Query         gi|254780483|ref|YP_003064896.1| putative inner membrane protein translocase component YidC [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 581
No_of_seqs    197 out of 1773
Neff          8.0 
Searched_HMMs 39220
Date          Sun May 29 17:33:27 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780483.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK01318 putative inner membra 100.0       0       0 1153.1  58.0  546    1-563     1-563 (565)
  2 PRK01001 putative inner membra 100.0       0       0  723.6  38.2  487   69-573   224-786 (791)
  3 COG0706 YidC Preprotein transl 100.0       0       0  568.1  24.0  291  248-565     4-302 (314)
  4 PRK00145 putative inner membra 100.0       0       0  483.3  26.0  204  338-562     1-217 (225)
  5 PRK01622 OxaA-like protein pre 100.0       0       0  482.9  25.0  212  335-569    33-260 (266)
  6 PRK02944 OxaA-like protein pre 100.0       0       0  479.3  25.9  202  336-558    33-242 (255)
  7 PRK02463 OxaA-like protein pre 100.0       0       0  479.9  25.0  218  336-578    34-267 (307)
  8 PRK02654 putative inner membra 100.0       0       0  480.2  23.1  241  334-577     1-358 (376)
  9 PRK01315 putative inner membra 100.0       0       0  468.4  27.5  238  337-576     6-278 (325)
 10 PRK03449 putative inner membra 100.0       0       0  467.0  26.0  230  339-569     2-279 (304)
 11 TIGR03593 yidC_nterm membrane  100.0       0       0  450.0  32.5  349    4-358     1-366 (366)
 12 PRK02201 putative inner membra 100.0       0       0  421.2  23.3  213  339-559   132-368 (392)
 13 TIGR03592 yidC_oxa1_cterm memb 100.0       0       0  395.7  23.0  179  359-558     1-181 (181)
 14 pfam02096 60KD_IMP 60Kd inner  100.0       0       0  367.3  23.3  182  358-560     1-193 (194)
 15 PRK00247 putative inner membra 100.0       0       0  357.6  18.1  197  359-560    31-273 (422)
 16 KOG1239 consensus               99.8 1.6E-18   4E-23  153.7  16.5  196  335-556    77-288 (372)
 17 KOG1239 consensus               96.9  0.0018 4.6E-08   43.8   5.2  200  355-556    30-244 (372)
 18 COG1422 Predicted membrane pro  96.8   0.017 4.2E-07   36.7   9.2   86  359-445    45-137 (201)
 19 pfam01956 DUF106 Integral memb  95.5    0.21 5.3E-06   28.7  11.8   63  383-448    43-112 (168)
 20 PRK11055 galM aldose 1-epimera  93.8    0.53 1.3E-05   25.8  14.0  122   67-198    14-174 (348)
 21 pfam01263 Aldose_epim Aldose 1  92.4     0.8 2.1E-05   24.4  16.9  124   69-202     1-163 (301)
 22 pfam00558 Vpu Vpu protein. The  92.3    0.83 2.1E-05   24.3   8.1   68  360-427     7-78  (81)
 23 pfam07423 DUF1510 Protein of u  91.3    0.28 7.2E-06   27.7   3.9   29    6-34     17-45  (214)
 24 pfam09973 DUF2208 Predicted me  89.1     1.6   4E-05   22.3   8.2   97  342-451     6-112 (232)
 25 pfam06936 Selenoprotein_S Sele  84.9     2.6 6.7E-05   20.7   8.0   51  355-406    31-106 (190)
 26 PRK09108 type III secretion sy  81.6     3.5 8.9E-05   19.8   6.9   39  362-405   190-228 (354)
 27 TIGR01185 devC DevC protein; I  81.2     2.5 6.3E-05   20.8   4.0   48  332-381   296-346 (381)
 28 cd02433 Nodulin-21_like_2 Nodu  80.0     3.9  0.0001   19.4   7.1   33  393-426    82-114 (234)
 29 PRK01001 putative inner membra  79.1    0.48 1.2E-05   26.0  -0.2  140  368-535   575-745 (791)
 30 pfam01988 VIT1 VIT family. Thi  76.9     4.8 0.00012   18.8   8.8   47  379-426    49-96  (210)
 31 KOG1594 consensus               74.2     5.6 0.00014   18.3   9.3  123   69-198    24-165 (305)
 32 PRK12721 secretion system appa  72.6     6.1 0.00015   18.0   6.3   16  374-389   200-215 (349)
 33 COG1377 FlhB Flagellar biosynt  72.2     6.2 0.00016   18.0   6.9   50  351-405   184-233 (363)
 34 PRK01294 lipase chaperone; Pro  71.6     5.9 0.00015   18.1   3.8   18   81-98     77-94  (339)
 35 PRK13109 flhB flagellar biosyn  71.5     6.4 0.00016   17.8   6.5   31  369-404   204-234 (358)
 36 PRK08156 surface presentation   71.3     6.4 0.00016   17.8   7.3   39  362-405   183-221 (367)
 37 PRK12468 flhB flagellar biosyn  70.4     6.7 0.00017   17.7   6.4   30  371-405   204-233 (383)
 38 PRK00191 tatA twin arginine tr  69.1     7.2 0.00018   17.5   6.0   65  357-427     3-72  (107)
 39 pfam02936 COX4 Cytochrome c ox  66.3     5.4 0.00014   18.4   2.6   32  389-420    26-57  (143)
 40 TIGR03513 GldL_gliding gliding  66.2     4.3 0.00011   19.1   2.2   26  349-378     3-28  (202)
 41 pfam00606 Glycoprotein_B Herpe  63.9     8.9 0.00023   16.8   3.9   34  425-458   663-696 (711)
 42 COG0676 Uncharacterized enzyme  63.8     8.9 0.00023   16.8   9.7  126   67-202    23-162 (287)
 43 COG2976 Uncharacterized protei  62.0     7.5 0.00019   17.4   2.7   30  361-390    22-51  (207)
 44 TIGR00380 cobD cobalamin biosy  60.4     9.7 0.00025   16.5   3.1   48  412-468   143-209 (322)
 45 PTZ00243 ABC transporter; Prov  59.5      11 0.00027   16.3  13.7   10  397-406  1055-1064(1560)
 46 KOG0209 consensus               58.3     9.1 0.00023   16.7   2.6   29    3-31    392-422 (1160)
 47 pfam09095 DUF1926 Domain of un  58.2      11 0.00028   16.1   9.6   28   69-96      8-36  (275)
 48 pfam05600 DUF773 Protein of un  57.6      11 0.00029   16.0   4.4   40  388-428   467-506 (506)
 49 TIGR02120 GspF general secreti  55.9      12 0.00031   15.9   3.4   49  309-376   201-250 (414)
 50 KOG2295 consensus               55.7      11 0.00027   16.2   2.6   59  392-457   475-537 (648)
 51 cd00922 Cyt_c_Oxidase_IV Cytoc  55.3       9 0.00023   16.7   2.2   31  390-420    27-57  (136)
 52 TIGR00328 flhB flagellar biosy  54.9      12 0.00032   15.7   7.3   13  462-474   169-181 (352)
 53 PRK00575 tatA twin arginine tr  54.6      13 0.00032   15.7   5.0   47  358-406     5-53  (88)
 54 PRK05702 flhB flagellar biosyn  53.8      13 0.00033   15.6   7.5   50  351-405   184-233 (352)
 55 pfam07014 Hs1pro-1_C Hs1pro-1   53.5     7.5 0.00019   17.3   1.6   14  410-423   168-181 (261)
 56 COG0646 MetH Methionine syntha  52.5     3.6 9.2E-05   19.7  -0.2   37  394-431   259-295 (311)
 57 PRK13665 hypothetical protein;  52.2      12 0.00031   15.8   2.4   16  389-404   261-276 (327)
 58 pfam11694 DUF3290 Protein of u  51.6      11 0.00027   16.3   2.1   22   66-87    107-128 (149)
 59 PRK06298 type III secretion sy  51.3      14 0.00036   15.3   7.7   16  374-389   201-216 (360)
 60 KOG4075 consensus               49.6      13 0.00033   15.6   2.3   34  387-420    49-82  (167)
 61 TIGR00699 GABAtrns_euk 4-amino  47.7      12 0.00031   15.8   1.9   41  390-431   384-441 (469)
 62 KOG3021 consensus               46.6      17 0.00042   14.8   3.2   37  390-426   170-210 (313)
 63 KOG3958 consensus               45.9      17 0.00043   14.8   5.0   53  387-439   250-304 (371)
 64 PTZ00234 variable surface prot  44.1      18 0.00046   14.6   3.1   13  526-538   377-389 (433)
 65 pfam07748 Glyco_hydro_38C Glyc  42.9      19 0.00048   14.4  19.3   30   69-99     31-60  (379)
 66 PRK10893 hypothetical protein;  42.7      19 0.00048   14.4   6.4   23    1-23      1-24  (190)
 67 KOG4847 consensus               42.6      19 0.00048   14.4   3.5   39  390-434   360-398 (483)
 68 PRK11462 putative transporter;  42.5      19 0.00048   14.4   4.8   30  547-576   415-444 (460)
 69 pfam06045 Rhamnogal_lyase Rham  41.1      20  0.0005   14.3   8.4   30   67-96      6-35  (194)
 70 PRK02919 oxaloacetate decarbox  41.0      20 0.00051   14.3   3.4   12   10-21     19-30  (82)
 71 TIGR02830 spore_III_AG stage I  39.5      21 0.00053   14.1   3.5   26    7-32      5-30  (193)
 72 KOG1604 consensus               37.7      22 0.00057   13.9  12.2   33   65-97     17-50  (353)
 73 PRK06531 yajC preprotein trans  36.9      23 0.00058   13.8   2.1   14   70-83     62-75  (120)
 74 PRK03411 consensus              34.9      17 0.00042   14.8   0.9   13  309-321   126-138 (194)
 75 COG2017 GalM Galactose mutarot  34.9      24 0.00062   13.6  18.1  122   67-198    11-165 (308)
 76 pfam09451 ATG27 Autophagy-rela  34.8      24 0.00061   13.7   1.7   13  333-345   194-206 (265)
 77 TIGR00263 trpB tryptophan synt  32.6      26 0.00068   13.3   3.4   10  106-115   263-272 (412)
 78 PRK03598 hypothetical protein;  32.6      27 0.00068   13.3   7.9   31   79-110    43-74  (331)
 79 KOG2639 consensus               31.7      27  0.0007   13.2   6.9   79  385-468   423-506 (685)
 80 KOG0904 consensus               30.9      27 0.00069   13.3   1.5   19  236-254   433-451 (1076)
 81 pfam12127 YdfA_immunity SigmaW  30.5      28 0.00072   13.1   1.5   18  388-405   259-276 (321)
 82 pfam05029 TIMELESS_C Timeless   30.4      29 0.00073   13.1   2.6   11  345-355   298-308 (507)
 83 pfam11120 DUF2636 Protein of u  29.6      30 0.00075   13.0   4.1   28  364-391     6-33  (62)
 84 TIGR03372 putres_am_tran putre  29.3      30 0.00076   13.0   1.8   19  387-405   354-372 (442)
 85 PRK10340 ebgA cryptic beta-D-g  29.1      30 0.00077   12.9  15.7   31   66-96    721-751 (1030)
 86 KOG3543 consensus               28.9      26 0.00067   13.4   1.1   22  446-468   816-837 (1218)
 87 TIGR02026 BchE magnesium-proto  28.8      30 0.00078   12.9   1.8   27  395-425   317-343 (506)
 88 pfam04912 Dynamitin Dynamitin.  28.7      31 0.00078   12.9   4.5   49  386-436   266-318 (387)
 89 TIGR00934 2a38euk potassium up  28.4      31 0.00079   12.8   7.2  107  419-551   815-926 (1197)
 90 pfam08216 DUF1716 Eukaryotic d  28.3      31 0.00079   12.8   3.7   15  396-411    42-56  (108)
 91 COG4449 Predicted protease of   28.3      31 0.00079   12.8   2.3   23  244-266   275-302 (827)
 92 PRK09738 small toxic polypepti  28.0      31  0.0008   12.8   2.7   20  360-382    10-29  (52)
 93 pfam02411 MerT MerT mercuric t  27.7      32 0.00081   12.8   5.5   69  453-538    33-112 (116)
 94 pfam03056 consensus             27.0      33 0.00083   12.7   8.3   56  356-421   151-207 (213)
 95 PRK10476 multidrug resistance   26.5      33 0.00085   12.6   7.0   35   73-110    46-81  (348)
 96 PRK12860 transcriptional activ  26.3      34 0.00085   12.6   2.9   18  415-432    40-58  (189)
 97 PRK09953 wcaD putative colanic  25.8      34 0.00087   12.5   1.4   51  305-362   311-364 (405)
 98 TIGR01726 HEQRo_perm_3TM amino  25.3      35 0.00089   12.5   1.9   12  523-534    55-66  (99)
 99 COG3901 NosR Regulator of nitr  25.2      27 0.00069   13.3   0.7   18   80-98     98-115 (482)
100 cd00927 Cyt_c_Oxidase_VIc Cyto  25.1      35  0.0009   12.4   2.8   29  388-417    34-63  (70)
101 pfam10095 DUF2333 Uncharacteri  24.9      30 0.00076   12.9   0.8   22   13-35     25-46  (337)
102 PRK10189 hypothetical protein;  24.9      35  0.0009   12.4   2.5   29  537-565   446-477 (481)
103 pfam04284 DUF441 Protein of un  24.8      36 0.00091   12.4   3.0   34  350-383    38-71  (140)
104 pfam07745 Glyco_hydro_53 Glyco  24.8      20 0.00051   14.3  -0.1   66  388-464   213-297 (332)
105 TIGR01523 ATPase-IID_K-Na pota  24.7      31 0.00078   12.9   0.9   51  354-407   762-828 (1001)
106 pfam05280 FlhC Flagellar trans  24.5      36 0.00092   12.4   2.6   18  415-432    40-58  (176)
107 pfam07358 DUF1482 Protein of u  24.4      28 0.00072   13.2   0.6   12  420-433    34-45  (57)
108 pfam05462 Dicty_CAR Slime mold  23.9      37 0.00094   12.3   3.0   99  437-548   126-238 (305)
109 TIGR02951 DMSO_dmsB dimethylsu  23.7      29 0.00075   13.0   0.6   16  164-179    29-45  (162)
110 pfam10319 7TM_GPCR_Srj Serpent  23.6      37 0.00096   12.2   8.8   17  430-446   253-270 (310)
111 cd02985 TRX_CDSP32 TRX family,  23.5      38 0.00096   12.2   1.7   14  391-404    32-45  (103)
112 TIGR02794 tolA_full protein To  23.4      38 0.00096   12.2   4.1   21    7-27      4-27  (452)
113 pfam11037 Musclin Insulin-resi  22.8      21 0.00054   14.0  -0.3   22   68-89     65-90  (132)
114 pfam03273 Baculo_gp64 Baculovi  22.8      39 0.00099   12.1   2.0   41  330-374   462-502 (508)
115 KOG0190 consensus               22.3      40   0.001   12.1   1.8   19  389-407   399-417 (493)
116 COG1883 OadB Na+-transporting   22.2      40   0.001   12.1   1.3   37  363-399   151-187 (375)
117 PRK11103 mannose-specific PTS   22.2      40   0.001   12.0  15.0   13  491-503   236-248 (277)
118 KOG1517 consensus               22.1      40   0.001   12.0   2.6  154  412-574   453-651 (1387)
119 PRK12417 secY preprotein trans  22.0      40   0.001   12.0   6.3   14  419-433   227-240 (399)
120 PRK13703 conjugal pilus assemb  21.9      40   0.001   12.0   1.9   26    5-31      2-33  (247)
121 COG3976 Uncharacterized protei  21.9      40   0.001   12.0   3.3   26   75-100    61-86  (135)
122 COG3031 PulC Type II secretory  21.7      41   0.001   12.0   1.0   16    9-24     21-36  (275)
123 pfam05934 MCLC Mid-1-related c  21.5      35  0.0009   12.4   0.6   13  430-442   349-361 (577)
124 COG4814 Uncharacterized protei  21.0      42  0.0011   11.9   5.6   50   71-127    72-122 (288)
125 KOG0637 consensus               20.8      42  0.0011   11.9   6.1   69  365-449   285-353 (498)
126 COG0499 SAM1 S-adenosylhomocys  20.6      30 0.00077   12.9   0.2   14   85-98    127-140 (420)
127 pfam04744 Monooxygenase_B Mono  20.5      43  0.0011   11.8   6.8   26  295-320   320-345 (381)
128 pfam05829 Adeno_PX Adenovirus   20.4      36 0.00091   12.4   0.5   14  428-443    14-27  (44)
129 PRK12722 transcriptional activ  20.4      43  0.0011   11.8   5.2   36  413-448    38-84  (185)

No 1  
>PRK01318 putative inner membrane protein translocase component YidC; Provisional
Probab=100.00  E-value=0  Score=1153.11  Aligned_cols=546  Identities=38%  Similarity=0.712  Sum_probs=474.1

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCC------------CCCCCCCCCCCHHCCCCC
Q ss_conf             97327899999999999999975137898876544333334456776677------------555666667610001458
Q gi|254780483|r    1 MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVD------------NSYAAVLIDDRAQALSMS   68 (581)
Q Consensus         1 Md~nKn~iIai~Ls~~ill~w~~~~~~p~~e~~~~~~~~~~s~~~~~~~~------------~~~~~~~~~~~~~~~~~~   68 (581)
                      || +||++||++||++++++|++|+.+|++++..++++.++........+            .+...............+
T Consensus         1 Md-~Kn~lLaivLs~~vL~gw~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   79 (565)
T PRK01318          1 MD-NKRLILAIALSFVVLLGWQYFFPDPNPQKQEQAAAAQAAQQQAAQAAAPAAQQATQTTTAAAAAAAAAAVPAAAAAS   79 (565)
T ss_pred             CC-HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             94-68899999999999999999738988985300112210245567776666777776665555555554432224677


Q ss_pred             CEEEEECCEEEEEEECCCCEEEEEEECCCCCCCCCCCCCEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCCEECCCCC
Q ss_conf             72899766499999769955999995357134478877268854566655310000013478775433343210015666
Q gi|254780483|r   69 PRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGK  148 (581)
Q Consensus        69 ~~I~Iend~l~i~is~~GG~I~~~~LK~Y~~~~~~ds~~v~Ll~~~~~~~~y~~~~G~~~~~~~~~~p~~~~~~~~~~~~  148 (581)
                      ++|+||||+++++||++||+|+++.||+|+++.+++++ +.|++++++.+.|++++||+..+ +...|++++.|+.....
T Consensus        80 ~~I~Ietd~l~~sIs~~GG~I~~~~LK~Yk~~~~~~~p-v~Ll~~~~~~~~y~a~~G~~~~~-~~~~~~~~~~~~~~~~~  157 (565)
T PRK01318         80 QRITVETDVLELSIDTKGGRIDDLLLKKYKETLDSDSP-VVLLSPSGSPFVYFAESGLVGAD-GPDVPGGRTLWTADKSS  157 (565)
T ss_pred             CEEEEECCCEEEEEECCCCEEEEEECCCCCCCCCCCCC-EEEECCCCCCCCEEEEEECCCCC-CCCCCCCCCCEEECCCC
T ss_conf             55999868499999889975737752678564379997-39948888876027763023688-87778888516845870


Q ss_pred             CC---CCCCCCEEEEECCCCEEEEEEEEECC-CCEEEEEEEECCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCEEECC
Q ss_conf             56---66665047741588426999997168-835899986315766642224210120256865444200110000015
Q gi|254780483|r  149 IL---TPTTPIKLVFKNANNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVL  224 (581)
Q Consensus       149 ~l---~~~~~v~l~~~~~~g~~i~kt~t~~~-~Y~i~i~~~v~N~s~~~i~~~~~~~i~r~~~~~~~~~~~~~~g~~~~~  224 (581)
                      ..   .++.+++|+|++++|++++|+|+|++ +|+++++++|+|.|+.++.+.+|+++.|+..+........|+|+++++
T Consensus       158 ~~~~~~~~~~vtl~~~~~~G~~v~K~ytf~~d~Y~i~v~~~v~N~s~~~~~l~~y~~i~r~~~~~~~~~~~~~~G~~~~~  237 (565)
T PRK01318        158 LLLAEQNELPVTLTWTNDNGVTFTKTYTLDRGDYMFTVEQSVNNNGGAPVNLSPYGQLKRRPSTDTGSSNFTFLGAAGYT  237 (565)
T ss_pred             EECCCCCCEEEEEEEECCCCEEEEEEEEECCCCEEEEEEEEEECCCCCCCEEEEEEEEECCCCCCCCCCCEEEEEEEEEE
T ss_conf             23268885279999987998799999998589558999999964788752021015764178887556643543347994


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECEEEEEEEECCCCCEEEEEEECCCCCCCEEEEEECCCCCCCCCCEEEE
Q ss_conf             65432100133333332223323463578731105899960789841589983167664102222024444578860367
Q gi|254780483|r  225 GDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITT  304 (581)
Q Consensus       225 ~d~~~~~~~~~d~~~~~~~~~~~~~~Wva~~qkYF~salIP~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~i~pg~~~~~  304 (581)
                      +|+++++++++|+++++..+.+++.||+|++||||++||||+++.......... +..+.|.+++..+...++||++.+.
T Consensus       238 ~~~~~~k~~~~d~~~~~~~~~~~~~gWvg~~qkYF~salIP~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~v~pg~~~~~  316 (565)
T PRK01318        238 DDEKYKKYSYKDIDDKENLNIKSKGGWVAILDKYFATALIPDNQGTNNFYSANL-GNAGLYQVGFKSPPVTVAPGQTAST  316 (565)
T ss_pred             CCCCEEEECCCCCCCCCCCCCCCCCCEEEEECCEEEEEEECCCCCCCEEEEEEC-CCCCCEEEEEECCCEEECCCCCEEE
T ss_conf             687437842343221466554577658998131489999658987504897422-8887158987446323279971468


Q ss_pred             EEEEEEECHHHHHHHHHHCCCCCCHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89988500027887632201463101233320110356899999999887632016399999999999988899999999
Q gi|254780483|r  305 TNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYV  384 (581)
Q Consensus       305 ~~~lY~GPk~~~~L~~~~~~l~~~~l~~~vd~Gwf~~i~kplf~~L~~l~~~i~NyGiaIIllTilikli~~PLt~ks~~  384 (581)
                      ++++|+|||+|++|+++..    ++||++||||||+|++|||||+|+|+|+++||||||||||||+||+++||||+|||+
T Consensus       317 ~~~ly~GPK~~~~L~~~~~----~~Le~~Vd~Gw~~~i~kplf~lL~~l~~~igN~G~aIIllTilIKl~~~PLt~ksy~  392 (565)
T PRK01318        317 TARLYAGPKEVKLLDKYIA----PGLDLAVDYGWFWFITKPLFWLLDFLHSFIGNWGWAIILLTIIVKLLLFPLTYKSYR  392 (565)
T ss_pred             EEEEEECHHHHHHHHHHCC----CCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             8899975078999875152----036672004179999999999999987761747699999999999999988999999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             99988877888999997314511567899999998504878678899999999999999999987698628875341000
Q gi|254780483|r  385 STANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKD  464 (581)
Q Consensus       385 Sm~kM~~lqP~i~~i~ekyk~d~~~~~~~e~m~ly~~~~vnP~~GClP~l~q~p~~~a~~~~~~~~ielr~~~f~~Wi~d  464 (581)
                      ||||||+|||||+|||||||||+ ||+|||||+|||||||||||||||||+|||||||||+||+++|||||+||+|||+|
T Consensus       393 Sm~kM~~lqP~~~~~~~~~~~d~-~~~~~~~m~ly~~~~~np~~gclp~l~q~p~~~~~~~~~~~~~~~r~~~f~~Wi~d  471 (565)
T PRK01318        393 SMAKMKELQPKMQELKEKYKDDP-QKMQQEMMELYKKEKVNPLGGCLPILIQIPIFFALYKVLLVSIELRHAPFIGWIHD  471 (565)
T ss_pred             HHHHHHHHCHHHHHHHHHHCCCH-HHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEECC
T ss_conf             99998754567999998715886-79999999999981998224568999999999999999998898637962010132


Q ss_pred             CCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCC-CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             03357256667641022220278999999999999999997528877-46899999999689999999878799999999
Q gi|254780483|r  465 LAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPAGLIIYWS  543 (581)
Q Consensus       465 ls~~d~~~~~~~~~~~p~~~~~~~~~~ilp~l~~~~m~~~~k~~p~~-~d~~q~~~~~~mp~~~~~~~~~~~~gl~~y~~  543 (581)
                      ||+|||+++++++      ++  .|++|||||||+|||+||||||++ +||+|++||++||+||+|||++|||||+|||+
T Consensus       472 ls~~d~~~~~~~~------~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~gl~~y~~  543 (565)
T PRK01318        472 LSAPDPTNIFNLF------GY--FHIGILPILMGITMFLQQKLNPTPVTDPMQAKIMKFMPLIFTFFFLSFPAGLVLYWI  543 (565)
T ss_pred             CCCCCCCHHCCCH------HH--HHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             5776830220321------57--789999999999999998448999999999999999999999999869999999999


