HHsearch alignment for GI: 254780483 and conserved domain: TIGR03592

>TIGR03592 yidC_oxa1_cterm membrane protein insertase, YidC/Oxa1 family, C-terminal domain. This model describes full-length from some species, and the C-terminal region only from other species, of the YidC/Oxa1 family of proteins. This domain appears to be univeral among bacteria (although absent from Archaea). The well-characterized YidC protein from Escherichia coli and its close homologs contain a large N-terminal periplasmic domain in addition to the region modeled here.
Probab=100.00  E-value=0  Score=395.73  Aligned_cols=179  Identities=49%  Similarity=0.960  Sum_probs=170.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH
Q ss_conf             16399999999999988899999999999888778889999973145115678999999985048786788999999999
Q gi|254780483|r  359 NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIP  438 (581)
Q Consensus       359 NyGiaIIllTilikli~~PLt~ks~~Sm~kM~~lqP~i~~i~ekyk~d~~~~~~~e~m~ly~~~~vnP~~GClP~l~q~p  438 (581)
T Consensus         1 nW~~sIi~~ti~vR~~~~Pl~i~~~~~~~km~~i~Pe~~~i~~k~~~~~-~~~~~~~~~lykk~~v~p~~~~l~~liQiP   79 (181)
T TIGR03592         1 NWGLAIILLTIIIRLILLPLTLKQYKSMRKMQELQPKLKEIQEKYKDDP-QKLQQEMMKLYKEEGVNPLGGCLPLLIQMP   79 (181)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH-HHHHHHHHHHHHHHCCCHHHHHHHHHHHHH
T ss_conf             9748999999999999999999999999999986888999875464668-999999999999848676788999999999


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCC-CCHHHH
Q ss_conf             9999999998769862887534100003357256667641022220278999999999999999997528877-468999
Q gi|254780483|r  439 VFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQA  517 (581)
Q Consensus       439 ~~~a~~~~~~~~ielr~~~f~~Wi~dls~~d~~~~~~~~~~~p~~~~~~~~~~ilp~l~~~~m~~~~k~~p~~-~d~~q~  517 (581)
T Consensus        80 i~~~l~~~l~~~~~l~~~~f-lw~~dLt~~dp~~-------------------iLP~~~~~~~~~~~~~~~~~~~~~~~~  139 (181)
T TIGR03592        80 IFIALYQVLRRSIELRHAPF-LWIKDLSAPDPYY-------------------ILPILMGVTMFLQQKLSPKGPPDPAQQ  139 (181)
T ss_pred             HHHHHHHHHHHHHHHHHHHH-HHHHHCCCCCHHH-------------------HHHHHHHHHHHHHHHHCCCCCCCHHHH
T ss_conf             99999999998588765123-2045038864799-------------------999999999999999537899998999


Q ss_pred             HHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999-9689999999878799999999999999999999987
Q gi|254780483|r  518 MILN-WMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK  558 (581)
Q Consensus       518 ~~~~-~mp~~~~~~~~~~~~gl~~y~~~~~~~~~~qq~~i~~  558 (581)
T Consensus       140 k~~~~~~p~~~~~~~~~~P~al~lYw~~s~~~~i~Q~~il~r  181 (181)
T TIGR03592       140 KIMMYIMPLMFLFFFLSFPAGLVLYWVVSNLFTIIQQLIINR  181 (181)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             999999999999999979999999999989999999999739