HHsearch alignment for GI: 254780483 and conserved domain: PRK01001

>PRK01001 putative inner membrane protein translocase component YidC; Provisional.
Probab=100.00  E-value=0  Score=723.59  Aligned_cols=487  Identities=26%  Similarity=0.434  Sum_probs=328.8

Q ss_pred             CEEEEECCEEEEEEECCCCEEEEEEECCCCCCCCCCCCCEEE-ECCC-----CCC--------------------CCCE-
Q ss_conf             728997664999997699559999953571344788772688-5456-----665--------------------5310-
Q gi|254780483|r   69 PRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTL-LSPS-----NTK--------------------NAYF-  121 (581)
Q Consensus        69 ~~I~Iend~l~i~is~~GG~I~~~~LK~Y~~~~~~ds~~v~L-l~~~-----~~~--------------------~~y~-  121 (581)
T Consensus       224 ~~yvL~n~Y~Qiv~S~~~gai~~iNLp~~s~-en~~Siv~ei~fDr~l~~~~p~~a~FP~~~~~~~~~~~~k~~~GGyyP  302 (791)
T PRK01001        224 SYYVLSNEYMQIVVSQESGAIEGINLPFASD-ENNKSIVNEIGFDRDLASESPSEASFPGLSSIDPQRQQIKNSIGGYYP  302 (791)
T ss_pred             CEEEEECCCEEEEEECCCCCHHHCCCCCCCC-CCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
T ss_conf             3799835616899954774110005764466-788760141133644550699635588875436322426534566027


Q ss_pred             -EEEECCCCCCCCCCCCCCCCEECCCCCCCC------------CCCCCEEEEECCCCEEEEEEEEECCC--CEEEEEEEE
Q ss_conf             -000013478775433343210015666566------------66650477415884269999971688--358999863
Q gi|254780483|r  122 -AELDYVSTANNIELPNSNTVWNLISGKILT------------PTTPIKLVFKNANNILFERTISLDEH--YLFKIVDTV  186 (581)
Q Consensus       122 -~~~G~~~~~~~~~~p~~~~~~~~~~~~~l~------------~~~~v~l~~~~~~g~~i~kt~t~~~~--Y~i~i~~~v  186 (581)
T Consensus       303 LLRR~ll~~~-~~~~p~~~~Aln~vS~~e~~~~~~~~y~V~~f~~~~i~~e--~~~-~~i~ktY~~~e~~PY~f~~~i~i  378 (791)
T PRK01001        303 LLRRGLLSDS-KKRVPAQYHALNIVSGRELASPVALGYRVVSFDNKSLQLE--SND-GSIRKTYSLGEEQPYAFELAIQL  378 (791)
T ss_pred             HHHHHHHCCC-CCCCCCHHHHHEECCCCCCCCHHHCEEEEEEECCCEEEEE--CCC-CCEEEEEECCCCCCEEEEEEEEE
T ss_conf             6652123136-5658604442100144446770131479999638548997--289-71788887788887069999753


Q ss_pred             CCCCCCCCCC--CCCEEEECCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECEEEEEEE
Q ss_conf             1576664222--42101202568654442001100000156543210013333333222332346357873110589996
Q gi|254780483|r  187 TNNSIDQIRF--SPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFI  264 (581)
Q Consensus       187 ~N~s~~~i~~--~~~~~i~r~~~~~~~~~~~~~~g~~~~~~d~~~~~~~~~d~~~~~~~~~~~~~~Wva~~qkYF~salI  264 (581)
T Consensus       379 ~~~~~~lwitsGvPEvEi~S~~~~Pa------~ky~~~k~~k~~~~~v~lpk~~~~~~~~~~~~p~wi~nsng~~g~il~  452 (791)
T PRK01001        379 TQGSEDLWITSGVPEVEIMSNAFAPA------IKYRVIKKNKSDLDKVKLPKAKDPLAVRNGVYPQWILNSNGYFGIILT  452 (791)
T ss_pred             CCCCCCEEEECCCCEEEEECCCCCCC------HHHHEECCCCCCEEEECCCCCCCCEEECCCCCCEEEECCCCEEEEECC
T ss_conf             36666515765997279724898610------321000246662024238887664011168874058727964678615