Q ss_pred             HHHHHHHHHHHHHHHHCCCC
Q ss_conf             99999999999998747998
Q gi|254780483|r  544 WSNVISIVQQAVIMKMHGAE  563 (581)
Q Consensus       544 ~~~~~~~~qq~~i~~~~~~~  563 (581)
                      +||++||+|||+|||++..|
T Consensus       544 ~~~~~~~~qq~~~~~~~~~~  563 (565)
T PRK01318        544 VNNLLTIIQQYIINRRLEKK  563 (565)
T ss_pred             HHHHHHHHHHHHHHHHHHHC
T ss_conf             99999999999998863432


No 2  
>PRK01001 putative inner membrane protein translocase component YidC; Provisional
Probab=100.00  E-value=0  Score=723.59  Aligned_cols=487  Identities=26%  Similarity=0.434  Sum_probs=328.8

Q ss_pred             CEEEEECCEEEEEEECCCCEEEEEEECCCCCCCCCCCCCEEE-ECCC-----CCC--------------------CCCE-
Q ss_conf             728997664999997699559999953571344788772688-5456-----665--------------------5310-
Q gi|254780483|r   69 PRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTL-LSPS-----NTK--------------------NAYF-  121 (581)
Q Consensus        69 ~~I~Iend~l~i~is~~GG~I~~~~LK~Y~~~~~~ds~~v~L-l~~~-----~~~--------------------~~y~-  121 (581)
                      +...+||+...+.||+.||.|.++.|+=.-+ .+..|....+ ++.+     .++                    .+|+ 
T Consensus       224 ~~yvL~n~Y~Qiv~S~~~gai~~iNLp~~s~-en~~Siv~ei~fDr~l~~~~p~~a~FP~~~~~~~~~~~~k~~~GGyyP  302 (791)
T PRK01001        224 SYYVLSNEYMQIVVSQESGAIEGINLPFASD-ENNKSIVNEIGFDRDLASESPSEASFPGLSSIDPQRQQIKNSIGGYYP  302 (791)
T ss_pred             CEEEEECCCEEEEEECCCCCHHHCCCCCCCC-CCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
T ss_conf             3799835616899954774110005764466-788760141133644550699635588875436322426534566027


Q ss_pred             -EEEECCCCCCCCCCCCCCCCEECCCCCCCC------------CCCCCEEEEECCCCEEEEEEEEECCC--CEEEEEEEE
Q ss_conf             -000013478775433343210015666566------------66650477415884269999971688--358999863
Q gi|254780483|r  122 -AELDYVSTANNIELPNSNTVWNLISGKILT------------PTTPIKLVFKNANNILFERTISLDEH--YLFKIVDTV  186 (581)
Q Consensus       122 -~~~G~~~~~~~~~~p~~~~~~~~~~~~~l~------------~~~~v~l~~~~~~g~~i~kt~t~~~~--Y~i~i~~~v  186 (581)
                       ...|+++.+ ...+|.......+.+++.+.            ++..+.|+  .++ ..++|||++.++  |.++++..+
T Consensus       303 LLRR~ll~~~-~~~~p~~~~Aln~vS~~e~~~~~~~~y~V~~f~~~~i~~e--~~~-~~i~ktY~~~e~~PY~f~~~i~i  378 (791)
T PRK01001        303 LLRRGLLSDS-KKRVPAQYHALNIVSGRELASPVALGYRVVSFDNKSLQLE--SND-GSIRKTYSLGEEQPYAFELAIQL  378 (791)
T ss_pred             HHHHHHHCCC-CCCCCCHHHHHEECCCCCCCCHHHCEEEEEEECCCEEEEE--CCC-CCEEEEEECCCCCCEEEEEEEEE
T ss_conf             6652123136-5658604442100144446770131479999638548997--289-71788887788887069999753


Q ss_pred             CCCCCCCCCC--CCCEEEECCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECEEEEEEE
Q ss_conf             1576664222--42101202568654442001100000156543210013333333222332346357873110589996
Q gi|254780483|r  187 TNNSIDQIRF--SPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFI  264 (581)
Q Consensus       187 ~N~s~~~i~~--~~~~~i~r~~~~~~~~~~~~~~g~~~~~~d~~~~~~~~~d~~~~~~~~~~~~~~Wva~~qkYF~salI  264 (581)
                      ...+++-|--  .|...+..+.....      -.+.+..-+.++..+++.-+..+.-.......-+|+.-.+-||-.++-
T Consensus       379 ~~~~~~lwitsGvPEvEi~S~~~~Pa------~ky~~~k~~k~~~~~v~lpk~~~~~~~~~~~~p~wi~nsng~~g~il~  452 (791)
T PRK01001        379 TQGSEDLWITSGVPEVEIMSNAFAPA------IKYRVIKKNKSDLDKVKLPKAKDPLAVRNGVYPQWILNSNGYFGIILT  452 (791)
T ss_pred             CCCCCCEEEECCCCEEEEECCCCCCC------HHHHEECCCCCCEEEECCCCCCCCEEECCCCCCEEEECCCCEEEEECC
T ss_conf             36666515765997279724898610------321000246662024238887664011168874058727964678615


Q ss_pred             ECCCCCEEEEEEE------------CCCCCCCEEEEEECC--CCCCCCCCEEEEEEEEEEECHHHHHHHHHHCCCCCCH-
Q ss_conf             0789841589983------------167664102222024--4445788603678998850002788763220146310-
Q gi|254780483|r  265 PSKETSFHSQFKY------------LSDGHARYQAKFSAN--EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPR-  329 (581)
Q Consensus       265 P~~~~~~~~~~~~------------~~~~~~~y~~~~~~~--~~~i~pg~~~~~~~~lY~GPk~~~~L~~~~~~l~~~~-  329 (581)
                      |-++...-....+            ...++..|.+.-.-.  ...-.|.+..+.+|.+|+||..-.+|+..|+....+. 
T Consensus       453 plt~i~~g~~~~~i~g~~vp~rl~~~~~k~~~~~a~~~pgy~~~lpl~~~~g~~~f~~~agp~~~~~lk~~d~~~~n~~g  532 (791)
T PRK01001        453 PLTEIPAGYASSYISGSTVPTRLSQLSPKNQAYPASKYPGYEALLPLPKEAGTYRFLVYAGPLADPTLKTLDRAYTNSKG  532 (791)
T ss_pred             CCCCCCCCCEECCCCCCCCCCHHHHHCCCCCCCCCCCCCCCEEEECCCCCCCEEEEEEECCCCCCHHHHHHHHHHCCCCC
T ss_conf             57668976211014688666134430842245642248983474015666875899997167675588888776338788


Q ss_pred             ----HHHHHHH-CCHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             ----1233320-110356899----9999998876320163999999999999888999999999998887788899999
Q gi|254780483|r  330 ----FEMLIDW-GWFYFIAKP----MFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR  400 (581)
Q Consensus       330 ----l~~~vd~-Gwf~~i~kp----lf~~L~~l~~~i~NyGiaIIllTilikli~~PLt~ks~~Sm~kM~~lqP~i~~i~  400 (581)
                          .-..+-| |||.||++|    ||.+|+|||.++||||||||+|||+||+++||||+||++||+|||+|||+|+|||
T Consensus       533 ~~p~y~~~~~~~g~f~fit~pfa~~lf~~m~FF~~lTGSwGLAIILLTIiIRLLLfPLt~KQ~KSMkKMQeLQPeMkEIQ  612 (791)
T PRK01001        533 ENPEYLDCITFRGFFAFITEPFAALLFIIMKFFKFLTGSWGISIILLTVFLKLLLYPLNAWSIRSMRRMQKLSPYIQEIQ  612 (791)
T ss_pred             CCCCHHEEEEEEEEEEEECCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHH
T ss_conf             89640012352115446457778999999999975447188999999999999998405899999999988688999999


Q ss_pred             HHCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC-CCCCCCCCCCHHHHHHHHHC
Q ss_conf             73145115678999999985048786788999999999999999999876986288753-41000033572566676410
Q gi|254780483|r  401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFW-GWIKDLAAADPTNIFTLFGI  479 (581)
Q Consensus       401 ekyk~d~~~~~~~e~m~ly~~~~vnP~~GClP~l~q~p~~~a~~~~~~~~ielr~~~f~-~Wi~dls~~d~~~~~~~~~~  479 (581)
                      ||||||+ ||+|||||+|||||||||||||||||||||||||||++|++++||||++|+ .||+|||+||+++  ++...
T Consensus       613 EKYKdDp-QKlQqEMMKLYKE~GVNPLgGCLPLLIQMPIFIALY~VL~~sieLRgAsFL~gWI~DLSaPD~lF--~~~~P  689 (791)
T PRK01001        613 QKYKKEP-KRAQMEIMALYKTNKVNPITGCLPLLIQLPFLIAMFDLLKSSFLLRGASFIPGWIDNLTAPDVLF--SWETP  689 (791)
T ss_pred             HHCCCCH-HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHCCCCCCCC--CCCCC
T ss_conf             8807999-99999999999870999156678999999999999999998887518930565776455777455--56776


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHCCCC------CCCHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             2222027899999999999999999752887------74689999-9999689999999878799999999999999999
Q gi|254780483|r  480 LPFYLPGFMHVGIWPIIMSLSMFIQMKMSPP------PADKGQAM-ILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQ  552 (581)
Q Consensus       480 ~p~~~~~~~~~~ilp~l~~~~m~~~~k~~p~------~~d~~q~~-~~~~mp~~~~~~~~~~~~gl~~y~~~~~~~~~~q  552 (581)
                      ++|.+   .+++|||||||++||+||||++.      +.++.||| ||++||+||+||+++|||||+|||++||+++|+|
T Consensus       690 i~flG---~p~~ILPILmgvtMFLQQKmS~~k~~gP~t~qq~QQKmMm~mMPLmF~fif~nFPSGLvLYWvtSNLLsIvQ  766 (791)
T PRK01001        690 IWFIG---NEFHLLPILLGIVMFLQQKISALKKKGPVTDQQRQQEAMGTMMALLFTFMFYNFPSGLNIYWLSSMLLGVIQ  766 (791)
T ss_pred             CCCCC---CCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHH
T ss_conf             31135---507799999999999999735888899999449999999999999999999711026869999989999999


Q ss_pred             HHHHHHHCCCCCCHHHHHHHH
Q ss_conf             999987479983479898888
Q gi|254780483|r  553 QAVIMKMHGAEIGLIDRLRST  573 (581)
Q Consensus       553 q~~i~~~~~~~~~~~~~~~~~  573 (581)
                      ||+|||-. ++.++-..+.-+
T Consensus       767 Q~iINKiL-d~K~lk~Ev~~~  786 (791)
T PRK01001        767 QWVTNKIL-DSKHLKNEVVIN  786 (791)
T ss_pred             HHHHHHHH-HHHHHHHHHHHH
T ss_conf             99999973-388888897730


No 3  
>COG0706 YidC Preprotein translocase subunit YidC [Intracellular trafficking and secretion]
Probab=100.00  E-value=0  Score=568.11  Aligned_cols=291  Identities=40%  Similarity=0.772  Sum_probs=263.4

Q ss_pred             CCCEEEEEECEEEEEEEECCCCCEEEEEEECCCCCCCEEEEEECCCCCCCCC--CEEEEEEEEEEECHHHHHHHHHHCCC
Q ss_conf             4635787311058999607898415899831676641022220244445788--60367899885000278876322014
Q gi|254780483|r  248 SNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPG--KSITTTNFLFAGAKEFPTIHHYEKDL  325 (581)
Q Consensus       248 ~~~Wva~~qkYF~salIP~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~i~pg--~~~~~~~~lY~GPk~~~~L~~~~~~l  325 (581)
                      ..+|.+..+|||.++++|.+..........   ....+..++......+.++  .+.+....+|.||+..+.+..++.  
T Consensus         4 ~~~~~~~~~~y~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~--   78 (314)
T COG0706           4 LGGWLGILQLYFASLLIPRDFGRLEVPSPG---GTSRYQSGLKSKLRLVPPGMKASASTELLLLAGPKYVDDLSTSDP--   78 (314)
T ss_pred             CCCCHHHEECCCEEEECCCCCCCCCCCCCC---CCHHHHHHCCCCHHHCCCCCCCCCCCEEEEECCCCCCCCCCCCCC--
T ss_conf             331010100120354156654442213578---742566640340021044211366520355416765553000351--


Q ss_pred             CCCHHHHHHHHCCHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             631012333201103568999999998876320-1639999999999998889999999999988877888999997314
Q gi|254780483|r  326 AIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVG-NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK  404 (581)
Q Consensus       326 ~~~~l~~~vd~Gwf~~i~kplf~~L~~l~~~i~-NyGiaIIllTilikli~~PLt~ks~~Sm~kM~~lqP~i~~i~ekyk  404 (581)
                          +|.++|+|||+++.+|+|+++.++|.+.| |||++||++|++||++++|++.+|++||+||+++|||++|||||||
T Consensus        79 ----~~~~~~~~~f~~~~~~~~~~~~~~~~~~g~n~G~sIi~~ti~vRl~i~Pl~~~~~~s~~km~~lqP~~~~i~~kyk  154 (314)
T COG0706          79 ----LDLTSDYGWFWNILAPLFPLLLFIDSFSGLNWGLSIILLTIIVRLLIFPLSQKSTRSMAKMQELQPKIKEIQEKYK  154 (314)
T ss_pred             ----HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHC
T ss_conf             ----1345567899999999999999888872520889999999999999840778886549999983788999998806


Q ss_pred             -CCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHCCCCC
Q ss_conf             -5115678999999985048786788999999999999999999876986288753410000335725666764102222
Q gi|254780483|r  405 -QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY  483 (581)
Q Consensus       405 -~d~~~~~~~e~m~ly~~~~vnP~~GClP~l~q~p~~~a~~~~~~~~ielr~~~f~~Wi~dls~~d~~~~~~~~~~~p~~  483 (581)
                       +|+ |++|||||+|||||||||++||+|+|+|+|||+|+|++++++.|+|+++|.+|++|||.+||++++         
T Consensus       155 ~~~~-~~~q~e~~~Lyk~~~vnPl~gclP~liQ~Pifialy~~l~~~~~l~~~~f~~w~~dl~~~dp~~~~---------  224 (314)
T COG0706         155 GTDK-QKQQQEMMKLYKKHKVNPLAGCLPLLIQMPIFIALYYVLRSTVELRGAPFLGWITDLSLPDPDYIL---------  224 (314)
T ss_pred             CCCH-HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCHHH---------
T ss_conf             5429-999999999999829992355678999999999999999960110344376665523678973446---------


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCCCC----CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             027899999999999999999752887----7468999999996899999998787999999999999999999999874
Q gi|254780483|r  484 LPGFMHVGIWPIIMSLSMFIQMKMSPP----PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKM  559 (581)
Q Consensus       484 ~~~~~~~~ilp~l~~~~m~~~~k~~p~----~~d~~q~~~~~~mp~~~~~~~~~~~~gl~~y~~~~~~~~~~qq~~i~~~  559 (581)
                              ++||+||++||+|+++++.    ++||+|++||++||++|++|+.++||||+|||++||++|++||++|+|.
T Consensus       225 --------~~pii~gv~~f~q~~ls~~~~~~~q~~~~~~~~~impi~f~~~~~~~PaGL~LYW~~~n~fsi~Qq~ii~~~  296 (314)
T COG0706         225 --------LLPILAGVTMFLQQKLSPRNLSTPQDPQQKKMMYIMPIIFTFFFFNFPAGLVLYWIVSNLFSILQQYILNKP  296 (314)
T ss_pred             --------HHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCC
T ss_conf             --------999999999999999635357653579999999999999999998747899999997239999999999042


Q ss_pred             CCCCCC
Q ss_conf             799834
Q gi|254780483|r  560 HGAEIG  565 (581)
Q Consensus       560 ~~~~~~  565 (581)
                      ...+.+
T Consensus       297 ~~~~~~  302 (314)
T COG0706         297 LEKKRT  302 (314)
T ss_pred             CCHHHH
T ss_conf             210333


No 4  
>PRK00145 putative inner membrane protein translocase component YidC; Provisional
Probab=100.00  E-value=0  Score=483.31  Aligned_cols=204  Identities=33%  Similarity=0.602  Sum_probs=187.8

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHH--------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHH
Q ss_conf             1035689999999988763201--------63999999999999888999999999998887788899999731451156
Q gi|254780483|r  338 WFYFIAKPMFMLMSYFYNLVGN--------FGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQ  409 (581)
Q Consensus       338 wf~~i~kplf~~L~~l~~~i~N--------yGiaIIllTilikli~~PLt~ks~~Sm~kM~~lqP~i~~i~ekyk~d~~~  409 (581)
                      .|+||++|+.++++++|+|++|        ||+|||++|++||++++||+.||++||+||+++|||+++||||||||+ |
T Consensus         1 ~~~~l~~~~~~~~~~i~~~~~~~~~~~g~~~g~aIil~TiivRlil~Pl~~kq~ks~~km~~lqPel~~iq~kyk~d~-q   79 (225)
T PRK00145          1 MMRYLNNAFVQFFQFIHGFVSSLISNPNFSYGIAIILVTLIIRLLILPLNIKQTKSSQRMNEIQPEIKKLQAKYKNDP-Q   79 (225)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHCCCH-H
T ss_conf             978999999999999999987426778864999999999999999999999999999999984878999999854782-7


Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCHHHHH
Q ss_conf             78999999985048786788999999999999999999876986288753410000335725666764102222027899
Q gi|254780483|r  410 VLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMH  489 (581)
Q Consensus       410 ~~~~e~m~ly~~~~vnP~~GClP~l~q~p~~~a~~~~~~~~ielr~~~f~~Wi~dls~~d~~~~~~~~~~~p~~~~~~~~  489 (581)
                      ++|+|||+|||||||||++||||+|+|+|||+|+|++++...++++++| +|++|||+|||++                 
T Consensus        80 ~~q~e~~~Lykk~ginPl~gclp~liQ~Pif~~ly~~l~~~~~l~~~~f-lwi~dLs~~d~~~-----------------  141 (225)
T PRK00145         80 KLQQEMMKLYKEKNVNPLGGCLPLLIQWPILIALYYVFNNLTGINGVSF-LWIKDLAAPDVTW-----------------  141 (225)
T ss_pred             HHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC-EEECCCCCCCHHH-----------------
T ss_conf             8999999999984998227788899999999999999986887058982-2100356543999-----------------


Q ss_pred             HHHHHHHHHHHHHHHHHCCCC-CC---CHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             999999999999999752887-74---68999999-996899999998787999999999999999999999874799
Q gi|254780483|r  490 VGIWPIIMSLSMFIQMKMSPP-PA---DKGQAMIL-NWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA  562 (581)
Q Consensus       490 ~~ilp~l~~~~m~~~~k~~p~-~~---d~~q~~~~-~~mp~~~~~~~~~~~~gl~~y~~~~~~~~~~qq~~i~~~~~~  562 (581)
                        +||+++++++++++++... ..   ++.|+++| ..||++++++++++||||++||++||+++++||++++|....
T Consensus       142 --iLpil~~~~~~l~~~l~~~~~~~~~~~~~~~~m~~~m~i~~~~~~~~~Pagl~lYW~~snl~~i~Q~~~i~~~~~k  217 (225)
T PRK00145        142 --ILPILSGATTYLSGYLMTKATSSQAGGMQMKTMNIGMSIFMGVMSWKFKSALVLYWVIGNLIQIIQTYFIKKLPLK  217 (225)
T ss_pred             --HHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             --9999999999999998188999965699999999999999999998788999999999899999999999621035


No 5  
>PRK01622 OxaA-like protein precursor; Validated
Probab=100.00  E-value=0  Score=482.88  Aligned_cols=212  Identities=35%  Similarity=0.657  Sum_probs=188.1

Q ss_pred             HHCCHH-HHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHCCC--C
Q ss_conf             201103-56899999999887632-016399999999999988899999999999----888778889999973145--1
Q gi|254780483|r  335 DWGWFY-FIAKPMFMLMSYFYNLV-GNFGIAIMLTTVFVKLLFFPLAKKQYVSTA----NMKNIQPKIDELREKFKQ--S  406 (581)
Q Consensus       335 d~Gwf~-~i~kplf~~L~~l~~~i-~NyGiaIIllTilikli~~PLt~ks~~Sm~----kM~~lqP~i~~i~ekyk~--d  406 (581)
                      ..|||. ++..|+-++++|++++. ||||||||++||+||++++||+.||+|||.    ||+++||||+||||||||  |
T Consensus        33 ~~g~~~~~~v~p~~~~i~~~a~~~~gnyGlaIIl~TiivRlil~PL~~kq~ks~~~mq~KM~~lqPel~~Iq~Kyk~~kd  112 (266)
T PRK01622         33 SDGFFHHYFVYPFSFLIQFVAHHIHGSYGIAIIIVTLIIRSLMIPLAVSQYKSQRGMQEKMAVMKPELDKIQAKLKDTKD  112 (266)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHCCCCC
T ss_conf             99707999999999999999987588499999999999999998702999999999999999828426899998468988


Q ss_pred             H--HHHHHHHHHHHHHHCCCCHHH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHCCCCC
Q ss_conf             1--567899999998504878678-8999999999999999999876986288753410000335725666764102222
Q gi|254780483|r  407 P--PQVLQKAMIQLYKTHNINPLA-GCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY  483 (581)
Q Consensus       407 ~--~~~~~~e~m~ly~~~~vnP~~-GClP~l~q~p~~~a~~~~~~~~ielr~~~f~~Wi~dls~~d~~~~~~~~~~~p~~  483 (581)
                      +  ++++|+|||+|||||||||+| ||||||+|||||+|||++++.+.|+|+++| +|+ ||+.+|  +           
T Consensus       113 ~~~q~~~qqEmm~LYke~gvNPla~GCLP~LIQmPIf~aLy~~i~~~~~l~~~~F-lw~-~L~~~d--~-----------  177 (266)
T PRK01622        113 LEKQKEYQKEMMELYKSGNINPLAMGCLPLLIQMPILSAFYYAIRRTEEIATHSF-LWF-NLGHAD--H-----------  177 (266)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC-EEE-ECCCCC--H-----------
T ss_conf             8999999999999999849996134578999999999999999985598717981-123-258630--9-----------


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCCCC-CCCHHHH---HHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             027899999999999999999752887-7468999---9999-9689999999878799999999999999999999987
Q gi|254780483|r  484 LPGFMHVGIWPIIMSLSMFIQMKMSPP-PADKGQA---MILN-WMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK  558 (581)
Q Consensus       484 ~~~~~~~~ilp~l~~~~m~~~~k~~p~-~~d~~q~---~~~~-~mp~~~~~~~~~~~~gl~~y~~~~~~~~~~qq~~i~~  558 (581)
                              |+|+++|+++|+|++++.. +.+|.|+   |+|. +||+|+++|+.++||||+|||++||+++|+||++++|
T Consensus       178 --------ilpila~~~~~~q~~l~~~~~~~~~q~~~~k~M~~~mPim~~~~~~~~PagL~LYW~vsnlf~i~Qq~ii~k  249 (266)
T PRK01622        178 --------ILPIIAGLTYFIQMKVSQSNGTSPEQVQMLKIQGFMMPAMILFMSFAAPSALVLYWITGGLFLMVQTIVLRK  249 (266)
T ss_pred             --------HHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             --------999999999999999758899996899999999999999999999844899999999979999999999998


Q ss_pred             HCCCCCCHHHH
Q ss_conf             47998347989
Q gi|254780483|r  559 MHGAEIGLIDR  569 (581)
Q Consensus       559 ~~~~~~~~~~~  569 (581)
                      ....|.+...+
T Consensus       250 ~~~k~~~~~~~  260 (266)
T PRK01622        250 VMEKEEKQLQK  260 (266)
T ss_pred             HHHHHHHHHHH
T ss_conf             86588999999


No 6  
>PRK02944 OxaA-like protein precursor; Validated
Probab=100.00  E-value=0  Score=479.29  Aligned_cols=202  Identities=37%  Similarity=0.714  Sum_probs=185.1

Q ss_pred             HCCHH-HHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH---HHH
Q ss_conf             01103-568999999998876320-1639999999999998889999999999988877888999997314511---567
Q gi|254780483|r  336 WGWFY-FIAKPMFMLMSYFYNLVG-NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSP---PQV  410 (581)
Q Consensus       336 ~Gwf~-~i~kplf~~L~~l~~~i~-NyGiaIIllTilikli~~PLt~ks~~Sm~kM~~lqP~i~~i~ekyk~d~---~~~  410 (581)
                      .|||. ++.+|+.++++|+++++| |||||||++||+||++++||+.||++||+|||++||||++||||||+|+   +|+
T Consensus        33 ~g~~~~~~v~p~~~~i~~~a~~~g~~yGlaIIl~TiiVRlillPL~~kq~ks~~kMq~lqPe~~~Iq~Ky~~kd~~~~qk  112 (255)
T PRK02944         33 TGIWNEYFVYPLSQLITYFANLFGSNYGLAIIVVTLLIRLAILPLMIKQTKSTKAMQALQPEMVKLKEKYSSKDQATQQK  112 (255)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHCCCCHHHHHH
T ss_conf             98189999999999999999864971999999999999999998899999999999884867999999865897678999


Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHH
Q ss_conf             89999999850487867889999999999999999998769862887534100003357256667641022220278999
Q gi|254780483|r  411 LQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHV  490 (581)
Q Consensus       411 ~~~e~m~ly~~~~vnP~~GClP~l~q~p~~~a~~~~~~~~ielr~~~f~~Wi~dls~~d~~~~~~~~~~~p~~~~~~~~~  490 (581)
                      +|+|||+|||||||||+|||||+|+|+|||+|||++++.+.|+++++| +|+ ||+.+||++                  
T Consensus       113 ~qqE~~~Lykk~gvnP~~GCLP~LIQ~PI~~aly~ai~~~~~i~~~~F-lw~-dL~~~dp~~------------------  172 (255)
T PRK02944        113 LQQEMMQLYQKNGVNPLAGCLPIFIQMPILFAFYHAIMRTREISKHTF-LWF-DLGQADPYY------------------  172 (255)
T ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCE-EEE-CCCCCCHHH------------------
T ss_conf             999999999983999468889999999999999999998787236974-311-467633999------------------


Q ss_pred             HHHHHHHHHHHHHHHHCCCC--CCCHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999752887--74689999999-9689999999878799999999999999999999987
Q gi|254780483|r  491 GIWPIIMSLSMFIQMKMSPP--PADKGQAMILN-WMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK  558 (581)
Q Consensus       491 ~ilp~l~~~~m~~~~k~~p~--~~d~~q~~~~~-~mp~~~~~~~~~~~~gl~~y~~~~~~~~~~qq~~i~~  558 (581)
                       +|||++|+++|+|++++..  +.+..|+++|. +||+|+++|..++||||.|||++||+++|+||++|++
T Consensus       173 -ilpila~v~~flq~~~~~~~~~~~~~qmk~m~~~mPimi~~~~~~~Pagl~LYW~vsn~f~i~Qt~ii~~  242 (255)
T PRK02944        173 -ILPIVAGITTFIQQKLMMAGTAGQNPQMAMMLWLMPIMILIFAINFPAALSLYWVVGNIFGIAQTYLIKG  242 (255)
T ss_pred             -HHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             -9999999999999998068999989999999999999999999979999999999999999999999678


No 7  
>PRK02463 OxaA-like protein precursor; Provisional
Probab=100.00  E-value=0  Score=479.94  Aligned_cols=218  Identities=28%  Similarity=0.507  Sum_probs=190.6

Q ss_pred             HCC-HHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHCCC--C-
Q ss_conf             011-03568999999998876320-1639999999999998889999999999----9888778889999973145--1-
Q gi|254780483|r  336 WGW-FYFIAKPMFMLMSYFYNLVG-NFGIAIMLTTVFVKLLFFPLAKKQYVST----ANMKNIQPKIDELREKFKQ--S-  406 (581)
Q Consensus       336 ~Gw-f~~i~kplf~~L~~l~~~i~-NyGiaIIllTilikli~~PLt~ks~~Sm----~kM~~lqP~i~~i~ekyk~--d-  406 (581)
                      .|| ..++..|+-+++.|+.+++| |||||||++||+||++++||+.++.+||    +||++|||||++||||||+  | 
T Consensus        34 ~G~~~~~~v~p~~~~i~~~a~~~g~nyG~aIIl~TiiIRlillPL~~~Q~kk~~~~q~KMq~lQPe~~~IQ~KyK~~~~~  113 (307)
T PRK02463         34 TGMIWNFLGKPMSYFIDYFANNLGLGFGLAIIIVTIIVRTLILPLGLYQSWKATYQSEKMAYLKPVFEPINERLKNAKTQ  113 (307)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCHHHHHHHHHHCCCCCH
T ss_conf             74089999999999999999863877338999999999999983018899988999999998587899999984378988


Q ss_pred             -HHHHHHHHHHHHHHHCCCCHHH--HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHCCCCC
Q ss_conf             -1567899999998504878678--8999999999999999999876986288753410000335725666764102222
Q gi|254780483|r  407 -PPQVLQKAMIQLYKTHNINPLA--GCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY  483 (581)
Q Consensus       407 -~~~~~~~e~m~ly~~~~vnP~~--GClP~l~q~p~~~a~~~~~~~~ielr~~~f~~Wi~dls~~d~~~~~~~~~~~p~~  483 (581)
                       .++++|||||+|||||||||+|  ||||||||||||+|||.+++.+.|+|+++| ||+ ||+.||  .           
T Consensus       114 e~k~~~qqEmm~LYke~gvNP~gs~GCLPlLIQmPIf~aLY~ai~~~~~l~~~~F-lwi-~Lg~p~--~-----------  178 (307)
T PRK02463        114 EEKMAAQTELMAAQRENGISMLGGIGCLPLLIQMPFFSALYFAAQYTKGVSSSTF-LGI-DLGSRS--L-----------  178 (307)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCE-EEE-ECCCCC--H-----------
T ss_conf             9999999999999998498976444337899999999999999974233236865-545-688732--9-----------


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHH---HHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             02789999999999999999975288774689---999-99996899999998787999999999999999999999874
Q gi|254780483|r  484 LPGFMHVGIWPIIMSLSMFIQMKMSPPPADKG---QAM-ILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKM  559 (581)
Q Consensus       484 ~~~~~~~~ilp~l~~~~m~~~~k~~p~~~d~~---q~~-~~~~mp~~~~~~~~~~~~gl~~y~~~~~~~~~~qq~~i~~~  559 (581)
                              +||+++++++|+|++++....++.   |++ ||++||+|++||++++||||+|||++||+++|+||++||.-
T Consensus       179 --------iL~ila~v~~fiq~~ls~~~~~~~q~~qmk~Mm~~mPimi~~~~~~~PagL~LYW~vsnl~~IiQqliin~~  250 (307)
T PRK02463        179 --------VLTAIIAALYFFQSWLSMMGVPEEQREQMKTMMYMMPIMMVFFSFSSPAGVALYWLVGGFFSIIQQLITTYI  250 (307)
T ss_pred             --------HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             --------999999999999999627789868899999999999999999998758999999999899999999999622


Q ss_pred             CCCCCCHHHHHHHHHHCCC
Q ss_conf             7998347989888852046
Q gi|254780483|r  560 HGAEIGLIDRLRSTFSKNY  578 (581)
Q Consensus       560 ~~~~~~~~~~~~~~~~~~~  578 (581)
                      +  +|++-..+++-+++++
T Consensus       251 ~--~p~~~~~i~~e~~~~p  267 (307)
T PRK02463        251 L--KPRLRKQIKEEFAKNP  267 (307)
T ss_pred             C--CHHHHHHHHHHHHHCC
T ss_conf             6--7679999999987289


No 8  
>PRK02654 putative inner membrane protein translocase component YidC; Provisional
Probab=100.00  E-value=0  Score=480.19  Aligned_cols=241  Identities=28%  Similarity=0.515  Sum_probs=188.2

Q ss_pred             HHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHCCCCHHH
Q ss_conf             3201103568999999998876320163999999999999888999999999998887788899----999731451156
Q gi|254780483|r  334 IDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKID----ELREKFKQSPPQ  409 (581)
Q Consensus       334 vd~Gwf~~i~kplf~~L~~l~~~i~NyGiaIIllTilikli~~PLt~ks~~Sm~kM~~lqP~i~----~i~ekyk~d~~~  409 (581)
                      +|||+.++..++++.+|+|+|+++||||||||+|||+||++++|||+||++||+|||++||||+    |||||||||+ |
T Consensus         1 md~gig~~~~~~~~~il~f~~~~~~nyG~aIillTi~ir~~l~PL~~kq~~s~~kM~~~qP~~~~~~~ei~~kyk~d~-~   79 (376)
T PRK02654          1 MDFGIGFISNNVMLPILDFFYGIVPSYGLAIVALTLVIRFALYPLSAGSIRNMRRMKIAQPVMQKRQAEIQERYKNDP-Q   79 (376)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHCCCCH-H
T ss_conf             975134786537999999999601309999999999999999874899999999998858546799999998713889-9


Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH-------------------HHCCCCC-----CCCCCC-
Q ss_conf             789999999850487867889999999999999999998769-------------------8628875-----341000-
Q gi|254780483|r  410 VLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISL-------------------EMRHAPF-----WGWIKD-  464 (581)
Q Consensus       410 ~~~~e~m~ly~~~~vnP~~GClP~l~q~p~~~a~~~~~~~~i-------------------elr~~~f-----~~Wi~d-  464 (581)
                      |+|+|||+|||||| ||||||||||+|||||||||+++|++-                   ....++|     -.|++| 
T Consensus        80 k~q~e~m~lyk~~g-nPl~GCLP~liQmPi~~aLy~vlr~~pfa~v~Y~~~vki~~~~~i~~I~~~~~~s~~~~if~~~~  158 (376)
T PRK02654         80 KQQEEMGKLMKEFG-NPLAGCLPLLVQMPILFALFATLRGSPFADVNYTVNLQVLPSEQIAAVEPKPFKSKPHNIFITEG  158 (376)
T ss_pred             HHHHHHHHHHHHCC-CCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEECCCHHHHHHHCCCCCCCCCHHEEECCC
T ss_conf             99999999998719-97488899999999999999999558753455433200050877777323446775300011244


Q ss_pred             --------------------------------------------------------------------CCCCCHH---HH
Q ss_conf             --------------------------------------------------------------------0335725---66
Q gi|254780483|r  465 --------------------------------------------------------------------LAAADPT---NI  473 (581)
Q Consensus       465 --------------------------------------------------------------------ls~~d~~---~~  473 (581)
                                                                                          |...|..   .|
T Consensus       159 ~h~~v~a~lp~g~kl~vg~~v~~~~~~~~g~~~~~~~~~~~~~~~~p~w~v~~g~~~~~~~~dgt~~al~pgd~~i~~~I  238 (376)
T PRK02654        159 VHYPVIASLPGGTKLGVGESVQIQLQTTEGKSFSQLLAEYNGSKLSPTWKVTKGEERVKVSADGTIEALAPGDATVQVTI  238 (376)
T ss_pred             CCCCEEEECCCCCCCCCCCCEEEEECCCCCCHHHHHHHHCCCCCCCCCEEEECCCCCCCCCCCCCEECCCCCCCCEECCC
T ss_conf             45530121467653355641246631567621888875244100486301204664111356665001366543000014


Q ss_pred             HHH-----------HHCCCCCCHHHH--HHHHHHHHHHHHHHHHHHCCCC--CCCHHHHHHHHHHHHHHH--HHHHHHHH
Q ss_conf             676-----------410222202789--9999999999999999752887--746899999999689999--99987879
Q gi|254780483|r  474 FTL-----------FGILPFYLPGFM--HVGIWPIIMSLSMFIQMKMSPP--PADKGQAMILNWMPVVFV--FALSSFPA  536 (581)
Q Consensus       474 ~~~-----------~~~~p~~~~~~~--~~~ilp~l~~~~m~~~~k~~p~--~~d~~q~~~~~~mp~~~~--~~~~~~~~  536 (581)
                      ..+           .+...++.+.-.  .|.++++++|+|+|++|+++.+  +++|+|+.|+++||+||.  |+|..+||
T Consensus       239 pgiaa~~~Fl~I~aL~~vg~~~~g~I~w~Ilili~~~Gvsl~lsQ~ls~~~~~~npqq~~mnkimPvMfsgmFlfF~LPa  318 (376)
T PRK02654        239 PGLAAKSGFLFIKALGRVGFYDDGAINWDILGMVGGFGVSLYLSQVLSGQGMPANPQQSTANKITPVMFSGMFLFFPLPA  318 (376)
T ss_pred             CCHHCCCCCCEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCHH
T ss_conf             20220477503332234565556514488999999999999999997279999997999999874899988897011337


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCC
Q ss_conf             99999999999999999999874799834798988885204
Q gi|254780483|r  537 GLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN  577 (581)
Q Consensus       537 gl~~y~~~~~~~~~~qq~~i~~~~~~~~~~~~~~~~~~~~~  577 (581)
                      ||.+||+++|++.++||++|||.. .++++...++++.||.
T Consensus       319 GvgLYWvisnIfq~vQq~iLnK~~-~penlqkii~e~~~~~  358 (376)
T PRK02654        319 GVLLYMVIANIFQTLQTFLLSREP-LPENLQKILDELQKSK  358 (376)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCC-CHHHHHHHHHHHHHHH
T ss_conf             899999999999999999995568-8565999999998766


No 9  
>PRK01315 putative inner membrane protein translocase component YidC; Provisional
Probab=100.00  E-value=0  Score=468.38  Aligned_cols=238  Identities=27%  Similarity=0.474  Sum_probs=178.4

Q ss_pred             CCHHHHHHHHHH----HHHHHHH---HHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             110356899999----9998876---320-------16399999999999988899999999999888778889999973
Q gi|254780483|r  337 GWFYFIAKPMFM----LMSYFYN---LVG-------NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREK  402 (581)
Q Consensus       337 Gwf~~i~kplf~----~L~~l~~---~i~-------NyGiaIIllTilikli~~PLt~ks~~Sm~kM~~lqP~i~~i~ek  402 (581)
                      +||++|--|+-|    +|..+|.   .+|       +||+|||+|||+||++++||+.||+|||+|||+|||||+|||||
T Consensus         6 ~~~~~il~P~~w~v~~il~~~h~~l~~~g~~~~~G~sW~LsIIllTivVR~ll~PL~~KQ~kS~~kMq~lqPem~~IQ~K   85 (325)
T PRK01315          6 DFLGFILWPIKWVIELILVQFHTLLGALGFGPDSGLSWVLSIVGLVIVIRAALIPLFVKQIKAQRRMQEIQPEMKKIQEK   85 (325)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999997899999999999999998825787666399999999999999999988999999999999867999999998


Q ss_pred             CCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC-HHHHHHHH----
Q ss_conf             1451156789999999850487867889999999999999999998769862887534100003357-25666764----
Q gi|254780483|r  403 FKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAAD-PTNIFTLF----  477 (581)
Q Consensus       403 yk~d~~~~~~~e~m~ly~~~~vnP~~GClP~l~q~p~~~a~~~~~~~~ielr~~~f~~Wi~dls~~d-~~~~~~~~----  477 (581)
                      ||||+ |++|+|||+|||||||||+|||||||+|||||||||++++++++ |+.++..|-+||+.-. ...+|..+    
T Consensus        86 Yk~d~-qk~qqEmmkLYke~gvNPlaGCLPlLiQmPIf~~Ly~vL~~~~~-~~~~~g~~~~~l~~~~~~a~~fg~pl~~~  163 (325)
T PRK01315         86 YKGDR-ERMSQEMMKLYKETGTNPLSSCLPILLQMPIFFALYQVLNSAQA-RGDGIGPLNGPLLESFRSAHIFGAPLAAS  163 (325)
T ss_pred             CCCCH-HHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCCCCCCHHHHHHHCCCCCCCCCCCHH
T ss_conf             26989-99999999999983999406779999999999999999998776-05763323266787621263058774000


Q ss_pred             -----HCCCCCCHHHHHHHHHHHHHHHHHHHHHHC-C----CC-C-CCHH--HHHHH-HHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             -----102222027899999999999999999752-8----87-7-4689--99999-9968999999987879999999
Q gi|254780483|r  478 -----GILPFYLPGFMHVGIWPIIMSLSMFIQMKM-S----PP-P-ADKG--QAMIL-NWMPVVFVFALSSFPAGLIIYW  542 (581)
Q Consensus       478 -----~~~p~~~~~~~~~~ilp~l~~~~m~~~~k~-~----p~-~-~d~~--q~~~~-~~mp~~~~~~~~~~~~gl~~y~  542 (581)
                           +..|..........+++++|++++|++|+. .    |. . .+|+  |+|+| ++||+||++++++||+||.+||
T Consensus       164 f~~~~~~~~~~~~~~iv~~il~vlm~~s~f~~q~qlm~k~~~~~~~~~p~~~qqk~Mm~~mPlm~~~~~~~fPaGl~lYW  243 (325)
T PRK01315        164 FSDANGAVTALTDVMVVAAVMVVLMSASQFFTQLQLMTKNMPPETKATPMFQQQKMLLYLLPVMFAVSGIAFPVGVLFYW  243 (325)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             04543335530158899999999999999999999703479986547869999999999999999999977899999999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHH-HHHHHC
Q ss_conf             9999999999999987479983479898-888520
Q gi|254780483|r  543 SWSNVISIVQQAVIMKMHGAEIGLIDRL-RSTFSK  576 (581)
Q Consensus       543 ~~~~~~~~~qq~~i~~~~~~~~~~~~~~-~~~~~~  576 (581)
                      ++||++|++||++|+|++..+-....+. ++|..|
T Consensus       244 ~tsNl~ti~QQ~~v~r~~p~pgs~a~~~~~~r~~~  278 (325)
T PRK01315        244 LTSNVWTMGQQFYVIRNNPTPGSKAAEARRERLAR  278 (325)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHH
T ss_conf             99999999999999970899997578999878876


No 10 
>PRK03449 putative inner membrane protein translocase component YidC; Provisional
Probab=100.00  E-value=0  Score=467.03  Aligned_cols=230  Identities=23%  Similarity=0.399  Sum_probs=175.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHH---------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHH
Q ss_conf             03568999999998876320---------163999999999999888999999999998887788899999731451156
Q gi|254780483|r  339 FYFIAKPMFMLMSYFYNLVG---------NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQ  409 (581)
Q Consensus       339 f~~i~kplf~~L~~l~~~i~---------NyGiaIIllTilikli~~PLt~ks~~Sm~kM~~lqP~i~~i~ekyk~d~~~  409 (581)
                      |.||..|+.|+|.++|.+++         +||+|||++||+||++++||+.||+|||+|||+|||||+|||||||||+ |
T Consensus         2 ~~~~~~~~~~vl~~~h~l~~~~~~~~~~~swglsIIllTiiVR~ll~PL~~kq~kS~~kMq~lqPei~~Iq~KYk~D~-q   80 (304)
T PRK03449          2 LDFIYYPVSAILWFWHKLFAFVLGPDNGFAWALSVMFLVFTLRALLYKPFVRQIRTTRKMQELQPQIKALQKKYGNDR-Q   80 (304)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHCCCCH-H
T ss_conf             005999999999999999997728866619999999999999999999899999999999985878999998865869-9


Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH-------------HH-CCCC-CCCCCCCCCCCCHHHHH
Q ss_conf             789999999850487867889999999999999999998769-------------86-2887-53410000335725666
Q gi|254780483|r  410 VLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISL-------------EM-RHAP-FWGWIKDLAAADPTNIF  474 (581)
Q Consensus       410 ~~~~e~m~ly~~~~vnP~~GClP~l~q~p~~~a~~~~~~~~i-------------el-r~~~-f~~Wi~dls~~d~~~~~  474 (581)
                      ++|||||+|||||||||+|||||+|||||||+|||+++++.-             |. ++.+ ++++..|+++.-...+|
T Consensus        81 k~qqE~mkLYke~gvNPl~GCLP~LiQmPIf~~LY~vlr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~sfl~~~~f  160 (304)
T PRK03449         81 RMALEMQKLQKEHGFNPILGCLPMLAQIPVFLGLFHVLRSFNRTGTGFGQLGLSVEENRNTPNYVFSAEDVQSFLDANLF  160 (304)
T ss_pred             HHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             99999999999859993156699999999999999999850123332132111025430474100565667666668772


Q ss_pred             H-------------HHHCCCCCCHHHHHHH-HHHHHHHHHHHHHHHCCC-----C-CCCHHH---HHHH-HHHHHHHHHH
Q ss_conf             7-------------6410222202789999-999999999999975288-----7-746899---9999-9968999999
Q gi|254780483|r  475 T-------------LFGILPFYLPGFMHVG-IWPIIMSLSMFIQMKMSP-----P-PADKGQ---AMIL-NWMPVVFVFA  530 (581)
Q Consensus       475 ~-------------~~~~~p~~~~~~~~~~-ilp~l~~~~m~~~~k~~p-----~-~~d~~q---~~~~-~~mp~~~~~~  530 (581)
                      .             +.....|.......+. .++++++++++++++++.     . ..+|+|   +|+| ++||+|++++
T Consensus       161 g~pl~~~~~~~~~~~~~~~~~~~~~i~~~~~pl~il~~~~~~~~~~~s~~~~~~~~~~n~q~~~m~k~M~~~mPlm~~~~  240 (304)
T PRK03449        161 GAPLSAYITMQRSGLDAFTDFSRTAIILVGVPLMIIAGVATHFNARASVARQSAEAAANPQTAMMNKLALWVFPLGVLVG  240 (304)
T ss_pred             CCCHHHHHCCCCHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             69727653266110012245442006999999999999999999999874358888999769999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHH
Q ss_conf             987879999999999999999999998747998347989
Q gi|254780483|r  531 LSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDR  569 (581)
Q Consensus       531 ~~~~~~gl~~y~~~~~~~~~~qq~~i~~~~~~~~~~~~~  569 (581)
                      +.++||||++||++||+++|+||++|+|++..|++....
T Consensus       241 ~~~~PaGL~lYWi~sNl~~i~QQ~~i~~~~~~~~~~~~~  279 (304)
T PRK03449        241 GPFLPLAILLYWFSNNIWTFGQQHYVFGKIDKEEEAKKQ  279 (304)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHH
T ss_conf             996999999999999999999999997138997127999


No 11 
>TIGR03593 yidC_nterm membrane protein insertase, YidC/Oxa1 family, N-terminal domain. Essentially all bacteria have a member of the YidC family, whose C-terminal domain is modeled by TIGR03592. The two copies are found in endospore-forming bacteria such as Bacillus subtilis appear redundant during vegetative growth, although the member designated spoIIIJ (stage III sporulation protein J) has a distinct role in spore formation. YidC, its mitochondrial homolog Oxa1, and its chloroplast homolog direct insertion into the bacterial/organellar inner (or only) membrane. This model describes an N-terminal sequence region, including a large periplasmic domain lacking in YidC members from Gram-positive species. The multifunctional YidC protein acts both with and independently of the Sec system.
Probab=100.00  E-value=0  Score=450.02  Aligned_cols=349  Identities=28%  Similarity=0.489  Sum_probs=277.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCC--------CCCCCCCCCHHCCCCCCEEEEEC
Q ss_conf             2789999999999999997513789887654433333445677667755--------56666676100014587289976
Q gi|254780483|r    4 NWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNS--------YAAVLIDDRAQALSMSPRVELKN   75 (581)
Q Consensus         4 nKn~iIai~Ls~~ill~w~~~~~~p~~e~~~~~~~~~~s~~~~~~~~~~--------~~~~~~~~~~~~~~~~~~I~Ien   75 (581)
                      +||+|||++||++||++|++|+.+|+++++.+++..++....+...+..        .......+.......+++|+|||
T Consensus         1 dkn~lia~~Ls~~ili~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~ien   80 (366)
T TIGR03593         1 NRRLILAIALSFVIFLLWQAWQVDPGPPPPKPPAAAQTASAQSATAAATPAAAPPAADAPSAAAAADAAAATAKRITVKT   80 (366)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEC
T ss_conf             91036999999999999999707778888755310121135667777777777754445555555433335675699985


Q ss_pred             CEEEEEEECCCCEEEEEEECCCCCCCCCCCCCEEEECCCCCCCCCEEEEECCCCCC-CCCCCCCCCCEECCCCC-CCC-C
Q ss_conf             64999997699559999953571344788772688545666553100000134787-75433343210015666-566-6
Q gi|254780483|r   76 PSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWNLISGK-ILT-P  152 (581)
Q Consensus        76 d~l~i~is~~GG~I~~~~LK~Y~~~~~~ds~~v~Ll~~~~~~~~y~~~~G~~~~~~-~~~~p~~~~~~~~~~~~-~l~-~  152 (581)
                      |+++++||++||+|+++.||+|+.+.+++++++.|++. +..+.|++++|+...+. ....++.++.|+..... .+. +
T Consensus        81 ~~~~~~is~~Gg~I~~~~LK~y~~~~~~~~~~v~L~~~-~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~  159 (366)
T TIGR03593        81 DVLRASISTKGGDIDSLELKKYKETLDKDSPPVLLLSN-GTERLYVAQSGLIGANGADLALPGHRTVWQAEGGEYTLTPG  159 (366)
T ss_pred             CCEEEEEECCCCEEEEEECCCCCCCCCCCCCEEEECCC-CCCCCCEEEECCCCCCCCCCCCCCCCCCEEECCCCEEECCC
T ss_conf             83999997899668999813553323789971880489-98874167404524687422478876307843771575699


Q ss_pred             CCCCEEEEECCCCEEEEEEEEEC-CCCEEEEEEEECCCCCCCCCCCCCEEEECCCCCCCCCCCC---CCCCEEECCCCCC
Q ss_conf             66504774158842699999716-8835899986315766642224210120256865444200---1100000156543
Q gi|254780483|r  153 TTPIKLVFKNANNILFERTISLD-EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFG---VQEGFIAVLGDKS  228 (581)
Q Consensus       153 ~~~v~l~~~~~~g~~i~kt~t~~-~~Y~i~i~~~v~N~s~~~i~~~~~~~i~r~~~~~~~~~~~---~~~g~~~~~~d~~  228 (581)
                      ..+++|++.+++|++++|+|+|+ ++|+++++++|+|.|+.++.+.++.++.|+..+...+...   .+.|+++..++++
T Consensus       160 ~~~v~~~~~~~~g~~i~k~yt~~~d~Y~i~~~~~v~n~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~  239 (366)
T TIGR03593       160 QLPVTLTWDNGNGVTVTKTYTFDRDSYLIDVEYKITNNGGAPVSLSLYGQLKRDLSPTEKSTYFLHETFTGAAYYTDGEK  239 (366)
T ss_pred             CEEEEEEEECCCCEEEEEEEEECCCCEEEEEEEEEECCCCCCCEEEEEEEEECCCCCCCCCCCEEEEEEEEEEEECCCCC
T ss_conf             75689999889996999999993895789999999758787310201389873787888775134330035799848984


