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~--   78 (314)
T COG0706           4 LGGWLGILQLYFASLLIPRDFGRLEVPSPG---GTSRYQSGLKSKLRLVPPGMKASASTELLLLAGPKYVDDLSTSDP--   78 (314)
T ss_pred             CCCCHHHEECCCEEEECCCCCCCCCCCCCC---CCHHHHHHCCCCHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCC--
T ss_conf             331010100120354156654442213578---742566640340021044211366520355416765553000351--


Q ss_pred             CCCHHHHHHHHCCHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             631012333201103568999999998876320-1639999999999998889999999999988877888999997314
Q gi|254780483|r  326 AIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVG-NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK  404 (581)
Q Consensus       326 ~~~~l~~~vd~Gwf~~i~kplf~~L~~l~~~i~-NyGiaIIllTilikli~~PLt~ks~~Sm~kM~~lqP~i~~i~ekyk  404 (581)
T Consensus        79 ----~~~~~~~~~f~~~~~~~~~~~~~~~~~~g~n~G~sIi~~ti~vRl~i~Pl~~~~~~s~~km~~lqP~~~~i~~kyk  154 (314)
T COG0706          79 ----LDLTSDYGWFWNILAPLFPLLLFIDSFSGLNWGLSIILLTIIVRLLIFPLSQKSTRSMAKMQELQPKIKEIQEKYK  154 (314)
T ss_pred             ----HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHC
T ss_conf             ----1345567899999999999999888872520889999999999999840778886549999983788999998806


Q ss_pred             -CCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHCCCCC
Q ss_conf             -5115678999999985048786788999999999999999999876986288753410000335725666764102222
Q gi|254780483|r  405 -QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY  483 (581)
Q Consensus       405 -~d~~~~~~~e~m~ly~~~~vnP~~GClP~l~q~p~~~a~~~~~~~~ielr~~~f~~Wi~dls~~d~~~~~~~~~~~p~~  483 (581)
T Consensus       155 ~~~~-~~~q~e~~~Lyk~~~vnPl~gclP~liQ~Pifialy~~l~~~~~l~~~~f~~w~~dl~~~dp~~~~---------  224 (314)
T COG0706         155 GTDK-QKQQQEMMKLYKKHKVNPLAGCLPLLIQMPIFIALYYVLRSTVELRGAPFLGWITDLSLPDPDYIL---------  224 (314)
T ss_pred             CCCH-HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHH---------
T ss_conf             5429-999999999999829992355678999999999999999960110344376665523678973446---------


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCCCC----CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             027899999999999999999752887----7468999999996899999998787999999999999999999999874
Q gi|254780483|r  484 LPGFMHVGIWPIIMSLSMFIQMKMSPP----PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKM  559 (581)
Q Consensus       484 ~~~~~~~~ilp~l~~~~m~~~~k~~p~----~~d~~q~~~~~~mp~~~~~~~~~~~~gl~~y~~~~~~~~~~qq~~i~~~  559 (581)
T Consensus       225 --------~~pii~gv~~f~q~~ls~~~~~~~q~~~~~~~~~impi~f~~~~~~~PaGL~LYW~~~n~fsi~Qq~ii~~~  296 (314)
T COG0706         225 --------LLPILAGVTMFLQQKLSPRNLSTPQDPQQKKMMYIMPIIFTFFFFNFPAGLVLYWIVSNLFSILQQYILNKP  296 (314)
T ss_pred             --------HHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCC
T ss_conf             --------999999999999999635357653579999999999999999998747899999997239999999999042


Q ss_pred             CCCCCC
Q ss_conf             799834
Q gi|254780483|r  560 HGAEIG  565 (581)
Q Consensus       560 ~~~~~~  565 (581)
T Consensus       297 ~~~~~~  302 (314)
T COG0706         297 LEKKRT  302 (314)
T ss_pred             CCHHHH
T s