Q ss_pred             ECCCCCEEEEEEE------------CCCCCCCEEEEEECC--CCCCCCCCEEEEEEEEEEECHHHHHHHHHHCCCCCCH-
Q ss_conf             0789841589983------------167664102222024--4445788603678998850002788763220146310-
Q gi|254780483|r  265 PSKETSFHSQFKY------------LSDGHARYQAKFSAN--EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPR-  329 (581)
Q Consensus       265 P~~~~~~~~~~~~------------~~~~~~~y~~~~~~~--~~~i~pg~~~~~~~~lY~GPk~~~~L~~~~~~l~~~~-  329 (581)
T Consensus       453 plt~i~~g~~~~~i~g~~vp~rl~~~~~k~~~~~a~~~pgy~~~lpl~~~~g~~~f~~~agp~~~~~lk~~d~~~~n~~g  532 (791)
T PRK01001        453 PLTEIPAGYASSYISGSTVPTRLSQLSPKNQAYPASKYPGYEALLPLPKEAGTYRFLVYAGPLADPTLKTLDRAYTNSKG  532 (791)
T ss_pred             CCCCCCCCCEECCCCCCCCCCHHHHHCCCCCCCCCCCCCCCEEEECCCCCCCEEEEEEECCCCCCHHHHHHHHHHCCCCC
T ss_conf             57668976211014688666134430842245642248983474015666875899997167675588888776338788


Q ss_pred             ----HHHHHHH-CCHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             ----1233320-110356899----9999998876320163999999999999888999999999998887788899999
Q gi|254780483|r  330 ----FEMLIDW-GWFYFIAKP----MFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR  400 (581)
Q Consensus       330 ----l~~~vd~-Gwf~~i~kp----lf~~L~~l~~~i~NyGiaIIllTilikli~~PLt~ks~~Sm~kM~~lqP~i~~i~  400 (581)
T Consensus       533 ~~p~y~~~~~~~g~f~fit~pfa~~lf~~m~FF~~lTGSwGLAIILLTIiIRLLLfPLt~KQ~KSMkKMQeLQPeMkEIQ  612 (791)
T PRK01001        533 ENPEYLDCITFRGFFAFITEPFAALLFIIMKFFKFLTGSWGISIILLTVFLKLLLYPLNAWSIRSMRRMQKLSPYIQEIQ  612 (791)
T ss_pred             CCCCHHEEEEEEEEEEEECCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHH
T ss_conf             89640012352115446457778999999999975447188999999999999998405899999999988688999999


Q ss_pred             HHCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC-CCCCCCCCCCHHHHHHHHHC
Q ss_conf             73145115678999999985048786788999999999999999999876986288753-41000033572566676410
Q gi|254780483|r  401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFW-GWIKDLAAADPTNIFTLFGI  479 (581)
Q Consensus       401 ekyk~d~~~~~~~e~m~ly~~~~vnP~~GClP~l~q~p~~~a~~~~~~~~ielr~~~f~-~Wi~dls~~d~~~~~~~~~~  479 (581)
T Consensus       613 EKYKdDp-QKlQqEMMKLYKE~GVNPLgGCLPLLIQMPIFIALY~VL~~sieLRgAsFL~gWI~DLSaPD~lF--~~~~P  689 (791)
T PRK01001        613 QKYKKEP-KRAQMEIMALYKTNKVNPITGCLPLLIQLPFLIAMFDLLKSSFLLRGASFIPGWIDNLTAPDVLF--SWETP  689 (791)
T ss_pred             HHCCCCH-HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHCCCCCCCC--CCCCC
T ss_conf             8807999-999999999998709991566789999999999999999988875189305657