Q ss_pred             CCCCCCCCCCCCCCC-CCCCCCCEEEEEECEEEEEEEECCCCCEEEEEEE-CCCCCCCEEEEEECCCCCCCCCCEEEEEE
Q ss_conf             210013333333222-3323463578731105899960789841589983-16766410222202444457886036789
Q gi|254780483|r  229 LVEQKYSDIEKSSIS-NFHESNSWLGISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILPGKSITTTN  306 (581)
Q Consensus       229 ~~~~~~~d~~~~~~~-~~~~~~~Wva~~qkYF~salIP~~~~~~~~~~~~-~~~~~~~y~~~~~~~~~~i~pg~~~~~~~  306 (581)
                      +++++++|+++++.. ...+.++|+|++||||++||||+++......... .....+.|.+++..+...+.||++.+.++
T Consensus       240 ~~~~~~~d~~~~~~~~~~~~~~~W~~~~~~YF~saliP~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~~~~~~~  319 (366)
T TIGR03593       240 YQKVSFKDIEKKKLNVETKGGAGWVAMLQHYFASAWIPQAGSDGTTAFYYGKKLGNNVYIAGFVSPPVTVAPGQSATIKS  319 (366)
T ss_pred             EEECCHHHHHHCCCCCCCCCCCCEEEEEEEEEEEEECCCCCCCCEEEEEEECCCCCCEEEEEECCCCEEECCCCEEEEEE
T ss_conf             57746102221666421137752899731025899814788762378985035789728998516750557998168998


Q ss_pred             EEEEECHHHHHHHHHHCCCCCCHHHHHHHHCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9885000278876322014631012333201103568999999998876320
Q gi|254780483|r  307 FLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVG  358 (581)
Q Consensus       307 ~lY~GPk~~~~L~~~~~~l~~~~l~~~vd~Gwf~~i~kplf~~L~~l~~~i~  358 (581)
                      ++|+|||+|++|++|+.+     ||++||||||+||+|||||+|+|||++||
T Consensus       320 ~~y~GPk~~~~L~~~~~~-----L~~~Vd~Gwf~~iakPlf~~L~~~~~~vG  366 (366)
T TIGR03593       320 RLYAGPKEQDVLKAIAPG-----LDLAVDYGWLWFIAKPLFWLLDFIHSLVG  366 (366)
T ss_pred             EEEECCCCHHHHHHHHCC-----CCEEEECCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             999874709999867509-----32699853299999999999999897519


No 12 
>PRK02201 putative inner membrane protein translocase component YidC; Provisional
Probab=100.00  E-value=0  Score=421.19  Aligned_cols=213  Identities=24%  Similarity=0.410  Sum_probs=163.5

Q ss_pred             HHHHHHHHHHHHHHHHHHH---HHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH----
Q ss_conf             0356899999999887632---0163----9999999999998889999999999988877888999997314511----
Q gi|254780483|r  339 FYFIAKPMFMLMSYFYNLV---GNFG----IAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSP----  407 (581)
Q Consensus       339 f~~i~kplf~~L~~l~~~i---~NyG----iaIIllTilikli~~PLt~ks~~Sm~kM~~lqP~i~~i~ekyk~d~----  407 (581)
                      ++++.-|.-+++.+.+...   .-+|    +|||++|++||++++|+|.||+.|+.|||++|||++||+|||||++    
T Consensus       132 yg~fV~P~a~i~~~~~~~~~~~~~~g~~~i~ai~~~~~ivrli~~~~t~kst~~q~KMqeiQpK~akIqaKYK~~kkD~q  211 (392)
T PRK02201        132 YGLFVYPIAQILLWVAAPLSLDELYGWSTILAILVLVLIIRLITFLITFKSTFNQEKMQELQGKKAKINAKYKDAKKDKQ  211 (392)
T ss_pred             EEEEHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHH
T ss_conf             58842347999877522565776555999999999999999999887699997699999862789999987356556999


Q ss_pred             -HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCHH
Q ss_conf             -5678999999985048786788999999999999999999876986288753410000335725666764102222027
Q gi|254780483|r  408 -PQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPG  486 (581)
Q Consensus       408 -~~~~~~e~m~ly~~~~vnP~~GClP~l~q~p~~~a~~~~~~~~ielr~~~f~~Wi~dls~~d~~~~~~~~~~~p~~~~~  486 (581)
                       +||||+|||+|||||||||+|||||+|+|||||||+|+++.++.|||+++| +|+ |||++|...+++  +..|+... 
T Consensus       212 SkQKmQ~EMm~LYKK~gVNP~ggclPilIQmPIFfALYrVl~~~~elk~a~f-~gi-dLsat~w~~i~s--g~~~yl~l-  286 (392)
T PRK02201        212 MKQRKQLEIQELYKKHNISPFSPFAQIFVTLPIFLAIYRIVQSLPPIKVTTF-LGI-DLSATPWQEIFA--GNWIYLPI-  286 (392)
T ss_pred             HHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCE-EEE-ECCCCCHHHHCC--CCCHHHHH-
T ss_conf             9999999999999983999157778899997899999999961376612403-200-004687354314--66258989-


Q ss_pred             HHHHHHHHHHHHHHHHHHHHC----CCCCC--------CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             899999999999999999752----88774--------689999999968999999987879999999999999999999
Q gi|254780483|r  487 FMHVGIWPIIMSLSMFIQMKM----SPPPA--------DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQA  554 (581)
Q Consensus       487 ~~~~~ilp~l~~~~m~~~~k~----~p~~~--------d~~q~~~~~~mp~~~~~~~~~~~~gl~~y~~~~~~~~~~qq~  554 (581)
                         +.+..+++.++|+++|-+    ++..+        ++.|++||.+||+||+|+..+|||||++||++||+++|+||+
T Consensus       287 ---lil~~~~q~lS~~lpq~L~~kk~~~~~~~~~~~~q~kkq~~m~~impiVF~f~~i~fPAGL~lYWiinNi~tIiQtl  363 (392)
T PRK02201        287 ---LIVVVPVQILSQKLPQILAKKKNKNRTNVEEKNESLKKQNRTQNIVSIVFIFIGVIFAAGVQIYWIFGGIFTILQTY  363 (392)
T ss_pred             ---HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             ---99999999999999999741147877783012477899999999999999999988765775687760299998787


Q ss_pred             HHHHH
Q ss_conf             99874
Q gi|254780483|r  555 VIMKM  559 (581)
Q Consensus       555 ~i~~~  559 (581)
                      +|..-
T Consensus       364 iI~~~  368 (392)
T PRK02201        364 GIHYF  368 (392)
T ss_pred             HEEEE
T ss_conf             21666


No 13 
>TIGR03592 yidC_oxa1_cterm membrane protein insertase, YidC/Oxa1 family, C-terminal domain. This model describes full-length from some species, and the C-terminal region only from other species, of the YidC/Oxa1 family of proteins. This domain appears to be univeral among bacteria (although absent from Archaea). The well-characterized YidC protein from Escherichia coli and its close homologs contain a large N-terminal periplasmic domain in addition to the region modeled here.
Probab=100.00  E-value=0  Score=395.73  Aligned_cols=179  Identities=49%  Similarity=0.960  Sum_probs=170.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH
Q ss_conf             16399999999999988899999999999888778889999973145115678999999985048786788999999999
Q gi|254780483|r  359 NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIP  438 (581)
Q Consensus       359 NyGiaIIllTilikli~~PLt~ks~~Sm~kM~~lqP~i~~i~ekyk~d~~~~~~~e~m~ly~~~~vnP~~GClP~l~q~p  438 (581)
                      |||+|||++|+++|++++|++.+|.++++||+.+|||+++||||||+|+ +++|+|+|+|||||||||++||+|+|+|+|
T Consensus         1 nW~~sIi~~ti~vR~~~~Pl~i~~~~~~~km~~i~Pe~~~i~~k~~~~~-~~~~~~~~~lykk~~v~p~~~~l~~liQiP   79 (181)
T TIGR03592         1 NWGLAIILLTIIIRLILLPLTLKQYKSMRKMQELQPKLKEIQEKYKDDP-QKLQQEMMKLYKEEGVNPLGGCLPLLIQMP   79 (181)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH-HHHHHHHHHHHHHHCCCHHHHHHHHHHHHH
T ss_conf             9748999999999999999999999999999986888999875464668-999999999999848676788999999999


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCC-CCHHHH
Q ss_conf             9999999998769862887534100003357256667641022220278999999999999999997528877-468999
Q gi|254780483|r  439 VFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQA  517 (581)
Q Consensus       439 ~~~a~~~~~~~~ielr~~~f~~Wi~dls~~d~~~~~~~~~~~p~~~~~~~~~~ilp~l~~~~m~~~~k~~p~~-~d~~q~  517 (581)
                      ||+++|++++...++.+++| +|++|||.+||++                   +||+++++++++++++++.. .++.|+
T Consensus        80 i~~~l~~~l~~~~~l~~~~f-lw~~dLt~~dp~~-------------------iLP~~~~~~~~~~~~~~~~~~~~~~~~  139 (181)
T TIGR03592        80 IFIALYQVLRRSIELRHAPF-LWIKDLSAPDPYY-------------------ILPILMGVTMFLQQKLSPKGPPDPAQQ  139 (181)
T ss_pred             HHHHHHHHHHHHHHHHHHHH-HHHHHCCCCCHHH-------------------HHHHHHHHHHHHHHHHCCCCCCCHHHH
T ss_conf             99999999998588765123-2045038864799-------------------999999999999999537899998999


Q ss_pred             HHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999-9689999999878799999999999999999999987
Q gi|254780483|r  518 MILN-WMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK  558 (581)
Q Consensus       518 ~~~~-~mp~~~~~~~~~~~~gl~~y~~~~~~~~~~qq~~i~~  558 (581)
                      |+|. +||++++++..++|||+.+||++||+++++||++++|
T Consensus       140 k~~~~~~p~~~~~~~~~~P~al~lYw~~s~~~~i~Q~~il~r  181 (181)
T TIGR03592       140 KIMMYIMPLMFLFFFLSFPAGLVLYWVVSNLFTIIQQLIINR  181 (181)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             999999999999999979999999999989999999999739


No 14 
>pfam02096 60KD_IMP 60Kd inner membrane protein.
Probab=100.00  E-value=0  Score=367.29  Aligned_cols=182  Identities=51%  Similarity=0.944  Sum_probs=164.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHH
Q ss_conf             01639999999999998889999999999988877888999997314511567899999998504878678899999999
Q gi|254780483|r  358 GNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQI  437 (581)
Q Consensus       358 ~NyGiaIIllTilikli~~PLt~ks~~Sm~kM~~lqP~i~~i~ekyk~d~~~~~~~e~m~ly~~~~vnP~~GClP~l~q~  437 (581)
                      ||||+||+++|++||++++|++.+|.++++||+.+|||+++||||||+|+ +++++|||+|||||||||++||+|+|+|+
T Consensus         1 ~sw~~sI~~~ti~vR~i~lPl~~~~~~~~~k~~~l~Pe~~~i~~k~~~~~-~~~~~e~~~lyk~~g~~p~~~~l~~liQ~   79 (194)
T pfam02096         1 GNWGLAIILLTILVRLLLLPLTLKQYKSMAKMQELQPEIKEIQEKYKDDP-QKLQQEMMKLYKEHGVNPLKGCLPMLIQL   79 (194)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHCCCCH-HHHHHHHHHHHHHHCCCHHHHHHHHHHHH
T ss_conf             96128999999999999999999999999999982586899987661447-99999999999994836788877899999


Q ss_pred             HHHHHHHHHHHHHHHHCC---CCCCCCCCCCCCCC-HHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCC--
Q ss_conf             999999999987698628---87534100003357-256667641022220278999999999999999997528877--
Q gi|254780483|r  438 PVFFAIYKVISISLEMRH---APFWGWIKDLAAAD-PTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP--  511 (581)
Q Consensus       438 p~~~a~~~~~~~~ielr~---~~f~~Wi~dls~~d-~~~~~~~~~~~p~~~~~~~~~~ilp~l~~~~m~~~~k~~p~~--  511 (581)
                      |||+++|.+++...++.+   ++| +|++||+.+| |++                   +||++++++++++++++...  
T Consensus        80 Pif~~~~~~ir~~~~~~~~~~~~~-lw~~dLt~~D~~~~-------------------iLpii~~~~~~~~~~~~~~~~~  139 (194)
T pfam02096        80 PIFFALYRVLRNMAELRGLETAGF-LWIKDLSAPDPPYF-------------------ILPILAGLTMFLQQKLSPKPQD  139 (194)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCC-CCCHHCCCCCCHHH-------------------HHHHHHHHHHHHHHHHCCCCCC
T ss_conf             999999999999998653002775-67020389860069-------------------9999999999999996656778


Q ss_pred             -CCH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             -468----9999999968999999987879999999999999999999998747
Q gi|254780483|r  512 -ADK----GQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMH  560 (581)
Q Consensus       512 -~d~----~q~~~~~~mp~~~~~~~~~~~~gl~~y~~~~~~~~~~qq~~i~~~~  560 (581)
                       .++    .++.++.+||++++++..++|+||.+||++||+++++|+++++|..
T Consensus       140 ~~~~~~~~~~k~~~~~~~~~~~~~~~~~Paal~lYW~~s~~~sl~Q~~il~~~~  193 (194)
T pfam02096       140 PTDKQQSPQMKIMMYIMPLIFLFFFLNFPAGLVLYWIVSNLFSLVQQLLIRKPL  193 (194)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             776146899999999999999999997899999999998999999999981678


No 15 
>PRK00247 putative inner membrane protein translocase component YidC; Validated
Probab=100.00  E-value=0  Score=357.62  Aligned_cols=197  Identities=23%  Similarity=0.388  Sum_probs=139.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH----HHHHHHHHHHHHHHCCCCHHHHHHHHH
Q ss_conf             1639999999999998889999999999988877888999997314511----567899999998504878678899999
Q gi|254780483|r  359 NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSP----PQVLQKAMIQLYKTHNINPLAGCWPIL  434 (581)
Q Consensus       359 NyGiaIIllTilikli~~PLt~ks~~Sm~kM~~lqP~i~~i~ekyk~d~----~~~~~~e~m~ly~~~~vnP~~GClP~l  434 (581)
                      .||+|||+|||+||++++||+.||++||.+|+.|||||++||||||||+    ++++|+|||+|||+|||||++||||||
T Consensus        31 aW~lSIi~Lti~VR~il~Pl~~kq~kS~r~Mq~lqPemk~LqeKYk~~~d~~s~~emqqe~m~LyKe~gvNPlaGCLP~L  110 (422)
T PRK00247         31 AWFFSLFGLVITVRAIIAPFTWQMYKSGRTAAHIRPKRAALREEYKGRYDEASIRELQKRQKDLNKEYGINPLAGCVPGL  110 (422)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCHHHH
T ss_conf             99999999999999999977999999999999829589999998568846689999999999999981999632222378


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCC---------CCCCCCCCCCCCCHHHHHHHHHCCCC-------------CCHHH--HHH
Q ss_conf             9999999999999876986288---------75341000033572566676410222-------------20278--999
Q gi|254780483|r  435 LQIPVFFAIYKVISISLEMRHA---------PFWGWIKDLAAADPTNIFTLFGILPF-------------YLPGF--MHV  490 (581)
Q Consensus       435 ~q~p~~~a~~~~~~~~ielr~~---------~f~~Wi~dls~~d~~~~~~~~~~~p~-------------~~~~~--~~~  490 (581)
                      +|||||||||+||...-.-.+.         .| +=.+|..+..-..+   || .|.             .+...  .+.
T Consensus       111 iQiPvFigLY~VLl~~ar~~~G~~~~~~~~iG~-ls~~dV~SF~~A~l---FG-aPLsa~~sm~~e~la~lgtt~~~V~~  185 (422)
T PRK00247        111 IQIPVVLGLYQVLLRMARPEGGLENPVFQSIGF-LTPEEVESFLAGRV---FN-VPLPAYVSMPTEQLAYLGTTQAEVLS  185 (422)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC-CCHHHHHHHHHCHH---CC-CCCHHHHCCCHHHHHHCCCCCHHHHH
T ss_conf             862699999999998525567878888778776-89999999984713---38-72188745878888650787225789


Q ss_pred             HHHHHHHHHHHHHHHHC--C----CCC-------CCHHHHH--HH-HHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999752--8----877-------4689999--99-9968999999987--8799999999999999999
Q gi|254780483|r  491 GIWPIIMSLSMFIQMKM--S----PPP-------ADKGQAM--IL-NWMPVVFVFALSS--FPAGLIIYWSWSNVISIVQ  552 (581)
Q Consensus       491 ~ilp~l~~~~m~~~~k~--~----p~~-------~d~~q~~--~~-~~mp~~~~~~~~~--~~~gl~~y~~~~~~~~~~q  552 (581)
                      -++|++|.++.|..+.+  +    .+.       +-++++.  +| ++||++.+++-.+  ||-|+.+||++||+.|++|
T Consensus       186 vvlplli~As~fTt~n~~~S~~R~~~t~d~~s~~~~~m~k~m~~m~~l~Pvfpl~~gv~GpFPVaVLlYW~tnNlWTmGQ  265 (422)
T PRK00247        186 FVLPLFITAAVFTAINMAMSTYRSFQTNDYASGFSNGMLKFMIVMSILAPIFPLSLGLTGPFPTAIALYWVANNLWTLLQ  265 (422)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEHHHHHCCHHHHHH
T ss_conf             99999999999999999999986422332121221468999999999999999999964886336324645203888866


Q ss_pred             HHHHHHHC
Q ss_conf             99998747
Q gi|254780483|r  553 QAVIMKMH  560 (581)
Q Consensus       553 q~~i~~~~  560 (581)
                      |.++.+-+
T Consensus       266 Q~~m~~i~  273 (422)
T PRK00247        266 TIIMMVIL  273 (422)
T ss_pred             HHHEEEEE
T ss_conf             45302555


No 16 
>KOG1239 consensus
Probab=99.82  E-value=1.6e-18  Score=153.67  Aligned_cols=196  Identities=20%  Similarity=0.341  Sum_probs=160.4

Q ss_pred             HHCCHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH-----H
Q ss_conf             201103568999999998876320-1639999999999998889999999999988877888999997314511-----5
Q gi|254780483|r  335 DWGWFYFIAKPMFMLMSYFYNLVG-NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSP-----P  408 (581)
Q Consensus       335 d~Gwf~~i~kplf~~L~~l~~~i~-NyGiaIIllTilikli~~PLt~ks~~Sm~kM~~lqP~i~~i~ekyk~d~-----~  408 (581)
                      .++|++..+. |=..|..+|.+-| +|+..|+.-|+.||.+.+|+-.++.+..+|+..+.|+|.++.++.++-.     .
T Consensus        77 ~~~~~~p~~~-lq~~l~~~h~~~g~pww~~i~~~t~~ir~~i~~~~~~~~~~~akls~~~~~mp~~~~~l~~a~~~~~~~  155 (372)
T KOG1239          77 ALSSWRPVAT-LQNELERLHVYSGLPWWASIVATTVLIRSLITPLLTNSQKNEAKLSKIFPEMPSLGEELGEAAQDNNAL  155 (372)
T ss_pred             HHCCCCCHHH-HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCH
T ss_conf             7326674248-899999999970886137888767667654556777401577887623701278898887631133136


Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC----CCCCCCCCCCCHHHHHHHHHCCCCCC
Q ss_conf             67899999998504878678899999999999999999987698628875----34100003357256667641022220
Q gi|254780483|r  409 QVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF----WGWIKDLAAADPTNIFTLFGILPFYL  484 (581)
Q Consensus       409 ~~~~~e~m~ly~~~~vnP~~GClP~l~q~p~~~a~~~~~~~~ielr~~~f----~~Wi~dls~~d~~~~~~~~~~~p~~~  484 (581)
                      ...|+||++++++|||+| -.-.=+++|.|+|+++|..++... .-..+|    .+|.+||+.+||++            
T Consensus       156 ~~~q~~~~~l~~~~~v~~-~~l~~~v~q~~l~~sff~air~ma-~~v~~f~t~g~~wf~dLt~~dp~~------------  221 (372)
T KOG1239         156 LSWQEEQKLLVKKYGVKP-KQLALPVVQGPLFISFFMAIRVMA-VPVPSFTTGGLLWFPDLTGPDPLY------------  221 (372)
T ss_pred             HHHHHHHHHHHHHCCCCC-CHHHHHHHCCHHHHHHHHHHHHHH-CCCCCCCHHHHHHCCCCCCCCCCH------------
T ss_conf             888899986455438884-045565410114788999998764-266664125677411466667303------------


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCC------CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             27899999999999999999752887------7468999999996899999998787999999999999999999999
Q gi|254780483|r  485 PGFMHVGIWPIIMSLSMFIQMKMSPP------PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVI  556 (581)
Q Consensus       485 ~~~~~~~ilp~l~~~~m~~~~k~~p~------~~d~~q~~~~~~mp~~~~~~~~~~~~gl~~y~~~~~~~~~~qq~~i  556 (581)
                             ++|++++++|..-.+++-.      ..-|.-..++.++|+..+.+..+||+++..||+    ++.+|-.++
T Consensus       222 -------ilp~it~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ll~~~~t~~~~~a~~~ywl----~s~~~~~vl  288 (372)
T KOG1239         222 -------ILPGITLATLTLFIELGAETGLSSSKLLPAMKSFIRILPLLSLASTMQFPSAIFVYWL----FSLVQGLVL  288 (372)
T ss_pred             -------HHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHH
T ss_conf             -------6678999999999998777643102346025889987353212544210346776442----677777775


No 17 
>KOG1239 consensus
Probab=96.94  E-value=0.0018  Score=43.77  Aligned_cols=200  Identities=18%  Similarity=0.147  Sum_probs=124.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHH-HHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             632016399999999999988899999999999888778889999973145115-6789999999850487867889999
Q gi|254780483|r  355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPP-QVLQKAMIQLYKTHNINPLAGCWPI  433 (581)
Q Consensus       355 ~~i~NyGiaIIllTilikli~~PLt~ks~~Sm~kM~~lqP~i~~i~ekyk~d~~-~~~~~e~m~ly~~~~vnP~~GClP~  433 (581)
                      +..+-+|.++++.|+++++..+|++..+-.|+--|...+|-+..+...+....+ -.+|.+.+.+|+-.|.++.+||.+-
T Consensus        30 s~~~~~~~~~~~~t~~~~~~~~p~~~~~~~s~~v~~~~~~~~~~~~~~~~~~~p~~~lq~~l~~~h~~~g~pww~~i~~~  109 (372)
T KOG1239          30 SSPGFSGFSVFLRTILVKLTNSPLSQPEASSTSVVATVSPIIEGILLALSSWRPVATLQNELERLHVYSGLPWWASIVAT  109 (372)
T ss_pred             CCCCCCCCCCCCEEECCCCCCCCCCCCCCCCHHHHHHHCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHH
T ss_conf             66776654401035410146688776766405788761316778887732667424889999999997088613788876


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC------CCCHHHHHHHH-----HCCCCCCH---HHHHHHHHHHHHHH
Q ss_conf             999999999999998769862887534100003------35725666764-----10222202---78999999999999
Q gi|254780483|r  434 LLQIPVFFAIYKVISISLEMRHAPFWGWIKDLA------AADPTNIFTLF-----GILPFYLP---GFMHVGIWPIIMSL  499 (581)
Q Consensus       434 l~q~p~~~a~~~~~~~~ielr~~~f~~Wi~dls------~~d~~~~~~~~-----~~~p~~~~---~~~~~~ilp~l~~~  499 (581)
                      .+-+|..+..+.+.....+-|-..-..|++-+.      +.|.-..+.+-     +..++..+   .-..+...|+--+-
T Consensus       110 t~~ir~~i~~~~~~~~~~~akls~~~~~mp~~~~~l~~a~~~~~~~~~~q~~~~~l~~~~~v~~~~l~~~v~q~~l~~sf  189 (372)
T KOG1239         110 TVLIRSLITPLLTNSQKNEAKLSKIFPEMPSLGEELGEAAQDNNALLSWQEEQKLLVKKYGVKPKQLALPVVQGPLFISF  189 (372)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHCCHHHHHH
T ss_conf             76676545567774015778876237012788988876311331368888999864554388840455654101147889


Q ss_pred             HHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999997528877468999999996899999998787999999999999999999999
Q gi|254780483|r  500 SMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVI  556 (581)
Q Consensus       500 ~m~~~~k~~p~~~d~~q~~~~~~mp~~~~~~~~~~~~gl~~y~~~~~~~~~~qq~~i  556 (581)
                      .|-+..-.-|.+.++++  ...|.|-+-...-..-..|++.||+.+++..=.|+-.-
T Consensus       190 f~air~ma~~v~~f~t~--g~~wf~dLt~~dp~~ilp~it~~~~~~~~~~~~~~~~~  244 (372)
T KOG1239         190 FMAIRVMAVPVPSFTTG--GLLWFPDLTGPDPLYILPGITLATLTLFIELGAETGLS  244 (372)
T ss_pred             HHHHHHHHCCCCCCCHH--HHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99998764266664125--67741146666730366789999999999987776431


No 18 
>COG1422 Predicted membrane protein [Function unknown]
Probab=96.80  E-value=0.017  Score=36.73  Aligned_cols=86  Identities=15%  Similarity=0.272  Sum_probs=51.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-----CH--HHHHHHHHHHHHHHCCCCHHHHHH
Q ss_conf             16399999999999988899999999999888778889999973145-----11--567899999998504878678899
Q gi|254780483|r  359 NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQ-----SP--PQVLQKAMIQLYKTHNINPLAGCW  431 (581)
Q Consensus       359 NyGiaIIllTilikli~~PLt~ks~~Sm~kM~~lqP~i~~i~ekyk~-----d~--~~~~~~e~m~ly~~~~vnP~~GCl  431 (581)
                      +.-|+|+++.+++-+.. -+-+|=..-..||+++|-+++|.||+++.     |.  -+|+|++.|+.-....==..--.-
T Consensus        45 ~p~lvilV~avi~gl~~-~i~~~~liD~ekm~~~qk~m~efq~e~~eA~~~~d~~~lkkLq~~qmem~~~Q~elmk~qfk  123 (201)
T COG1422          45 PPHLVILVAAVITGLYI-TILQKLLIDQEKMKELQKMMKEFQKEFREAQESGDMKKLKKLQEKQMEMMDDQRELMKMQFK  123 (201)
T ss_pred             CCHHHHHHHHHHHHHHH-HHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             62899999999999999-99999960299999999999999999999998088999999999999999999999998641


Q ss_pred             HHHHHHHHHHHHHH
Q ss_conf             99999999999999
Q gi|254780483|r  432 PILLQIPVFFAIYK  445 (581)
Q Consensus       432 P~l~q~p~~~a~~~  445 (581)
                      ||+.++++-|-+|.
T Consensus       124 PM~~~~v~tI~~F~  137 (201)
T COG1422         124 PMLYISVLTIPFFA  137 (201)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             58999999999999


No 19 
>pfam01956 DUF106 Integral membrane protein DUF106. This archaebacterial protein family has no known function. Members are predicted to be integral membrane proteins.
Probab=95.51  E-value=0.21  Score=28.73  Aligned_cols=63  Identities=25%  Similarity=0.267  Sum_probs=34.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCHHHHH---HHHHHHHHHHCCCCHHHHHHH----HHHHHHHHHHHHHHHH
Q ss_conf             99999888778889999973145115678---999999985048786788999----9999999999999998
Q gi|254780483|r  383 YVSTANMKNIQPKIDELREKFKQSPPQVL---QKAMIQLYKTHNINPLAGCWP----ILLQIPVFFAIYKVIS  448 (581)
Q Consensus       383 ~~Sm~kM~~lqP~i~~i~ekyk~d~~~~~---~~e~m~ly~~~~vnP~~GClP----~l~q~p~~~a~~~~~~  448 (581)
                      -+-..+|+.+|=+.+++++....-+.+++   |.|+|+..++-   -+..--|    |++|+|||.-++++|.
T Consensus        43 ~~~q~~~~~~~~~~~~l~~~~~~~~~~k~~~~q~~~~~~q~~m---m~~~mK~~~~~~i~~i~i~~wi~~~f~  112 (168)
T pfam01956        43 EKYKKRMKEIQKRARELRKNGDKLSPKKFEKRQEELMEDQKEM---MMDMMKPNFAIMIPQILIFGWINSFFS  112 (168)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             9999999999999999987689557899999999988848999---999777779999999999999999924


No 20 
>PRK11055 galM aldose 1-epimerase; Provisional
Probab=93.75  E-value=0.53  Score=25.76  Aligned_cols=122  Identities=11%  Similarity=0.124  Sum_probs=64.1

Q ss_pred             CCCEEEEECCE-EEEEEECCCCEEEEEEECCCCCCCCCCCCCEEEECCCCCCCCCEEEE---ECCC--------------
Q ss_conf             58728997664-99999769955999995357134478877268854566655310000---0134--------------
Q gi|254780483|r   67 MSPRVELKNPS-LIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAEL---DYVS--------------  128 (581)
Q Consensus        67 ~~~~I~Iend~-l~i~is~~GG~I~~~~LK~Y~~~~~~ds~~v~Ll~~~~~~~~y~~~~---G~~~--------------  128 (581)
                      ....++++|+. ++++|.+.||.|.++.+++=.    .....|.|-. ++. ..|....   |-+.              
T Consensus        14 ~v~~~tL~N~~g~~v~i~n~GA~i~s~~vpd~~----G~~~dvVLG~-d~~-e~Y~~~~~y~GatiGR~AnRI~~g~f~l   87 (348)
T PRK11055         14 PYRLLTLRNNAGMVVTLMDWGATWLSCRVPLSD----GEVREVLLGC-ASP-EDYPDQAAYLGASVGRYANRIANSRFTL   87 (348)
T ss_pred             EEEEEEEECCCCCEEEEECCCCEEEEEEEECCC----CCEEEEEECC-CCH-HHHHCCCCCCCCCCCCCCCEEECCEEEE
T ss_conf             999999987999599998878199999979888----9885349789-998-9984188841668056467253887988


Q ss_pred             CCCCCCCC--------------CCCCCEECCCCCCCCCCCCCEEEEECC-------CCEEEEEEEEECCCCEEEEEEEEC
Q ss_conf             78775433--------------343210015666566666504774158-------842699999716883589998631
Q gi|254780483|r  129 TANNIELP--------------NSNTVWNLISGKILTPTTPIKLVFKNA-------NNILFERTISLDEHYLFKIVDTVT  187 (581)
Q Consensus       129 ~~~~~~~p--------------~~~~~~~~~~~~~l~~~~~v~l~~~~~-------~g~~i~kt~t~~~~Y~i~i~~~v~  187 (581)
                      .+....++              .+.-.|++..    .++..|+|++...       ..+.++-+|++.++-.+.++++-+
T Consensus        88 dg~~y~L~~N~g~n~LHGG~~Gf~~~~W~v~~----~~~~~V~f~~~s~dge~GfPG~l~v~vtY~L~~~n~L~I~y~A~  163 (348)
T PRK11055         88 DGETYQLSPNQGGNQLHGGPEGFDKRRWQIVN----QNDRQVTFSLSSPDGDQGFPGNLGVTVQYRLTDDNRVSITYRAT  163 (348)
T ss_pred             CCEEEEECCCCCCCEECCCCCCCCCEEEEEEC----CCCCEEEEEEECCCCCCCCCCEEEEEEEEEEECCCEEEEEEEEE
T ss_conf             99899825788983207897765525899952----78998999998876567887039999999990499799999999


Q ss_pred             CCCCCCCCCCC
Q ss_conf             57666422242
Q gi|254780483|r  188 NNSIDQIRFSP  198 (581)
Q Consensus       188 N~s~~~i~~~~  198 (581)
                      -....++++..
T Consensus       164 td~~T~~NlTn  174 (348)
T PRK11055        164 VDKPCPVNLTN  174 (348)
T ss_pred             ECCCCEEECCC
T ss_conf             08983642256


No 21 
>pfam01263 Aldose_epim Aldose 1-epimerase.
Probab=92.44  E-value=0.8  Score=24.42  Aligned_cols=124  Identities=22%  Similarity=0.327  Sum_probs=64.7

Q ss_pred             CEEEEECCE-EEEEEECCCCEEEEEEECCCCCCCCCCCCCEEEECCCCCCCCCEEE-------EECC----------CCC
Q ss_conf             728997664-9999976995599999535713447887726885456665531000-------0013----------478
Q gi|254780483|r   69 PRVELKNPS-LIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAE-------LDYV----------STA  130 (581)
Q Consensus        69 ~~I~Iend~-l~i~is~~GG~I~~~~LK~Y~~~~~~ds~~v~Ll~~~~~~~~y~~~-------~G~~----------~~~  130 (581)
                      +.++++|+. ++++|.+.||.|.++++++      +..+ +.|-.++  ...|...       .|-.          ..+
T Consensus         1 ~l~tL~n~~g~~v~i~~~GA~l~s~~~~~------~~~~-vvlg~~~--~~~y~~~~~~~Ga~iGr~anRI~~g~~~~~G   71 (301)
T pfam01263         1 DLITLKNGNGLSATISLYGATLLSLKVPD------KGEE-VLLGSDD--ADGYLKDANYFGATLGRYANRIANGRFELDG   71 (301)
T ss_pred             CEEEEECCCCCEEEEECCCCEEEEEEECC------CCCC-EEECCCC--HHHHHCCCCCCCCCCCCCCCEEECCEEEECC
T ss_conf             97999879986999988792999999899------2852-3886899--8998308674152627877740897396999


Q ss_pred             CCCCCCCC------------CCCEECCCCCCCCCCCCCEEEEE-CC-----CCEEEEEEEEECCCCEEEEEEEECCCC-C
Q ss_conf             77543334------------32100156665666665047741-58-----842699999716883589998631576-6
Q gi|254780483|r  131 NNIELPNS------------NTVWNLISGKILTPTTPIKLVFK-NA-----NNILFERTISLDEHYLFKIVDTVTNNS-I  191 (581)
Q Consensus       131 ~~~~~p~~------------~~~~~~~~~~~l~~~~~v~l~~~-~~-----~g~~i~kt~t~~~~Y~i~i~~~v~N~s-~  191 (581)
                      ....++..            ...|++..... .++..+++... ++     ..+.++-+|+++++..+.++++++|.+ .
T Consensus        72 ~~y~l~~N~~g~~~lHGg~~~~~W~~~~~~~-~~~~~~~~~~~~~~~~gyPg~~~~~v~y~L~~~~~l~i~~~a~~~~~~  150 (301)
T pfam01263        72 KPYQLPQNGPGKNPLHGGARGRIWEVEEVKP-DDGVTVSLVLDPDGEEGYPGDLEVRVTYTLNEDNELTIEYEATNDGKP  150 (301)
T ss_pred             EEEECCCCCCCCCEECCCCCCEEEEEEEECC-CCCEEEEEEECCCCCCCCCEEEEEEEEEEECCCCEEEEEEEEEECCCC
T ss_conf             8998646899975203676762778899628-985899999878744698637999999999379989999999968988


Q ss_pred             CCCCCC--CCEEE
Q ss_conf             642224--21012
Q gi|254780483|r  192 DQIRFS--PRGRI  202 (581)
Q Consensus       192 ~~i~~~--~~~~i  202 (581)
                      .++.+.  +|..+
T Consensus       151 tp~n~t~H~YFnl  163 (301)
T pfam01263       151 TPFNLGNHPYFNL  163 (301)
T ss_pred             EEEEECCCCEEEC
T ss_conf             5787026446845


No 22 
>pfam00558 Vpu Vpu protein. The Vpu protein contains an N-terminal transmembrane spanning region and a C-terminal cytoplasmic region. The HIV-1 Vpu protein stimulates virus production by enhancing the release of viral particles from infected cells. The VPU protein binds specifically to CD4.
Probab=92.30  E-value=0.83  Score=24.30  Aligned_cols=68  Identities=16%  Similarity=0.447  Sum_probs=52.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC--HHH-HHHHHHHHHHHHCCC-CHH
Q ss_conf             63999999999999888999999999998887788899999731451--156-789999999850487-867
Q gi|254780483|r  360 FGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQS--PPQ-VLQKAMIQLYKTHNI-NPL  427 (581)
Q Consensus       360 yGiaIIllTilikli~~PLt~ks~~Sm~kM~~lqP~i~~i~ekyk~d--~~~-~~~~e~m~ly~~~~v-nP~  427 (581)
                      .|+.+++..+++-++.|-..++-|+--+|=|++--.++.|+||-.|-  ... .-.++.|+|--.+|. |||
T Consensus         7 ~~ii~l~v~liiaIvVW~iv~~ey~k~~rqrkI~~l~~RIrEraEDSgnES~Gd~Ee~L~~Lv~~~gfdnPm   78 (81)
T pfam00558         7 IGLIALIVALIINIVVWTIVYREYRKIKKQREILRLIKRIRERAEDSGNESNGDEEEELADLVHSHGFDNPM   78 (81)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHCCCCCCC
T ss_conf             999999999999999999999999999999999999999999603678878870889999998807998755


No 23 
>pfam07423 DUF1510 Protein of unknown function (DUF1510). This family consists of several hypothetical bacterial proteins of around 200 residues in length. The function of this family is unknown.
Probab=91.34  E-value=0.28  Score=27.74  Aligned_cols=29  Identities=24%  Similarity=0.424  Sum_probs=22.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             89999999999999997513789887654
Q gi|254780483|r    6 NYFVAIALSVIIVYAWQNFYVYPRIEEMN   34 (581)
Q Consensus         6 n~iIai~Ls~~ill~w~~~~~~p~~e~~~   34 (581)
                      |++|++++.++++++|+.|+.....++..
T Consensus        17 NiaI~iV~llIiiva~~lf~~~~~~~~~~   45 (214)
T pfam07423        17 NIAIGIVVVLIIIVAYQLFFPSSPSDQAA   45 (214)
T ss_pred             HHHHHHHHHHHHHHHHHEEECCCCCCCCC
T ss_conf             79999999999997664023588753211


No 24 
>pfam09973 DUF2208 Predicted membrane protein (DUF2208). This domain, found in various hypothetical archaeal proteins, has no known function.
Probab=89.12  E-value=1.6  Score=22.29  Aligned_cols=97  Identities=14%  Similarity=0.267  Sum_probs=48.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHH-HHHHHHH---HHHHH-----HHHHHCCCCHHHHH
Q ss_conf             68999999998876320163999999-999999888999999999-9988877---88899-----99973145115678
Q gi|254780483|r  342 IAKPMFMLMSYFYNLVGNFGIAIMLT-TVFVKLLFFPLAKKQYVS-TANMKNI---QPKID-----ELREKFKQSPPQVL  411 (581)
Q Consensus       342 i~kplf~~L~~l~~~i~NyGiaIIll-Tilikli~~PLt~ks~~S-m~kM~~l---qP~i~-----~i~ekyk~d~~~~~  411 (581)
                      |++-...+....-++.|.|=+-++++ =|++=.+..-.+.+||+| .+-++++   +|-++     ++.||   |+  .+
T Consensus         6 iSqvsillfs~Vlsf~Pqyy~~~filYfiif~~is~~~~~Rs~~~~~~~~~Ei~~gr~L~eEk~a~kl~~k---D~--el   80 (232)
T pfam09973         6 ISQVSILLFSAVLSFYPQYYLEVFILYFIIFMGIMIVMTLRSNRSERKSLQEISSGRTLYEEKEANKLVEK---DE--EL   80 (232)
T ss_pred             HHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHCCCCCCCCCHHHHHHHH---CH--HH
T ss_conf             99999999999998763889999999999999999999865265568877787336864462206789873---79--99


Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999850487867889999999999999999998769
Q gi|254780483|r  412 QKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISL  451 (581)
Q Consensus       412 ~~e~m~ly~~~~vnP~~GClP~l~q~p~~~a~~~~~~~~i  451 (581)
                      ++|+++.-|+.=.+        |+-+|+++.++.++...+
T Consensus        81 ~~e~~~~~kas~~~--------ll~l~i~ii~~~l~~~~v  112 (232)
T pfam09973        81 TKELKAQAKASMSP--------LLILPIYIIVFFLLYPFV  112 (232)
T ss_pred             HHHHHHHHHHHHHH--------HHHHHHHHHHHHHHHHCC
T ss_conf             99999999999888--------899999999999987211


No 25 
>pfam06936 Selenoprotein_S Selenoprotein S (SelS). This family consists of several mammalian selenoprotein S (SelS) sequences. SelS is a plasma membrane protein and is present in a variety of tissues and cell types. The function of this family is unknown.
Probab=84.92  E-value=2.6  Score=20.68  Aligned_cols=51  Identities=25%  Similarity=0.382  Sum_probs=33.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---------------------H----HHHHHHHHHHHHHHCCCC
Q ss_conf             632016399999999999988899999999999---------------------8----887788899999731451
Q gi|254780483|r  355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTA---------------------N----MKNIQPKIDELREKFKQS  406 (581)
Q Consensus       355 ~~i~NyGiaIIllTilikli~~PLt~ks~~Sm~---------------------k----M~~lqP~i~~i~ekyk~d  406 (581)
                      .|+.+|||=|++..|++=+|.--|... .+++.                     +    =+.+|-+.++--|+|+.-
T Consensus        31 ~~l~~YGWyiL~~~v~ly~l~qkL~~~-~~~~~~r~~~~~~~~~dPd~v~~RQEam~aAR~RmQee~dA~A~~~~ek  106 (190)
T pfam06936        31 ELLSKYGWYLLLGCVGIYLLIQKLRPR-WRSLQKRSSEKEITVFDPDKVVRRQEALEAARLRMQEDLDAKAAKFKEK  106 (190)
T ss_pred             HHHHHCCHHHHHHHHHHHHHHHHHHHH-HHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999963779999999999999987199-9988740244310005989999999999999999999999999999999


No 26 
>PRK09108 type III secretion system protein HrcU; Validated
Probab=81.61  E-value=3.5  Score=19.77  Aligned_cols=39  Identities=15%  Similarity=0.279  Sum_probs=22.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             99999999999988899999999999888778889999973145
Q gi|254780483|r  362 IAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQ  405 (581)
Q Consensus       362 iaIIllTilikli~~PLt~ks~~Sm~kM~~lqP~i~~i~ekyk~  405 (581)
                      +.++++.++|=++=|+.+...|..--||-+     +|+|+.||+
T Consensus       190 ~~~~~~~~via~~D~~~qr~~~~k~LkMSk-----qEvK~E~K~  228 (354)
T PRK09108        190 AVAALVFLVVGAADWKIQRWLFIRDNRMSK-----DEVKREHKE  228 (354)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCH-----HHHHHHHHH
T ss_conf             999999999999999999999999738998-----999999886


No 27 
>TIGR01185 devC DevC protein; InterPro: IPR005891   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This family contains a predicted membrane subunit, DevC, of an ABC transporter known so far from two species of cyanobacteria. Some experimental data from mutational analysis { suggest that this protein, along with DevA and DevB encoded in the same operon, may be involved in the transport/export of glycolipids.; GO: 0005215 transporter activity, 0006810 transport, 0016020 membrane.
Probab=81.16  E-value=2.5  Score=20.85  Aligned_cols=48  Identities=19%  Similarity=0.210  Sum_probs=32.1

Q ss_pred             HHHHHCC---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             3332011---0356899999999887632016399999999999988899999
Q gi|254780483|r  332 MLIDWGW---FYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKK  381 (581)
Q Consensus       332 ~~vd~Gw---f~~i~kplf~~L~~l~~~i~NyGiaIIllTilikli~~PLt~k  381 (581)
                      ++|.||=   +|.|-+  --+|=-.=+|.|+|+++|||-+---|.-..|+--.
T Consensus       296 KAIGY~~~YLLGV~lQ--EALLLA~~GyLP~~~l~i~LY~~~~~AT~LP~~M~  346 (381)
T TIGR01185       296 KAIGYTDKYLLGVVLQ--EALLLAVLGYLPSFVLAILLYTTARRATLLPLIMS  346 (381)
T ss_pred             HHCCCCCHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHH
T ss_conf             3203442246788999--99999998751689999999876577623714756


No 28 
>cd02433 Nodulin-21_like_2 Nodulin-21 and CCC1-related protein family. Nodulin-21_like_2: This is a family of proteins closely related to nodulin-21, a plant nodule-specific protein that may be involved in symbiotic nitrogen fixation. This family is also related to CCC1, a yeast vacuole transmembrane protein that functions as an iron and manganese transporter.
Probab=79.98  E-value=3.9  Score=19.39  Aligned_cols=33  Identities=12%  Similarity=0.386  Sum_probs=24.1

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCH
Q ss_conf             8889999973145115678999999985048786
Q gi|254780483|r  393 QPKIDELREKFKQSPPQVLQKAMIQLYKTHNINP  426 (581)
Q Consensus       393 qP~i~~i~ekyk~d~~~~~~~e~m~ly~~~~vnP  426 (581)
                      +=++++-+....++| +...+|+.++|++.|..|
T Consensus        82 ~~e~~rE~~ei~~~p-~~E~~El~~iy~~kG~~~  114 (234)
T cd02433          82 EASIPDERRELRKHP-LEEAAELALIYRAKGLDE  114 (234)
T ss_pred             HHHHHHHHHHHHHCH-HHHHHHHHHHHHHCCCCH
T ss_conf             988999999985095-889999999998769998


No 29 
>PRK01001 putative inner membrane protein translocase component YidC; Provisional
Probab=79.09  E-value=0.48  Score=26.03  Aligned_cols=140  Identities=16%  Similarity=0.180  Sum_probs=67.2

Q ss_pred             HHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCHH------------HHHHHH
Q ss_conf             999999888999--999999998887788899999731451156789999999850487867------------889999
Q gi|254780483|r  368 TVFVKLLFFPLA--KKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPL------------AGCWPI  433 (581)
Q Consensus       368 Tilikli~~PLt--~ks~~Sm~kM~~lqP~i~~i~ekyk~d~~~~~~~e~m~ly~~~~vnP~------------~GClP~  433 (581)
                      +|++=.|+--|-  =-..+|++-|++                ||++|=+|-+|-+||+=+|-            .|.=|+
T Consensus       575 AIILLTIiIRLLLfPLt~KQ~KSMkK----------------MQeLQPeMkEIQEKYKdDpQKlQqEMMKLYKE~GVNPL  638 (791)
T PRK01001        575 SIILLTVFLKLLLYPLNAWSIRSMRR----------------MQKLSPYIQEIQQKYKKEPKRAQMEIMALYKTNKVNPI  638 (791)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH----------------HHHHCHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCH
T ss_conf             99999999999998405899999999----------------98868899999988079999999999999987099915


Q ss_pred             HHHHHHHHHH--HHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHCC--C-----CCCHHHHHHHHHHH-HHHHHHHH
Q ss_conf             9999999999--9999876986288753410000335725666764102--2-----22027899999999-99999999
Q gi|254780483|r  434 LLQIPVFFAI--YKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL--P-----FYLPGFMHVGIWPI-IMSLSMFI  503 (581)
Q Consensus       434 l~q~p~~~a~--~~~~~~~ielr~~~f~~Wi~dls~~d~~~~~~~~~~~--p-----~~~~~~~~~~ilp~-l~~~~m~~  503 (581)
                      ==-+|+++-+  |..|...  ||. ++     +|-...  ++..|.-.+  |     +..|.+ .++ .|+ +.-+.|-+
T Consensus       639 gGCLPLLIQMPIFIALY~V--L~~-si-----eLRgAs--FL~gWI~DLSaPD~lF~~~~Pi~-flG-~p~~ILPILmgv  706 (791)
T PRK01001        639 TGCLPLLIQLPFLIAMFDL--LKS-SF-----LLRGAS--FIPGWIDNLTAPDVLFSWETPIW-FIG-NEFHLLPILLGI  706 (791)
T ss_pred             HHHHHHHHHHHHHHHHHHH--HHH-HH-----HHCCCC--CHHHHHHHCCCCCCCCCCCCCCC-CCC-CCHHHHHHHHHH
T ss_conf             6678999999999999999--998-88-----751893--05657764557774555677631-135-507799999999


Q ss_pred             HHHCCCCCCCH-------HHHHHHHHHHHHHHHHHHHHH
Q ss_conf             97528877468-------999999996899999998787
Q gi|254780483|r  504 QMKMSPPPADK-------GQAMILNWMPVVFVFALSSFP  535 (581)
Q Consensus       504 ~~k~~p~~~d~-------~q~~~~~~mp~~~~~~~~~~~  535 (581)
                      .|-++..-+-+       .|++.|+.|..+|.+||..+-
T Consensus       707 tMFLQQKmS~~k~~gP~t~qq~QQKmMm~mMPLmF~fif  745 (791)
T PRK01001        707 VMFLQQKISALKKKGPVTDQQRQQEAMGTMMALLFTFMF  745 (791)
T ss_pred             HHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999735888899999449999999999999999999


No 30 
>pfam01988 VIT1 VIT family. This family includes the vacuolar Fe2+/Mn2+ uptake transporter, Ccc1 and the vacuolar iron transporter VIT1.
Probab=76.86  E-value=4.8  Score=18.76  Aligned_cols=47  Identities=13%  Similarity=0.385  Sum_probs=26.6

Q ss_pred             HHHHHHHHHHHHH-HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCH
Q ss_conf             9999999998887-78889999973145115678999999985048786
Q gi|254780483|r  379 AKKQYVSTANMKN-IQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINP  426 (581)
Q Consensus       379 t~ks~~Sm~kM~~-lqP~i~~i~ekyk~d~~~~~~~e~m~ly~~~~vnP  426 (581)
                      ..-.|.|-+.=|. .+=|+++-+....++| ++..+|+.++|++.|.+|
T Consensus        49 ~~G~yls~~se~~~~~~e~~~e~~~~~~~p-~~e~~el~~i~~~~Gl~~   96 (210)
T pfam01988        49 AAGEYLSVKSERDLEEAELEREKWELENDP-EGEREELAQIYRARGLSE   96 (210)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCH-HHHHHHHHHHHHHCCCCH
T ss_conf             888999987089999999999999873385-889999999998749998


No 31 
>KOG1594 consensus
Probab=74.20  E-value=5.6  Score=18.29  Aligned_cols=123  Identities=14%  Similarity=0.203  Sum_probs=59.9

Q ss_pred             CEEEEECCE-EEEEEECCCCEEEEEEECCCCCC-----CC--CCCCCEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCC
Q ss_conf             728997664-99999769955999995357134-----47--88772688545666553100000134787754333432
Q gi|254780483|r   69 PRVELKNPS-LIGSINLKGAQFDDLNLRGYHLD-----VS--SNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNT  140 (581)
Q Consensus        69 ~~I~Iend~-l~i~is~~GG~I~~~~LK~Y~~~-----~~--~ds~~v~Ll~~~~~~~~y~~~~G~~~~~~~~~~p~~~~  140 (581)
                      ..|.+.+.. =+++|...||+|.+++.++=.+-     ..  +..+++     .+.....|-++|-.+.... --...+.
T Consensus        24 ~~ivL~~p~g~taev~L~Gg~V~SWK~~~geElLf~S~kA~f~ppKpI-----RGGIP~~FPQFG~~g~l~q-HGFaRn~   97 (305)
T KOG1594          24 DKIVLTDPRGSTAEVYLYGGQVVSWKNENGEELLFVSTKAIFKPPKPI-----RGGIPICFPQFGNFGSLPQ-HGFARNR   97 (305)
T ss_pred             CEEEEECCCCCEEEEEEECCEEEEEECCCCCEEEEECHHHHCCCCCCC-----CCCCCEEEECCCCCCCCCC-CCCCCCE
T ss_conf             569995899983899992428999652788446886105304899864-----4786467304578876544-4520030


Q ss_pred             CEECCCCCCCCC---CCCCEEEEECC--------CCEEEEEEEEECCCCEEEEEEEECCCCCCCCCCCC
Q ss_conf             100156665666---66504774158--------84269999971688358999863157666422242
Q gi|254780483|r  141 VWNLISGKILTP---TTPIKLVFKNA--------NNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSP  198 (581)
Q Consensus       141 ~~~~~~~~~l~~---~~~v~l~~~~~--------~g~~i~kt~t~~~~Y~i~i~~~v~N~s~~~i~~~~  198 (581)
                      .|.+.....-.+   ...|.|.....        ....++.+.++.+++ ++....|+|..+++.++..
T Consensus        98 ~W~v~~~p~~lp~~~~a~Vdl~Lk~~~~~~kiWp~~Fe~~lrv~l~~g~-Lt~~~rV~Ntd~KpFsF~~  165 (305)
T KOG1594          98 FWEVENNPPPLPSLGKATVDLILKSSEDDLKIWPHSFELRLRVSLGDGE-LTLTSRVRNTDSKPFSFSF  165 (305)
T ss_pred             EEEECCCCCCCCCCCCEEEEEEECCCHHHHHHCCCCEEEEEEEEECCCC-EEEEEEEECCCCCCEEEEE
T ss_conf             4685169998976786059999658820343087522799999973881-5887776627998558886


No 32 
>PRK12721 secretion system apparatus protein SsaU; Reviewed
Probab=72.55  E-value=6.1  Score=18.01  Aligned_cols=16  Identities=13%  Similarity=0.287  Sum_probs=5.4

Q ss_pred             HHHHHHHHHHHHHHHH
Q ss_conf             8889999999999988
Q gi|254780483|r  374 LFFPLAKKQYVSTANM  389 (581)
Q Consensus       374 i~~PLt~ks~~Sm~kM  389 (581)
                      +=++.+...|..--||
T Consensus       200 ~D~~~Qr~~~~k~LkM  215 (349)
T PRK12721        200 LDYAFQRYKIMKQLKM  215 (349)
T ss_pred             HHHHHHHHHHHHHCCC
T ss_conf             9999999999987389


No 33 
>COG1377 FlhB Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=72.17  E-value=6.2  Score=17.95  Aligned_cols=50  Identities=26%  Similarity=0.518  Sum_probs=28.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             9887632016399999999999988899999999999888778889999973145
Q gi|254780483|r  351 SYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQ  405 (581)
Q Consensus       351 ~~l~~~i~NyGiaIIllTilikli~~PLt~ks~~Sm~kM~~lqP~i~~i~ekyk~  405 (581)
                      .++...+..-.++++++.+++=++=++.+..+|.---||-+     +|+|+.||+
T Consensus       184 ~~~~~~~~~~~l~~~~~~liia~~D~~~qr~~~~k~lkMtK-----qEVKdE~K~  233 (363)
T COG1377         184 SIFMELLGKLLLAVLLLLLIVAAFDYFYQRFQYIKKLKMTK-----QEVKDEYKQ  233 (363)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH-----HHHHHHHHH
T ss_conf             99999999999999999999999999999999999666868-----999999861


No 34 
>PRK01294 lipase chaperone; Provisional
Probab=71.60  E-value=5.9  Score=18.10  Aligned_cols=18  Identities=22%  Similarity=0.495  Sum_probs=10.7

Q ss_pred             EEECCCCEEEEEEECCCC
Q ss_conf             997699559999953571
Q gi|254780483|r   81 SINLKGAQFDDLNLRGYH   98 (581)
Q Consensus        81 ~is~~GG~I~~~~LK~Y~   98 (581)
                      .+|..|.-|+...++++.
T Consensus        77 ~~Da~g~Li~~~~~R~~F   94 (339)
T PRK01294         77 ALDAQGHLVDTRALRDFF   94 (339)
T ss_pred             CCCCCCCEEECHHHHHHH
T ss_conf             417999975458899999


No 35 
>PRK13109 flhB flagellar biosynthesis protein FlhB; Reviewed
Probab=71.49  E-value=6.4  Score=17.85  Aligned_cols=31  Identities=16%  Similarity=0.311  Sum_probs=12.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             999998889999999999988877888999997314
Q gi|254780483|r  369 VFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK  404 (581)
Q Consensus       369 ilikli~~PLt~ks~~Sm~kM~~lqP~i~~i~ekyk  404 (581)
                      +++=++=++.+..+|..--||-+     +|+|+.||
T Consensus       204 ~via~~D~~~Qr~~~~k~lkMsk-----qEvK~E~K  234 (358)
T PRK13109        204 IVLVALDLVWARFHWRRSLRMTK-----QEIKDEHK  234 (358)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCH-----HHHHHHHH
T ss_conf             99999999999999998648999-----99999988


No 36 
>PRK08156 surface presentation of antigens protein SpaS; Validated
Probab=71.34  E-value=6.4  Score=17.83  Aligned_cols=39  Identities=15%  Similarity=0.302  Sum_probs=23.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             99999999999988899999999999888778889999973145
Q gi|254780483|r  362 IAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQ  405 (581)
Q Consensus       362 iaIIllTilikli~~PLt~ks~~Sm~kM~~lqP~i~~i~ekyk~  405 (581)
                      +.+++..++|=++=++.+..+|.---||-+     +|+|+.||+
T Consensus       183 ~~~~~~~~via~iD~~~Qr~~~~k~LrMSk-----qEVKdE~Ke  221 (367)
T PRK08156        183 LTFLACALIVLILDAIAEYFLYMKDMKMDK-----QEVKREYKE  221 (367)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCH-----HHHHHHHHH
T ss_conf             999999999999999999999999748998-----999999886


No 37 
>PRK12468 flhB flagellar biosynthesis protein FlhB; Reviewed
Probab=70.41  E-value=6.7  Score=17.69  Aligned_cols=30  Identities=13%  Similarity=0.208  Sum_probs=16.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             99988899999999999888778889999973145
Q gi|254780483|r  371 VKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQ  405 (581)
Q Consensus       371 ikli~~PLt~ks~~Sm~kM~~lqP~i~~i~ekyk~  405 (581)
                      +=++=++.+..+|.-.-||-+     +|+|+.||+
T Consensus       204 ia~iD~~~Qr~~~~k~LkMSK-----qEVKdE~Ke  233 (383)
T PRK12468        204 MVGFDVFYQITSHIKKLRMTK-----QDIRDEFKN  233 (383)
T ss_pred             HHHHHHHHHHHHHHHHCCCCH-----HHHHHHHHH
T ss_conf             999999999999998748999-----999999886


No 38 
>PRK00191 tatA twin arginine translocase protein A; Provisional
Probab=69.05  E-value=7.2  Score=17.49  Aligned_cols=65  Identities=25%  Similarity=0.407  Sum_probs=35.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHH-HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCHH
Q ss_conf             20163999999999999888----99999999999-8887788899999731451156789999999850487867
Q gi|254780483|r  357 VGNFGIAIMLTTVFVKLLFF----PLAKKQYVSTA-NMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPL  427 (581)
Q Consensus       357 i~NyGiaIIllTilikli~~----PLt~ks~~Sm~-kM~~lqP~i~~i~ekyk~d~~~~~~~e~m~ly~~~~vnP~  427 (581)
                      +|-|-++||++.++  ++|-    |=..   +|+. .||.++-|++|+++-=.. +.+..++-..+.|...-.||.
T Consensus         3 LGpweiiiI~vvvl--lLFGaKKLPdlA---RslGks~RifKsE~k~m~~d~~~-~~~~q~~~~~a~~~~~~~~p~   72 (107)
T PRK00191          3 LGPWEIGIIVLLII--VLFGAKKLPDAA---RSIGRSMRIFKSEVKEMNKDDDT-PEQQQQQQQIAAAQQQAPNPI   72 (107)
T ss_pred             CCHHHHHHHHHHHH--HHHCCCCCHHHH---HHHHHHHHHHHHHHHHHHHCCCC-CCCHHHCHHHHHHHHCCCCHH
T ss_conf             63799999999999--997653036999---98858999999999998734577-433222446765211278803


No 39 
>pfam02936 COX4 Cytochrome c oxidase subunit IV. Cytochrome c oxidase, a 13 sub-unit complex, EC:1.9.3.1 is the terminal oxidase in the mitochondrial electron transport chain. This family is composed of cytochrome c oxidase subunit IV. The Dictyostelium member of this family is called COX VI. The uncharacterized yeast protein YGL226W appears to be the yeast COX IV subunit.
Probab=66.25  E-value=5.4  Score=18.40  Aligned_cols=32  Identities=25%  Similarity=0.219  Sum_probs=25.5

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH
Q ss_conf             88778889999973145115678999999985
Q gi|254780483|r  389 MKNIQPKIDELREKFKQSPPQVLQKAMIQLYK  420 (581)
Q Consensus       389 M~~lqP~i~~i~ekyk~d~~~~~~~e~m~ly~  420 (581)
                      -|.+.|++++|+||-|.|=.+--.+|-.+||+
T Consensus        26 ~~e~t~~~~aLreKeKgdWk~LS~eEKkalYr   57 (143)
T pfam02936        26 FREQSELIMALREKEKGDWKSLSLEEKKALYR   57 (143)
T ss_pred             CHHCCHHHHHHHHHHCCCHHHCCHHHHHHHHH
T ss_conf             10131999999999519977769999999999


No 40 
>TIGR03513 GldL_gliding gliding motility-associated protein GldL. This protein family, GldL, is named for the member from Flavobacterium johnsoniae, which is required for a type of rapid gliding motility found in certain members of the Bacteriodetes. However, members are found also in several members of the Bacteriodetes that appear not to be motile
Probab=66.23  E-value=4.3  Score=19.08  Aligned_cols=26  Identities=23%  Similarity=0.723  Sum_probs=16.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999887632016399999999999988899
Q gi|254780483|r  349 LMSYFYNLVGNFGIAIMLTTVFVKLLFFPL  378 (581)
Q Consensus       349 ~L~~l~~~i~NyGiaIIllTilikli~~PL  378 (581)
                      +|+++|+    ||=||+|+--|.||.-||.
T Consensus         3 ~mn~~yg----~GAaVVIiGALFKI~H~~~   28 (202)
T TIGR03513         3 VMNIVYG----WGAAVVILGALFKIMHWPM   28 (202)
T ss_pred             HHHHHHH----CCHHHHHHHHHHHHHCCCC
T ss_conf             8999882----1429999999999928765


No 41 
>pfam00606 Glycoprotein_B Herpesvirus Glycoprotein B. This family of proteins contains a transmembrane region.
Probab=63.93  E-value=8.9  Score=16.80  Aligned_cols=34  Identities=26%  Similarity=0.468  Sum_probs=17.6

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             8678899999999999999999987698628875
Q gi|254780483|r  425 NPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF  458 (581)
Q Consensus       425 nP~~GClP~l~q~p~~~a~~~~~~~~ielr~~~f  458 (581)
                      ||+||.+=+|+=+-+.++.|.+++..-.|+++|.
T Consensus       663 NPfGg~~i~llv~~~v~~v~~~~rr~~~~~~~Pi  696 (711)
T pfam00606       663 NPFGGLLIILLVLAGLVAVFLAYRRVRRLRQNPI  696 (711)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCH
T ss_conf             9578899999999998543578999999885967


No 42 
>COG0676 Uncharacterized enzymes related to aldose 1-epimerase [Carbohydrate transport and metabolism]
Probab=63.81  E-value=8.9  Score=16.79  Aligned_cols=126  Identities=16%  Similarity=0.169  Sum_probs=65.7

Q ss_pred             CCCEEEEECCEEEEEEECCCCEEEEEEECCCCCCCCCCCCCEEEECCCCCCC-------CCEEEEECCCCCCCCCCCCC-
Q ss_conf             5872899766499999769955999995357134478877268854566655-------31000001347877543334-
Q gi|254780483|r   67 MSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN-------AYFAELDYVSTANNIELPNS-  138 (581)
Q Consensus        67 ~~~~I~Iend~l~i~is~~GG~I~~~~LK~Y~~~~~~ds~~v~Ll~~~~~~~-------~y~~~~G~~~~~~~~~~p~~-  138 (581)
                      ..+.+.+..+..++.|+..||.+.+++.+.-        ..+.=++++..-.       .-..-.-|.+.......|.+ 
T Consensus        23 ~~~~~~~~h~~~~a~islqGAqLLs~qP~ge--------~evLWLS~~~p~~~g~aIRGGIPICwPWFG~~~~~~~PaHG   94 (287)
T COG0676          23 QLPLIVVDHPLGSAAISLQGAQLLSWQPKGE--------EEVLWLSSNAPFKGGAAIRGGIPICWPWFGPLAQQGLPAHG   94 (287)
T ss_pred             CCCCEEEECCCCEEEEECCCCEEEEECCCCC--------CCEEEECCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCC
T ss_conf             3581676156413678627716987647999--------73588635676678875337774887554766788898621


Q ss_pred             ---CCCEECCCCCCCCCCCCCEEEEECCC---CEEEEEEEEECCCCEEEEEEEECCCCCCCCCCCCCEEE
Q ss_conf             ---32100156665666665047741588---42699999716883589998631576664222421012
Q gi|254780483|r  139 ---NTVWNLISGKILTPTTPIKLVFKNAN---NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRI  202 (581)
Q Consensus       139 ---~~~~~~~~~~~l~~~~~v~l~~~~~~---g~~i~kt~t~~~~Y~i~i~~~v~N~s~~~i~~~~~~~i  202 (581)
                         +..|++.......+...++|......   ...++-++.|.+.  .+++.+..|.++....+..|..+
T Consensus        95 ~AR~~~W~l~~~~~~~~~v~v~f~L~~~~~p~~~~lr~~~~~g~~--le~~l~~~~~~s~~~AlHtYF~V  162 (287)
T COG0676          95 FARNRPWKLLEHDEDEDGVRVTFGLDLEDEPHDFTLRLTFRFGET--LELELESYGEESFQAALHTYFRV  162 (287)
T ss_pred             HHHCCCEEEEEHHCCCCCEEEEEEECCCCCCCCEEEEEEEECCCE--EEEEEEECCHHHHHHHHCCEEEE
T ss_conf             011474043200102686399997278766651478887650224--89999744855788751110770


No 43 
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=62.01  E-value=7.5  Score=17.35  Aligned_cols=30  Identities=13%  Similarity=0.056  Sum_probs=12.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             399999999999988899999999999888
Q gi|254780483|r  361 GIAIMLTTVFVKLLFFPLAKKQYVSTANMK  390 (581)
Q Consensus       361 GiaIIllTilikli~~PLt~ks~~Sm~kM~  390 (581)
                      |..+|+..||.=+.+|-=+|.+-+--..++
T Consensus        22 Gk~li~gviLg~~~lfGW~ywq~~q~~q~~   51 (207)
T COG2976          22 GKALIVGVILGLGGLFGWRYWQSHQVEQAQ   51 (207)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             907899999999999988999998788888


No 44 
>TIGR00380 cobD cobalamin biosynthesis protein CobD; InterPro: IPR004485   Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt. Cobalamin is usually found in one of two biologically active forms: methylcobalamin and adocobalamin. Most prokaryotes, as well as animals, have cobalamin-dependent enzymes, whereas plants and fungi do not appear to use it. In bacteria and archaea, these include methionine synthase, ribonucleotide reductase, glutamate and methylmalonyl-CoA mutases, ethanolamine ammonia lyase, and diol dehydratase . In mammals, cobalamin is obtained through the diet, and is required for methionine synthase and methylmalonyl-CoA mutase .    There are at least two distinct cobalamin biosynthetic pathways in bacteria :  Aerobic pathway that requires oxygen and in which cobalt is inserted late in the pathway ; found in Pseudomonas denitrificans and Rhodobacter capsulatus. Anaerobic pathway in which cobalt insertion is the first committed step towards cobalamin synthesis ; found in Salmonella typhimurium, Bacillus megaterium, and Propionibacterium freudenreichii shermanii.     Either pathway can be divided into two parts: (1) corrin ring synthesis (differs in aerobic and anaerobic pathways) and (2) adenosylation of corrin ring, attachment of aminopropanol arm, and assembly of the nucleotide loop (common to both pathways) . There are about 30 enzymes involved in either pathway, where those involved in the aerobic pathway are prefixed Cob and those of the anaerobic pathway Cbi. Several of these enzymes are pathway-specific: CbiD, CbiG, and CbiK are specific to the anaerobic route of S. typhimurium, whereas CobE, CobF, CobG, CobN, CobS, CobT, and CobW are unique to the aerobic pathway of P. denitrificans.   This entry represents the CbiB protein, which is involved in cobalamin biosynthesis and porphyrin biosynthesis. It converts cobyric acid to cobinamide by the addition of aminopropanol on the F carboxylic group. It is part of the cob operon .; GO: 0009236 cobalamin biosynthetic process, 0016021 integral to membrane.
Probab=60.43  E-value=9.7  Score=16.52  Aligned_cols=48  Identities=13%  Similarity=0.309  Sum_probs=22.8

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHH----------------HH---HHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             999999985048786788999999999999999----------------99---9876986288753410000335
Q gi|254780483|r  412 QKAMIQLYKTHNINPLAGCWPILLQIPVFFAIY----------------KV---ISISLEMRHAPFWGWIKDLAAA  468 (581)
Q Consensus       412 ~~e~m~ly~~~~vnP~~GClP~l~q~p~~~a~~----------------~~---~~~~ielr~~~f~~Wi~dls~~  468 (581)
                      -.|..|==.||=|-        =+--|+|+|+-                ++   +-.+|==|.++. .|+-=+++.
T Consensus       143 ~sA~vESlaEN~vD--------gv~apLFY~llGilfGl~GPWPlA~~YravnTLDAMvGY~~~~Y-~~~GkfaAR  209 (322)
T TIGR00380       143 LSAAVESLAENIVD--------GVTAPLFYALLGILFGLPGPWPLAFVYRAVNTLDAMVGYKKEKY-EDLGKFAAR  209 (322)
T ss_pred             HHHHHHHHHHCHHH--------HHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCCCC-CCCCCCHHH
T ss_conf             77886553301133--------33789999999986478771479999999977532102467643-100430112


No 45 
>PTZ00243 ABC transporter; Provisional
Probab=59.49  E-value=11  Score=16.26  Aligned_cols=10  Identities=10%  Similarity=0.461  Sum_probs=4.9

Q ss_pred             HHHHHHCCCC
Q ss_conf             9999731451
Q gi|254780483|r  397 DELREKFKQS  406 (581)
Q Consensus       397 ~~i~ekyk~d  406 (581)
                      -.|-.|+-.|
T Consensus      1055 GRIlNRFS~D 1064 (1560)
T PTZ00243       1055 GRILNRFSRD 1064 (1560)
T ss_pred             HHHHHHHHHH
T ss_conf             7788886777


No 46 
>KOG0209 consensus
Probab=58.27  E-value=9.1  Score=16.74  Aligned_cols=29  Identities=17%  Similarity=0.052  Sum_probs=17.3

Q ss_pred             CHHHHH--HHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             327899--99999999999997513789887
Q gi|254780483|r    3 RNWNYF--VAIALSVIIVYAWQNFYVYPRIE   31 (581)
Q Consensus         3 ~nKn~i--Iai~Ls~~ill~w~~~~~~p~~e   31 (581)
                      +||-++  |.+.|.|+|.-.|..|......+
T Consensus       392 Nn~Etf~FILFLlVFAiaAa~Yvwv~Gskd~  422 (1160)
T KOG0209         392 NNRETFIFILFLLVFAIAAAGYVWVEGSKDP  422 (1160)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHEEEEECCCCC
T ss_conf             4277899999999999975205788424686


No 47 
>pfam09095 DUF1926 Domain of unknown function (DUF1926). Members of this family, which are found in a set of prokaryotic transferases, adopt a beta-sandwich fold, in which two layers of anti-parallel beta-sheets are arranged in a nearly parallel fashion. The exact function of this family is, as yet, unknown, however it has been proposed that they may play a role in transglycosylation reactions.
Probab=58.16  E-value=11  Score=16.11  Aligned_cols=28  Identities=18%  Similarity=0.294  Sum_probs=24.2

Q ss_pred             CEEEEECCEEEEEEECC-CCEEEEEEECC
Q ss_conf             72899766499999769-95599999535
Q gi|254780483|r   69 PRVELKNPSLIGSINLK-GAQFDDLNLRG   96 (581)
Q Consensus        69 ~~I~Iend~l~i~is~~-GG~I~~~~LK~   96 (581)
                      +.|-++|+.+.+.|.+. ||+|.++-.|.
T Consensus         8 ~Ev~l~~~~~~~~~~p~~GGsi~ElD~k~   36 (275)
T pfam09095         8 EEILLENESFNAYVKPDQGGSIFELDSKA   36 (275)
T ss_pred             EEEEEECCCEEEEEEECCCCEEEEEECCC
T ss_conf             01588768579999628885799982255


No 48 
>pfam05600 DUF773 Protein of unknown function (DUF773). This family contains several eukaryotic sequences which are thought to be CDK5 activator-binding proteins, however, the function of this family is unknown.
Probab=57.63  E-value=11  Score=16.04  Aligned_cols=40  Identities=20%  Similarity=0.429  Sum_probs=31.4

Q ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCHHH
Q ss_conf             88877888999997314511567899999998504878678
Q gi|254780483|r  388 NMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLA  428 (581)
Q Consensus       388 kM~~lqP~i~~i~ekyk~d~~~~~~~e~m~ly~~~~vnP~~  428 (581)
                      ..+.++|++++|.+|-|.=+ +...++.-+.|+...||=||
T Consensus       467 ~~~~~~pkl~~l~~~TreLq-k~iE~~iSk~y~~R~VnlmG  506 (506)
T pfam05600       467 EQSSLEPKLDLLIEKTRELQ-KLIEADISKRYNGRPVNLMG  506 (506)
T ss_pred             HHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHCCCCCCCCC
T ss_conf             99973079999999999999-99999999984898323479


No 49 
>TIGR02120 GspF general secretion pathway protein F; InterPro: IPR011850   This membrane protein is a component of the terminal branch complex of the general secretion pathway (GSP), also known as the "Type II" secretion pathway. The GSP transports proteins (generally virulence-associated cell wall hydrolases) across the outer membrase of the bacterial cell. Transport across the inner membrane is often, but not exclusively handled by the Sec system. GspF nearly always clusters with other GSP subunits. However, some genes from Xylella and Xanthomonas strains are excluded from this entry due to excessive divergence.; GO: 0008565 protein transporter activity, 0015628 protein secretion by the type II secretion system, 0015627 type II protein secretion system complex.
Probab=55.94  E-value=12  Score=15.85  Aligned_cols=49  Identities=16%  Similarity=0.356  Sum_probs=30.4

Q ss_pred             EEECHHHHHHHHHHCCCCCCHHHHHHHHCCHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             850002788763220146310123332011035689999-99998876320163999999999999888
Q gi|254780483|r  309 FAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMF-MLMSYFYNLVGNFGIAIMLTTVFVKLLFF  376 (581)
Q Consensus       309 Y~GPk~~~~L~~~~~~l~~~~l~~~vd~Gwf~~i~kplf-~~L~~l~~~i~NyGiaIIllTilikli~~  376 (581)
                      |+=||-.+.-+.....|                   |+. .+|=.+.+|+.+|||+|++--.++=.++.
T Consensus       201 ~VVPkvV~~F~~~~q~L-------------------Pl~Tr~li~lSdFl~~~G~~~~~~~~~~~~l~~  250 (414)
T TIGR02120       201 YVVPKVVEQFAHMKQTL-------------------PLLTRALIALSDFLRSWGWALLAALAALVVLFR  250 (414)
T ss_pred             HHCCCEECHHHCCCCCC-------------------CHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             20444031023199787-------------------489999998451688899999999999999999


No 50 
>KOG2295 consensus
Probab=55.69  E-value=11  Score=16.24  Aligned_cols=59  Identities=19%  Similarity=0.370  Sum_probs=38.8

Q ss_pred             HHHHHHHHHHHCCCCHHHH----HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             7888999997314511567----89999999850487867889999999999999999998769862887
Q gi|254780483|r  392 IQPKIDELREKFKQSPPQV----LQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAP  457 (581)
Q Consensus       392 lqP~i~~i~ekyk~d~~~~----~~~e~m~ly~~~~vnP~~GClP~l~q~p~~~a~~~~~~~~ielr~~~  457 (581)
                      +-++-.|+++|-+.|..+.    .+.-+|+||+..=--|++||--.+ --|=|+      +.-|.+.|+.
T Consensus       475 ~~lee~eakkkg~k~~e~eve~~v~s~t~e~~kdKy~C~lsgc~KlF-~gpEFv------rKHi~~KH~d  537 (648)
T KOG2295         475 LELEEEEAKKKGAKDVEDEVENFVDSNTMELDKDKYLCPLSGCAKLF-KGPEFV------RKHINKKHKD  537 (648)
T ss_pred             CCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHC-CCHHHH------HHHHHHHHHH
T ss_conf             55018999975146788899999888788752202057775267541-378999------9998877789


No 51 
>cd00922 Cyt_c_Oxidase_IV Cytochrome c oxidase subunit IV. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Found only in eukaryotes, subunit IV is the largest of the nuclear-encoded subunits. It binds ATP at the matrix side, leading to an allosteric inhibition of enzyme activity at high intramitochondrial ATP/ADP ratios. In mammals, subunit IV has a lung-specific isoform and a ubiquitously expressed isoform.
Probab=55.34  E-value=9  Score=16.75  Aligned_cols=31  Identities=29%  Similarity=0.376  Sum_probs=23.5

Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH
Q ss_conf             8778889999973145115678999999985
Q gi|254780483|r  390 KNIQPKIDELREKFKQSPPQVLQKAMIQLYK  420 (581)
Q Consensus       390 ~~lqP~i~~i~ekyk~d~~~~~~~e~m~ly~  420 (581)
                      +++.|++++|+||-|.|=.+--.+|-.+||+
T Consensus        27 ~e~t~~~~aLrekeKgdWk~LT~eEKkalYr   57 (136)
T cd00922          27 RELSAEIKALREKEKGDWKQLTLEEKKALYR   57 (136)
T ss_pred             CCCCHHHHHHHHHHCCCHHHCCHHHHHHHHH
T ss_conf             0089889999998529966669999999999


No 52 
>TIGR00328 flhB flagellar biosynthetic protein FlhB; InterPro: IPR006136   The flhB and flhA genes constitute an operon called flhB operon on the Salmonella typhimurium chromosome. They, together with FliI and FliH, may constitute the export apparatus of flagellin, the component protein of flagellar filament. The flhB gene encodes a highly hydrophobic polypeptide with several potential membrane-spanning segments, suggesting that it may be an integral membrane protein .; GO: 0009306 protein secretion, 0016020 membrane.
Probab=54.87  E-value=12  Score=15.73  Aligned_cols=13  Identities=8%  Similarity=0.079  Sum_probs=5.2

Q ss_pred             CCCCCCCCHHHHH
Q ss_conf             0000335725666
Q gi|254780483|r  462 IKDLAAADPTNIF  474 (581)
Q Consensus       462 i~dls~~d~~~~~  474 (581)
                      +.+|+..++-..+
T Consensus       169 ~~~L~~~~~~~~~  181 (352)
T TIGR00328       169 LLSLSLYSLQQAL  181 (352)
T ss_pred             HHHHHHCCHHHHH
T ss_conf             9988614888999


No 53 
>PRK00575 tatA twin arginine translocase protein A; Provisional
Probab=54.64  E-value=13  Score=15.71  Aligned_cols=47  Identities=21%  Similarity=0.249  Sum_probs=24.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH-HHHHH-HHHHHHHHHHHHHHHHCCCC
Q ss_conf             016399999999999988899999-99999-98887788899999731451
Q gi|254780483|r  358 GNFGIAIMLTTVFVKLLFFPLAKK-QYVST-ANMKNIQPKIDELREKFKQS  406 (581)
Q Consensus       358 ~NyGiaIIllTilikli~~PLt~k-s~~Sm-~kM~~lqP~i~~i~ekyk~d  406 (581)
                      +-|-|+||++.+++  +|-+=-.- -.+|. +-||..+.+++|.++..|.+
T Consensus         5 ~~w~~~ii~~vv~l--lFG~kkLp~~arslG~s~r~fK~~~~e~~~e~~~~   53 (88)
T PRK00575          5 SPWHWAILAVVVIV--LFGAKKLPDAARSLGKSMRIFKSEVREMQNENKAE   53 (88)
T ss_pred             CHHHHHHHHHHHHH--HHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             17999999999999--96754016899999999999999998755100012


No 54 
>PRK05702 flhB flagellar biosynthesis protein FlhB; Reviewed
Probab=53.82  E-value=13  Score=15.62  Aligned_cols=50  Identities=20%  Similarity=0.406  Sum_probs=25.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             9887632016399999999999988899999999999888778889999973145
Q gi|254780483|r  351 SYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQ  405 (581)
Q Consensus       351 ~~l~~~i~NyGiaIIllTilikli~~PLt~ks~~Sm~kM~~lqP~i~~i~ekyk~  405 (581)
                      ..+.+.+..-.+.+++.-++|=++=|+.+...|.---||-+     +|+|+.||+
T Consensus       184 ~~~~~~~~~l~~~~~~~~~via~~D~~~qr~~~~k~lkMSk-----qEvKdE~K~  233 (352)
T PRK05702        184 GHALDLVLKLLLLVVLALLVIAAIDVPFQRWQYLKKLKMTK-----QEVKDEYKQ  233 (352)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH-----HHHHHHHHH
T ss_conf             99999999999999999999999999999999998838999-----999999986


No 55 
>pfam07014 Hs1pro-1_C Hs1pro-1 protein C-terminus. This family represents the C-terminus (approximately 270 residues) of a number of plant Hs1pro-1 proteins, which are believed to confer nematode resistance.
Probab=53.47  E-value=7.5  Score=17.34  Aligned_cols=14  Identities=29%  Similarity=0.615  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHHCC
Q ss_conf             78999999985048
Q gi|254780483|r  410 VLQKAMIQLYKTHN  423 (581)
Q Consensus       410 ~~~~e~m~ly~~~~  423 (581)
                      ++|.+.|+||++.+
T Consensus       168 riqEAaMkLy~~k~  181 (261)
T pfam07014       168 RIQEAAMKLYRRKT  181 (261)
T ss_pred             HHHHHHHHHHHHCC
T ss_conf             69999999998236


No 56 
>COG0646 MetH Methionine synthase I (cobalamin-dependent), methyltransferase domain [Amino acid transport and metabolism]
Probab=52.51  E-value=3.6  Score=19.67  Aligned_cols=37  Identities=19%  Similarity=0.449  Sum_probs=27.5

Q ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCHHHHHH
Q ss_conf             88999997314511567899999998504878678899
Q gi|254780483|r  394 PKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCW  431 (581)
Q Consensus       394 P~i~~i~ekyk~d~~~~~~~e~m~ly~~~~vnP~~GCl  431 (581)
                      |+...=+..|-++| +.+.+.++.+.++-+||-+|||-
T Consensus       259 P~~~g~~~~Y~~~p-~~~a~~~~~f~~~g~vnIvGGCC  295 (311)
T COG0646         259 PNAFGERAVYDLTP-EYMAEALAEFAEEGGVNIVGGCC  295 (311)
T ss_pred             CCCCCCCCCCCCCH-HHHHHHHHHHHHHCCCEEECCCC
T ss_conf             75468845268998-99999999999837841604436


No 57 
>PRK13665 hypothetical protein; Provisional
Probab=52.19  E-value=12  Score=15.83  Aligned_cols=16  Identities=19%  Similarity=0.503  Sum_probs=6.7

Q ss_pred             HHHHHHHHHHHHHHCC
Q ss_conf             8877888999997314
Q gi|254780483|r  389 MKNIQPKIDELREKFK  404 (581)
Q Consensus       389 M~~lqP~i~~i~ekyk  404 (581)
                      -|+++-+.+|.|.|-=
T Consensus       261 EQEm~A~~qe~rAkvV  276 (327)
T PRK13665        261 EQEMKARVQEMRAKVV  276 (327)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999766731


No 58 
>pfam11694 DUF3290 Protein of unknown function (DUF3290). This family of proteins with unknown function appears to be restricted to Firmicutes.
Probab=51.57  E-value=11  Score=16.26  Aligned_cols=22  Identities=9%  Similarity=-0.005  Sum_probs=11.5

Q ss_pred             CCCCEEEEECCEEEEEEECCCC
Q ss_conf             4587289976649999976995
Q gi|254780483|r   66 SMSPRVELKNPSLIGSINLKGA   87 (581)
Q Consensus        66 ~~~~~I~Iend~l~i~is~~GG   87 (581)
                      ..+-.|.++...+++.+++.|-
T Consensus       107 ~dG~iVki~~~~Yrv~~n~d~~  128 (149)
T pfam11694       107 TDGMIVKIGKNYYRVNLNTDNN  128 (149)
T ss_pred             CCCEEEEECCEEEEEEECCCCC
T ss_conf             5776999878279999879987


No 59 
>PRK06298 type III secretion system protein; Validated
Probab=51.32  E-value=14  Score=15.34  Aligned_cols=16  Identities=13%  Similarity=0.264  Sum_probs=5.9

Q ss_pred             HHHHHHHHHHHHHHHH
Q ss_conf             8889999999999988
Q gi|254780483|r  374 LFFPLAKKQYVSTANM  389 (581)
Q Consensus       374 i~~PLt~ks~~Sm~kM  389 (581)
                      +=|+.+...|..--||
T Consensus       201 ~D~~~qr~~~~k~LkM  216 (360)
T PRK06298        201 LDLVYQRHNFAKELKM  216 (360)
T ss_pred             HHHHHHHHHHHHHHCC
T ss_conf             9999999999987079


No 60 
>KOG4075 consensus
Probab=49.65  E-value=13  Score=15.63  Aligned_cols=34  Identities=26%  Similarity=0.369  Sum_probs=24.0

Q ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH
Q ss_conf             9888778889999973145115678999999985
Q gi|254780483|r  387 ANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYK  420 (581)
Q Consensus       387 ~kM~~lqP~i~~i~ekyk~d~~~~~~~e~m~ly~  420 (581)
                      ..-+++++++++|+||=|.|=.+.-.+|--+||+
T Consensus        49 ~~~~e~~~~~~aL~eKek~~Wk~LS~~EKkalYr   82 (167)
T KOG4075          49 IRFRELSAEIKALREKEKAPWKQLSTEEKKALYR   82 (167)
T ss_pred             HHHHCCCHHHHHHHHHHCCCHHHCCHHHHHHHHH
T ss_conf             5430301777778887508843338798889999


No 61 
>TIGR00699 GABAtrns_euk 4-aminobutyrate aminotransferase; InterPro: IPR004631 4-aminobutyrate aminotransferase eukaryotic (2.6.1.19 from EC) is a class III pyridoxal-phosphate-dependent aminotransferase. The enzyme catalyses the conversion of 4-aminobutanoate and 2-oxoglutarate into succinate semialdehyde and L-glutamate. The degree of sequence difference between this set and known bacterial examples is greater than the distance between either set the most similar enzyme with distinct function, and so the prokaryotic and eukaryotic sets have been placed into separate families. This family describes known eukaryotic examples of the enzyme. Alternate names include GABA transaminase, gamma-amino-N-butyrate transaminase, and beta-alanine--oxoglutarate aminotransferase.; GO: 0003867 4-aminobutyrate transaminase activity, 0009448 gamma-aminobutyric acid metabolic process.
Probab=47.73  E-value=12  Score=15.79  Aligned_cols=41  Identities=15%  Similarity=0.490  Sum_probs=27.1

Q ss_pred             HHHHHHHHHHHHHCCC-----------------CHHHHHHHHHHHHHHHCCCCHHHHHH
Q ss_conf             8778889999973145-----------------11567899999998504878678899
Q gi|254780483|r  390 KNIQPKIDELREKFKQ-----------------SPPQVLQKAMIQLYKTHNINPLAGCW  431 (581)
Q Consensus       390 ~~lqP~i~~i~ekyk~-----------------d~~~~~~~e~m~ly~~~~vnP~~GCl  431 (581)
                      .-|=-.+++|++||-+                 -|..+..-+...--|-+||| +|||=
T Consensus       384 d~Ly~GLe~L~~~YP~~~~nlRGKGrGTFiawD~p~~a~Rd~l~~~~r~~Gvn-~GGcG  441 (469)
T TIGR00699       384 DYLYTGLEDLQKKYPEKVQNLRGKGRGTFIAWDTPDEAKRDKLLLKARLNGVN-IGGCG  441 (469)
T ss_pred             HHHHHHHHHHHHHCCHHHHCCCCCCCCCEEECCCCCHHHHHHHHHHHCCCCEE-ECCCC
T ss_conf             78899899999750134403446764215740498878889999962238257-62653


No 62 
>KOG3021 consensus
Probab=46.55  E-value=17  Score=14.84  Aligned_cols=37  Identities=27%  Similarity=0.560  Sum_probs=24.4

Q ss_pred             HHHHHHHHHHHHHCCCCHH----HHHHHHHHHHHHHCCCCH
Q ss_conf             8778889999973145115----678999999985048786
Q gi|254780483|r  390 KNIQPKIDELREKFKQSPP----QVLQKAMIQLYKTHNINP  426 (581)
Q Consensus       390 ~~lqP~i~~i~ekyk~d~~----~~~~~e~m~ly~~~~vnP  426 (581)
                      +.|||+|+-+.+.|+|-..    ..+|+.|-.|++---|-|
T Consensus       170 hRlq~Qldl~~~~~~Dre~~el~~~L~~kia~Lf~~~eI~P  210 (313)
T KOG3021         170 HRLQPQLDLLEKTYGDREAFELWSILQTKIADLFKCLEILP  210 (313)
T ss_pred             HHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCEEEH
T ss_conf             75327888998862539999999999986378754644423


No 63 
>KOG3958 consensus
Probab=45.88  E-value=17  Score=14.77  Aligned_cols=53  Identities=28%  Similarity=0.427  Sum_probs=41.3

Q ss_pred             HHHHHHHHHHHHHHHHCCCC-HHHHHHHHHHHHHHH-CCCCHHHHHHHHHHHHHH
Q ss_conf             98887788899999731451-156789999999850-487867889999999999
Q gi|254780483|r  387 ANMKNIQPKIDELREKFKQS-PPQVLQKAMIQLYKT-HNINPLAGCWPILLQIPV  439 (581)
Q Consensus       387 ~kM~~lqP~i~~i~ekyk~d-~~~~~~~e~m~ly~~-~~vnP~~GClP~l~q~p~  439 (581)
                      ++.+-+--+|++|-||+++. .-...++..-+||-- .+-.|....||-++|--+
T Consensus       250 qRL~s~lgK~~~IaEk~~~s~~Da~~d~KV~elye~~qrw~pi~stLP~~V~rl~  304 (371)
T KOG3958         250 QRLQSVLGKVNEIAEKHKASVEDADTDSKVHELYETIQRWSPIASTLPELVQRLV  304 (371)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999889999876016511112566699999999864058776299999999


No 64 
>PTZ00234 variable surface protein Vir12; Provisional
Probab=44.13  E-value=18  Score=14.58  Aligned_cols=13  Identities=0%  Similarity=-0.074  Sum_probs=4.9

Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             9999998787999
Q gi|254780483|r  526 VFVFALSSFPAGL  538 (581)
Q Consensus       526 ~~~~~~~~~~~gl  538 (581)
                      ||++|++++.|||
T Consensus       377 IfFLFYYN~SS~l  389 (433)
T PTZ00234        377 LVFLFFFFKSTPI  389 (433)
T ss_pred             HHHHHHEECCCCC
T ss_conf             9998630036664


No 65 
>pfam07748 Glyco_hydro_38C Glycosyl hydrolases family 38 C-terminal domain. Glycosyl hydrolases are key enzymes of carbohydrate metabolism.
Probab=42.89  E-value=19  Score=14.45  Aligned_cols=30  Identities=13%  Similarity=0.009  Sum_probs=24.6

Q ss_pred             CEEEEECCEEEEEEECCCCEEEEEEECCCCC
Q ss_conf             7289976649999976995599999535713
Q gi|254780483|r   69 PRVELKNPSLIGSINLKGAQFDDLNLRGYHL   99 (581)
Q Consensus        69 ~~I~Iend~l~i~is~~GG~I~~~~LK~Y~~   99 (581)
                      ..+++||+.++++|+.. |.|.++.-|+-..
T Consensus        31 ~~~~lEN~~~rv~~~~~-G~i~Si~dK~~~r   60 (379)
T pfam07748        31 ESVILENGFLKVEFDPT-GLLKSIYDKENGR   60 (379)
T ss_pred             CCEEEECCCEEEEECCC-CCEEEEEECCCCC
T ss_conf             99998798299999999-9899999946797


No 66 
>PRK10893 hypothetical protein; Provisional
Probab=42.67  E-value=19  Score=14.43  Aligned_cols=23  Identities=13%  Similarity=0.638  Sum_probs=16.1

Q ss_pred             CCCHHHH-HHHHHHHHHHHHHHHH
Q ss_conf             9732789-9999999999999975
Q gi|254780483|r    1 MERNWNY-FVAIALSVIIVYAWQN   23 (581)
Q Consensus         1 Md~nKn~-iIai~Ls~~ill~w~~   23 (581)
                      |..-||= .|.+++++++|+||++
T Consensus         1 ~~~~~~w~~~~l~~~a~~l~~w~~   24 (190)
T PRK10893          1 MSKTRRWVIIVLSLAALVLIGWNM   24 (190)
T ss_pred             CCHHHHHHHHHHHHHHHHHHEEEE
T ss_conf             952577999999999999850551


No 67 
>KOG4847 consensus
Probab=42.56  E-value=19  Score=14.41  Aligned_cols=39  Identities=23%  Similarity=0.404  Sum_probs=27.0

Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHH
Q ss_conf             877888999997314511567899999998504878678899999
Q gi|254780483|r  390 KNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPIL  434 (581)
Q Consensus       390 ~~lqP~i~~i~ekyk~d~~~~~~~e~m~ly~~~~vnP~~GClP~l  434 (581)
                      ++||||++-+-+.-|.  +.+||.|.    +|+|+.|.|-.||-.
T Consensus       360 kklq~ei~ialaq~ke--mAkMqVe~----~K~n~~pV~dllp~m  398 (483)
T KOG4847         360 KKLQPEIQIALAQIKE--MAKMQVEI----CKKNMEPVGDLLPEM  398 (483)
T ss_pred             HHCCHHHHHHHHHHHH--HHHHHHHH----HHCCCCHHHHHHHHC
T ss_conf             6405679999988688--88878999----972887189876512


No 68 
>PRK11462 putative transporter; Provisional
Probab=42.51  E-value=19  Score=14.41  Aligned_cols=30  Identities=0%  Similarity=0.082  Sum_probs=13.6

Q ss_pred             HHHHHHHHHHHHHCCCCCCHHHHHHHHHHC
Q ss_conf             999999999987479983479898888520
Q gi|254780483|r  547 VISIVQQAVIMKMHGAEIGLIDRLRSTFSK  576 (581)
Q Consensus       547 ~~~~~qq~~i~~~~~~~~~~~~~~~~~~~~  576 (581)
                      ++-++=-.++.|...-.++..+.|++.+++
T Consensus       415 i~~ll~~ii~~~~Y~L~~~~~~eI~~eL~~  444 (460)
T PRK11462        415 ICYLLSAIIAKRYYSLTTHNLKTVMEQLAQ  444 (460)
T ss_pred             HHHHHHHHHHHHEECCCHHHHHHHHHHHHH
T ss_conf             999999999995235989999999999999


No 69 
>pfam06045 Rhamnogal_lyase Rhamnogalacturonate lyase family. Rhamnogalacturonate lyase (EC:4.2.2.-) degrades the rhamnogalacturonan I (RG-I) backbone of pectin. This family contains mainly members from plants, but also contains the plant pathogen Erwinia chrysanthemi.
Probab=41.15  E-value=20  Score=14.26  Aligned_cols=30  Identities=13%  Similarity=0.184  Sum_probs=25.6

Q ss_pred             CCCEEEEECCEEEEEEECCCCEEEEEEECC
Q ss_conf             587289976649999976995599999535
Q gi|254780483|r   67 MSPRVELKNPSLIGSINLKGAQFDDLNLRG   96 (581)
Q Consensus        67 ~~~~I~Iend~l~i~is~~GG~I~~~~LK~   96 (581)
                      .+..|.++|..+.+++|+-||.|..++-+.
T Consensus         6 ~~~~VvlDNGivqvTls~p~g~vtgikynG   35 (194)
T pfam06045         6 PGLNVVVDNGIVQVTLSNPGGAITGIRYNG   35 (194)
T ss_pred             CCCEEEEECCEEEEEECCCCCCEEEEEECC
T ss_conf             788799978879999769985289999868


No 70 
>PRK02919 oxaloacetate decarboxylase subunit gamma; Provisional
Probab=41.04  E-value=20  Score=14.25  Aligned_cols=12  Identities=8%  Similarity=0.423  Sum_probs=7.0

Q ss_pred             HHHHHHHHHHHH
Q ss_conf             999999999999
Q gi|254780483|r   10 AIALSVIIVYAW   21 (581)
Q Consensus        10 ai~Ls~~ill~w   21 (581)
                      |+++.|++++.|
T Consensus        19 G~Vf~FL~lLV~   30 (82)
T PRK02919         19 GFVLAFLFLLIF   30 (82)
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999999


No 71 
>TIGR02830 spore_III_AG stage III sporulation protein AG; InterPro: IPR014195    This entry represents the stage III sporulation protein AG, which is encoded in a spore formation operon: spoIIIAABCDEFGH under the control of sigma G . A comparative genome analysis of all sequenced genomes of Firmicutes shows that the proteins are strictly conserved among the sub-set of endospore-forming species..
Probab=39.53  E-value=21  Score=14.09  Aligned_cols=26  Identities=15%  Similarity=0.309  Sum_probs=18.7

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             99999999999999975137898876
Q gi|254780483|r    7 YFVAIALSVIIVYAWQNFYVYPRIEE   32 (581)
Q Consensus         7 ~iIai~Ls~~ill~w~~~~~~p~~e~   32 (581)
                      .|+-++|++++||.|.-||.++....
T Consensus         5 ~l~~L~liG~~ll~~s~~F~~~~~~~   30 (193)
T TIGR02830         5 YLLVLLLIGLLLLLVSSFFSSSEDIE   30 (193)
T ss_pred             CEEHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             14424789999999987617856633


No 72 
>KOG1604 consensus
Probab=37.74  E-value=22  Score=13.90  Aligned_cols=33  Identities=21%  Similarity=0.077  Sum_probs=28.6

Q ss_pred             CCCCCEEEEECCE-EEEEEECCCCEEEEEEECCC
Q ss_conf             1458728997664-99999769955999995357
Q gi|254780483|r   65 LSMSPRVELKNPS-LIGSINLKGAQFDDLNLRGY   97 (581)
Q Consensus        65 ~~~~~~I~Iend~-l~i~is~~GG~I~~~~LK~Y   97 (581)
                      ....+++++.|.. +.++|.+.|+.|.++.+.+-
T Consensus        17 ~~~~~~~tl~n~~~l~vti~~~GATi~sL~vpd~   50 (353)
T KOG1604          17 KQTIRVYTLGNGKGLQVTIINLGATITSLKVPDK   50 (353)
T ss_pred             CCCEEEEEECCCCEEEEEEEECCCEEEEEECCCC
T ss_conf             3725899953797468999617848899872786


No 73 
>PRK06531 yajC preprotein translocase subunit YajC; Validated
Probab=36.87  E-value=23  Score=13.81  Aligned_cols=14  Identities=7%  Similarity=0.145  Sum_probs=5.8

Q ss_pred             EEEEECCEEEEEEE
Q ss_conf             28997664999997
Q gi|254780483|r   70 RVELKNPSLIGSIN   83 (581)
Q Consensus        70 ~I~Iend~l~i~is   83 (581)
                      ++.++.|-+.++|+
T Consensus        62 tV~Ld~~Gv~l~f~   75 (120)
T PRK06531         62 KIVLDVDGVYLTFE   75 (120)
T ss_pred             EEEEEECCEEEEEE
T ss_conf             89998289799998


No 74 
>PRK03411 consensus
Probab=34.94  E-value=17  Score=14.82  Aligned_cols=13  Identities=15%  Similarity=0.028  Sum_probs=4.8

Q ss_pred             EEECHHHHHHHHH
Q ss_conf             8500027887632
Q gi|254780483|r  309 FAGAKEFPTIHHY  321 (581)
Q Consensus       309 Y~GPk~~~~L~~~  321 (581)
                      ++-+..-+.++.|
T Consensus       126 ~fr~ls~~eI~~Y  138 (194)
T PRK03411        126 HFRHLSEAEIDGY  138 (194)
T ss_pred             EECCCCHHHHHHH
T ss_conf             5037999999999


No 75 
>COG2017 GalM Galactose mutarotase and related enzymes [Carbohydrate transport and metabolism]
Probab=34.91  E-value=24  Score=13.59  Aligned_cols=122  Identities=17%  Similarity=0.269  Sum_probs=60.1

Q ss_pred             CCCEEEEECC-EEEEEEECCCCEEEEEEECCCCCCCCCCCCCEEEECC-CC--CCCCCE-EEEE----------CCCCCC
Q ss_conf             5872899766-4999997699559999953571344788772688545-66--655310-0000----------134787
Q gi|254780483|r   67 MSPRVELKNP-SLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSP-SN--TKNAYF-AELD----------YVSTAN  131 (581)
Q Consensus        67 ~~~~I~Iend-~l~i~is~~GG~I~~~~LK~Y~~~~~~ds~~v~Ll~~-~~--~~~~y~-~~~G----------~~~~~~  131 (581)
                      ....++++|. ...+++-..||.|.+++.+.        .+.+....+ +.  ....|. +..|          +...+.
T Consensus        11 ~~~~i~~~~~~~~~~~~~~~GA~l~~l~~~~--------~~v~l~~~~~~~~~~~~~~~ga~l~p~anRI~~g~f~~~G~   82 (308)
T COG2017          11 PVRLLTLGNGGGMVVTVPDWGATLTSLRVNG--------RNLLLGFDDAESYPATRGYGGAILGPYANRISNGRFTLDGK   82 (308)
T ss_pred             CEEEEEECCCCEEEEEECCCCCEEEEEEECC--------CCEEEECCCCCCCCCCCCCCCCEECCCCCEECCCEEEECCE
T ss_conf             2479995699879999825895899989879--------43677546421122346656647706167440998989998


Q ss_pred             CCCCC-------CC----CCCEECCCCCCCCCCCCCEEEEECC-----CCEEEEEEEEECCCCEEEEEEEECCCC--CCC
Q ss_conf             75433-------34----3210015666566666504774158-----842699999716883589998631576--664
Q gi|254780483|r  132 NIELP-------NS----NTVWNLISGKILTPTTPIKLVFKNA-----NNILFERTISLDEHYLFKIVDTVTNNS--IDQ  193 (581)
Q Consensus       132 ~~~~p-------~~----~~~~~~~~~~~l~~~~~v~l~~~~~-----~g~~i~kt~t~~~~Y~i~i~~~v~N~s--~~~  193 (581)
                      ..+++       .|    .-.|++..... .++..++++...+     ..+.++-+|+++++- +.++++++|.+  ..+
T Consensus        83 ~y~L~~N~~~~~lHG~~~~~~~~v~~~~~-~~~~~~~l~~~~~~~gyP~~l~~~vtY~L~~~~-L~v~~~~~n~~~~~~p  160 (308)
T COG2017          83 TYQLPPNEGGNALHGGARDFDWQVWEAEE-DDNAEFSLVLRDGEDGYPGNLEATVTYTLNEDG-LTVTYEVTNDGDEPTP  160 (308)
T ss_pred             EEECCCCCCCCCCCCCCCCCCCEEEEEEC-CCCCEEEEEECCCCCCCCEEEEEEEEEEECCCC-EEEEEEEEECCCCCEE
T ss_conf             98757678877776751378728898762-458579999457788998348999999985897-8999999928986402


Q ss_pred             CCCCC
Q ss_conf             22242
Q gi|254780483|r  194 IRFSP  198 (581)
Q Consensus       194 i~~~~  198 (581)
                      +.+..
T Consensus       161 ~~~g~  165 (308)
T COG2017         161 FNLGN  165 (308)
T ss_pred             EECCC
T ss_conf             55233


No 76 
>pfam09451 ATG27 Autophagy-related protein 27.
Probab=34.80  E-value=24  Score=13.68  Aligned_cols=13  Identities=31%  Similarity=0.843  Sum_probs=8.5

Q ss_pred             HHHHCCHHHHHHH
Q ss_conf             3320110356899
Q gi|254780483|r  333 LIDWGWFYFIAKP  345 (581)
Q Consensus       333 ~vd~Gwf~~i~kp  345 (581)
                      .=-||||.||---
T Consensus       194 s~~wG~FTWlfi~  206 (265)
T pfam09451       194 SGSWGWFTWLFIY  206 (265)
T ss_pred             CCCCCHHHHHHHH
T ss_conf             8886503568799


No 77 
>TIGR00263 trpB tryptophan synthase, beta subunit; InterPro: IPR006654   Tryptophan synthase catalyzes the last step in the biosynthesis of tryptophan , :  L-serine + 1-(indol-3-yl)glycerol 3-phosphate = L-tryptophan + glyceraldehyde 3-phosphate + H_2O  It has two functional domains, each found in bacteria and plants on a separate subunit: alpha chain (IPR002028 from INTERPRO) is for the aldol cleavage of indoleglycerol phosphate to indole and glyceraldehyde 3-phosphate and beta chain is for the synthesis of tryptophan from indole and serine. In fungi the two domains are fused together on a single multifunctional protein .   The beta chain of the enzyme, represented here, requires pyridoxal-phosphate as a cofactor. The pyridoxal-phosphate group is attached to a lysine residue. The region around this lysine residue also contains two histidine residues which are part of the pyridoxal-phosphate binding site.; GO: 0004834 tryptophan synthase activity, 0006568 tryptophan metabolic process.
Probab=32.63  E-value=26  Score=13.34  Aligned_cols=10  Identities=30%  Similarity=0.415  Sum_probs=5.1

Q ss_pred             CCEEEECCCC
Q ss_conf             7268854566
Q gi|254780483|r  106 PIVTLLSPSN  115 (581)
Q Consensus       106 ~~v~Ll~~~~  115 (581)
                      |-|.|+.-+.
T Consensus       263 PDV~LiGVEA  272 (412)
T TIGR00263       263 PDVELIGVEA  272 (412)
T ss_pred             CCCEEEEEEC
T ss_conf             8605898733


No 78 
>PRK03598 hypothetical protein; Provisional
Probab=32.61  E-value=27  Score=13.34  Aligned_cols=31  Identities=13%  Similarity=0.207  Sum_probs=19.5

Q ss_pred             EEEEECC-CCEEEEEEECCCCCCCCCCCCCEEE
Q ss_conf             9999769-9559999953571344788772688
Q gi|254780483|r   79 IGSINLK-GAQFDDLNLRGYHLDVSSNSPIVTL  110 (581)
Q Consensus        79 ~i~is~~-GG~I~~~~LK~Y~~~~~~ds~~v~L  110 (581)
                      ++.++++ +|+|.++..++- +...++..+..|
T Consensus        43 ~V~vs~~v~G~V~~v~V~eG-d~Vk~Gq~La~L   74 (331)
T PRK03598         43 TVNLSFRVGGRLASLAVDEG-DAVKAGQVLGEL   74 (331)
T ss_pred             EEEECCCCCEEEEEEECCCC-CEECCCCEEEEE
T ss_conf             99991327759999986897-987799889998


No 79 
>KOG2639 consensus
Probab=31.73  E-value=27  Score=13.24  Aligned_cols=79  Identities=16%  Similarity=0.254  Sum_probs=49.4

Q ss_pred             HHHHHHHHHHHHHHHHHHCCC-CHHHHHHHHHHHHHHHCCCCH---HHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCCC
Q ss_conf             999888778889999973145-115678999999985048786---7889999999999999999998769862-88753
Q gi|254780483|r  385 STANMKNIQPKIDELREKFKQ-SPPQVLQKAMIQLYKTHNINP---LAGCWPILLQIPVFFAIYKVISISLEMR-HAPFW  459 (581)
Q Consensus       385 Sm~kM~~lqP~i~~i~ekyk~-d~~~~~~~e~m~ly~~~~vnP---~~GClP~l~q~p~~~a~~~~~~~~ielr-~~~f~  459 (581)
                      +++|.|.+.-++.+=+-+.++ .+.....+-.-+|-++|.+|-   +--|+-.|    .|.++|.++.+...++ |.+- 
T Consensus       423 ~~~~i~~r~~~lr~r~~~~~~~~~a~~y~~tl~~l~~~~~irnk~ll~k~~~aL----~fviv~F~l~svp~~~~gl~L-  497 (685)
T KOG2639         423 LSAKIRARARSLRERLPTSCNSNPAENYFNTLAELQAKNRIRNKTLLIKCLRAL----WFVIVCFFLQSVPSLHMGLSL-  497 (685)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHH----HHHHHHHHHHCCHHHHCCCCC-
T ss_conf             999999999987551343456884377785599886546642078999999999----999999998211887618874-


Q ss_pred             CCCCCCCCC
Q ss_conf             410000335
Q gi|254780483|r  460 GWIKDLAAA  468 (581)
Q Consensus       460 ~Wi~dls~~  468 (581)
                      +|+.=|++.
T Consensus       498 gW~AIlgA~  506 (685)
T KOG2639         498 GWTAILGAI  506 (685)
T ss_pred             CHHHHHHHH
T ss_conf             489999999


No 80 
>KOG0904 consensus
Probab=30.86  E-value=27  Score=13.29  Aligned_cols=19  Identities=16%  Similarity=0.354  Sum_probs=9.1

Q ss_pred             CCCCCCCCCCCCCCCEEEE
Q ss_conf             3333322233234635787
Q gi|254780483|r  236 DIEKSSISNFHESNSWLGI  254 (581)
Q Consensus       236 d~~~~~~~~~~~~~~Wva~  254 (581)
                      ++...+.+...-...||-.
T Consensus       433 ~~~~kk~k~~~~plaWvN~  451 (1076)
T KOG0904         433 ESTKKKSKKEHCPLAWVNL  451 (1076)
T ss_pred             CCCCCCCCCCCCCEEEEEE
T ss_conf             0023456644584367764


No 81 
>pfam12127 YdfA_immunity SigmaW regulon antibacterial. This protein is found in bacteria. Proteins in this family are about 330 amino acids in length. The operon from which this protein is derived confers immunity for the host species to a broad range of antibacterial compounds, unlike the specific immunity proteins that are linked to and co-regulated with their antibiotic-synthesis proteins.
Probab=30.46  E-value=28  Score=13.13  Aligned_cols=18  Identities=22%  Similarity=0.494  Sum_probs=8.4

Q ss_pred             HHHHHHHHHHHHHHHCCC
Q ss_conf             888778889999973145
Q gi|254780483|r  388 NMKNIQPKIDELREKFKQ  405 (581)
Q Consensus       388 kM~~lqP~i~~i~ekyk~  405 (581)
                      +-|+++-+.+|.|+|-=.
T Consensus       259 ~EQEm~A~vqemrAkvVe  276 (321)
T pfam12127       259 REQEMKAKVQEMRAKVVE  276 (321)
T ss_pred             HHHHHHHHHHHHHHHHHH
T ss_conf             989999999997767312


No 82 
>pfam05029 TIMELESS_C Timeless protein C terminal region. The timeless (tim) gene is essential for circadian function in Drosophila. Putative homologues of Drosophila tim have been identified in both mice and humans (mTim and hTIM, respectively). Mammalian TIM is not the true orthologue of Drosophila TIM, but is the likely orthologue of a fly gene, timeout (also called tim-2). mTim has been shown to be essential for embryonic development, but does not have substantiated circadian function. Some family members contain a SANT domain in this region.
Probab=30.35  E-value=29  Score=13.08  Aligned_cols=11  Identities=27%  Similarity=0.537  Sum_probs=4.0

Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999998876
Q gi|254780483|r  345 PMFMLMSYFYN  355 (581)
Q Consensus       345 plf~~L~~l~~  355 (581)
                      ++.|+=+-|+.
T Consensus       298 ~L~WIqs~L~~  308 (507)
T pfam05029       298 PLLWLQSCLIR  308 (507)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999988777


No 83 
>pfam11120 DUF2636 Protein of unknown function (DUF2636). This family is conserved in the Enterobacteriaceae family. Several members are named as being YhjT, but the function is not known.
Probab=29.57  E-value=30  Score=12.99  Aligned_cols=28  Identities=25%  Similarity=0.443  Sum_probs=23.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999888999999999998887
Q gi|254780483|r  364 IMLTTVFVKLLFFPLAKKQYVSTANMKN  391 (581)
Q Consensus       364 IIllTilikli~~PLt~ks~~Sm~kM~~  391 (581)
                      |+=+-++--+||+||-|-.-+|..+++.
T Consensus         6 I~Qlv~lcAlIffpLGYla~~~~~r~r~   33 (62)
T pfam11120         6 IVQLVLLCALIFFPLGYLARRSLRRIRT   33 (62)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999998409999875589999


No 84 
>TIGR03372 putres_am_tran putrescine aminotransferase. Members of this family are putrescine aminotransferase, as found in Escherichia coli, Erwinia carotovora subsp. atroseptica, and closely related species. This pyridoxal phosphate enzyme, as characterized in E. coli, can act also on cadaverine and, more weakly, spermidine.
Probab=29.27  E-value=30  Score=12.95  Aligned_cols=19  Identities=5%  Similarity=0.123  Sum_probs=13.6

Q ss_pred             HHHHHHHHHHHHHHHHCCC
Q ss_conf             9888778889999973145
Q gi|254780483|r  387 ANMKNIQPKIDELREKFKQ  405 (581)
Q Consensus       387 ~kM~~lqP~i~~i~ekyk~  405 (581)
                      .+=+.|...+++|+++|.+
T Consensus       354 ~~G~~l~~~L~~L~~~~p~  372 (442)
T TIGR03372       354 IKGDFLLDGFQQLAAEYPD  372 (442)
T ss_pred             HHHHHHHHHHHHHHHHCCC
T ss_conf             9999999999999876878


No 85 
>PRK10340 ebgA cryptic beta-D-galactosidase subunit alpha; Reviewed
Probab=29.05  E-value=30  Score=12.93  Aligned_cols=31  Identities=3%  Similarity=0.081  Sum_probs=25.9

Q ss_pred             CCCCEEEEECCEEEEEEECCCCEEEEEEECC
Q ss_conf             4587289976649999976995599999535
Q gi|254780483|r   66 SMSPRVELKNPSLIGSINLKGAQFDDLNLRG   96 (581)
Q Consensus        66 ~~~~~I~Iend~l~i~is~~GG~I~~~~LK~   96 (581)
                      ..+..+.|..+.++++||..-|.+.++...+
T Consensus       721 e~~~~~~v~g~~f~~~Fdk~tG~L~s~~~~G  751 (1030)
T PRK10340        721 DDRLSCTVRGYNFAITFSKVSGKLTSWQVNG  751 (1030)
T ss_pred             ECCCEEEEEECCEEEEEECCCCEEEEEEECC
T ss_conf             4697799996999999985666289999899


No 86 
>KOG3543 consensus
Probab=28.87  E-value=26  Score=13.39  Aligned_cols=22  Identities=27%  Similarity=0.501  Sum_probs=13.0

Q ss_pred             HHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             99876986288753410000335
Q gi|254780483|r  446 VISISLEMRHAPFWGWIKDLAAA  468 (581)
Q Consensus       446 ~~~~~ielr~~~f~~Wi~dls~~  468 (581)
                      +|...-|-.++.| .|-.||-+-
T Consensus       816 vlqqneehhgeaf-awwsdll~e  837 (1218)
T KOG3543         816 VLQQNEEHHGEAF-AWWSDLLSE  837 (1218)
T ss_pred             HHHHHHHHCCHHH-HHHHHHHHH
T ss_conf             9973356412178-768888898


No 87 
>TIGR02026 BchE magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase; InterPro: IPR011772    This entry respresents the cobalamin-dependent oxidative cyclase responsible for forming the distinctive E-ring of the chlorin ring system under anaerobic conditions . This step is essential in the biosynthesis of both bacteriochlorophyll and chlorophyll under anaerobic conditions (a separate enzyme, AcsF, acts under aerobic conditions). This entry identifies two clades of sequences, one from photosynthetic, non-cyanobacterial bacteria and another including Synechocystis and several non-photosynthetic bacteria. The function of the Synechocystis gene is supported by gene clustering with other photosynthetic genes, so the purpose of the gene in the non-photosynthetic bacteria is uncertain. Note that homologues of this gene are not found in plants which rely solely on the aerobic cyclase.; GO: 0016709 oxidoreductase activity acting on paired donors with incorporation or reduction of molecular oxygen NADH or NADPH as one donor and incorporation of one atom of oxygen, 0050661 NADP binding, 0015995 chlorophyll biosynthetic process.
Probab=28.85  E-value=30  Score=12.90  Aligned_cols=27  Identities=30%  Similarity=0.441  Sum_probs=13.8

Q ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             8999997314511567899999998504878
Q gi|254780483|r  395 KIDELREKFKQSPPQVLQKAMIQLYKTHNIN  425 (581)
Q Consensus       395 ~i~~i~ekyk~d~~~~~~~e~m~ly~~~~vn  425 (581)
                      +++.+++.=+   . ..++|=-+|-|+|++=
T Consensus       317 ~Ld~~rK~t~---~-~~nkeAIrLlr~h~i~  343 (506)
T TIGR02026       317 TLDRFRKETT---V-SENKEAIRLLRQHNIL  343 (506)
T ss_pred             HHHHHCCCCC---C-HHHHHHHHHHHHCCCE
T ss_conf             2312136675---2-4448999999761840


No 88 
>pfam04912 Dynamitin Dynamitin. Dynamitin is a subunit of the microtubule-dependent motor complex and in implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS).
Probab=28.73  E-value=31  Score=12.89  Aligned_cols=49  Identities=18%  Similarity=0.365  Sum_probs=37.9

Q ss_pred             HHHHHHHHHHHHHHHHHCCC---CHHHHHHHHHHHHHHH-CCCCHHHHHHHHHHH
Q ss_conf             99888778889999973145---1156789999999850-487867889999999
Q gi|254780483|r  386 TANMKNIQPKIDELREKFKQ---SPPQVLQKAMIQLYKT-HNINPLAGCWPILLQ  436 (581)
Q Consensus       386 m~kM~~lqP~i~~i~ekyk~---d~~~~~~~e~m~ly~~-~~vnP~~GClP~l~q  436 (581)
                      -++++.|.-+|++|.++-+.   |.  ..++.+-+||-. -..++++--||.+|.
T Consensus       266 e~Rl~~L~~k~e~lae~r~~~~~d~--~~~~KI~eLY~~l~~~~~~~~~LP~vl~  318 (387)
T pfam04912       266 EARLQTVLGKMNSIAEKKAATDQDA--DTQSKISELYELMQKWDPVVSSLPDVVN  318 (387)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCC--CHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999998640323462--1566899999998757777635158999


No 89 
>TIGR00934 2a38euk potassium uptake protein, Trk family; InterPro: IPR004773 The proteins of the Trk family are derived from Gram-negative and Gram-positive bacteria, yeast and Triticum aestivum (Wheat). The proteins of Escherichia coli K12 TrkH and TrkG as well as several yeast proteins have been functionally characterised. The E. coli TrkH and TrkG proteins are complexed to two peripheral membrane proteins, TrkA, an NAD-binding protein, and TrkE, an ATP-binding protein. This complex forms the potassium uptake system. This family is specific for the eukaryotic Trk system.; GO: 0015079 potassium ion transmembrane transporter activity, 0006813 potassium ion transport, 0016021 integral to membrane.
Probab=28.36  E-value=31  Score=12.84  Aligned_cols=107  Identities=17%  Similarity=0.431  Sum_probs=56.9

Q ss_pred             HHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHH
Q ss_conf             85048786788999999999999999999876986288753410000335725666764102222027899999999999
Q gi|254780483|r  419 YKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMS  498 (581)
Q Consensus       419 y~~~~vnP~~GClP~l~q~p~~~a~~~~~~~~ielr~~~f~~Wi~dls~~d~~~~~~~~~~~p~~~~~~~~~~ilp~l~~  498 (581)
                      =++.||+|            +++|||....+=   -...|-|=-+-.-+.+. .++-|...++|....-.   .+||++-
T Consensus       815 v~~~g~sp------------~wW~fft~~SaF---~nlGL~LTp~SM~sF~k-~~~~Ll~m~~fiiiGNT---GFP~fLR  875 (1197)
T TIGR00934       815 VRSKGVSP------------TWWGFFTAMSAF---ANLGLTLTPDSMVSFNK-AVYLLLLMIFFIIIGNT---GFPIFLR  875 (1197)
T ss_pred             CCCCCCCC------------HHHHHHHHHHHH---HCCCCCCCCCCCCCCHH-HHHHHHHHHHHHHHHHC---CHHHHHH
T ss_conf             03167850------------568889999998---53788758665441112-46899999999997531---3468888


Q ss_pred             HHHHHHHHCCCCCCCHHHHH-HHHHH---H-HHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999975288774689999-99996---8-999999987879999999999999999
Q gi|254780483|r  499 LSMFIQMKMSPPPADKGQAM-ILNWM---P-VVFVFALSSFPAGLIIYWSWSNVISIV  551 (581)
Q Consensus       499 ~~m~~~~k~~p~~~d~~q~~-~~~~m---p-~~~~~~~~~~~~gl~~y~~~~~~~~~~  551 (581)
                      .-.|+.-|++|--   -|.| -+.|+   | .-|+.+   ||+|.+. |+...|+.+.
T Consensus       876 ~~IW~l~k~~P~~---S~~~E~~~fLlDHprrCFtlL---fP~~aTW-wL~~tL~gLn  926 (1197)
T TIGR00934       876 FIIWILFKISPDL---SKRKESLGFLLDHPRRCFTLL---FPSGATW-WLFLTLVGLN  926 (1197)
T ss_pred             HHHHHHHEECCCH---HHHHHHHHHHHCCCHHHHHHH---HHHHHHH-HHHHHHHHHH
T ss_conf             8755542023321---225678776608612446653---0225799-9999999999


No 90 
>pfam08216 DUF1716 Eukaryotic domain of unknown function (DUF1716). This domain is found in eukaryotic proteins. A human nuclear protein with this domain is thought to have a role in apoptosis.
Probab=28.28  E-value=31  Score=12.83  Aligned_cols=15  Identities=40%  Similarity=0.629  Sum_probs=11.3

Q ss_pred             HHHHHHHCCCCHHHHH
Q ss_conf             9999973145115678
Q gi|254780483|r  396 IDELREKFKQSPPQVL  411 (581)
Q Consensus       396 i~~i~ekyk~d~~~~~  411 (581)
                      =+++|.||.||| +|.
T Consensus        42 Nqe~R~K~~d~P-eKF   56 (108)
T pfam08216        42 NQELRIKFPDDP-EKF   56 (108)
T ss_pred             HHHHHHHCCCCH-HHH
T ss_conf             599986088988-999


No 91 
>COG4449 Predicted protease of the Abi (CAAX) family [General function prediction only]
Probab=28.27  E-value=31  Score=12.83  Aligned_cols=23  Identities=13%  Similarity=0.260  Sum_probs=10.6

Q ss_pred             CCCCCCCEEEE----EECEEE-EEEEEC
Q ss_conf             33234635787----311058-999607
Q gi|254780483|r  244 NFHESNSWLGI----SDKYWA-SVFIPS  266 (581)
Q Consensus       244 ~~~~~~~Wva~----~qkYF~-salIP~  266 (581)
                      +..+..||--+    +|--|. ..+.|.
T Consensus       275 sp~gqagwyiyga~~~~gif~vq~~~pr  302 (827)
T COG4449         275 SPVGQAGWYVYGAQGKDGIFTVQSLNPR  302 (827)
T ss_pred             CCCCCCCEEEECCCCCCCEEEEECCCCH
T ss_conf             8776440489714577606998412613


No 92 
>PRK09738 small toxic polypeptide; Provisional
Probab=28.03  E-value=31  Score=12.80  Aligned_cols=20  Identities=25%  Similarity=0.469  Sum_probs=14.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             63999999999999888999999
Q gi|254780483|r  360 FGIAIMLTTVFVKLLFFPLAKKQ  382 (581)
Q Consensus       360 yGiaIIllTilikli~~PLt~ks  382 (581)
                      |++-||.+|+++   |..||.+|
T Consensus        10 ~c~livC~TlLi---FT~ltR~s   29 (52)
T PRK09738         10 WCVLIVCLTLLI---FTYLTRKS   29 (52)
T ss_pred             HHHHHHHHHHHH---HHHHHHHH
T ss_conf             338999999999---99997612


No 93 
>pfam02411 MerT MerT mercuric transport protein. MerT is an mercuric transport integral membrane protein and is responsible for transport of the Hg2+ iron from periplasmic MerP (also part of the transport system) to mercuric reductase (MerE).
Probab=27.66  E-value=32  Score=12.76  Aligned_cols=69  Identities=14%  Similarity=0.318  Sum_probs=38.6

Q ss_pred             HCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCC--------CCH---HHHHHHH
Q ss_conf             62887534100003357256667641022220278999999999999999997528877--------468---9999999
Q gi|254780483|r  453 MRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP--------ADK---GQAMILN  521 (581)
Q Consensus       453 lr~~~f~~Wi~dls~~d~~~~~~~~~~~p~~~~~~~~~~ilp~l~~~~m~~~~k~~p~~--------~d~---~q~~~~~  521 (581)
                      .=|.|= -||..|+.-+||..            .|..+.+  +.+|..-  .+.+-|..        ..|   .++|++.
T Consensus        33 ~lGvSG-awig~Lt~LePyRP------------~fi~~al--~~lg~a~--~~~yrp~~~C~~g~~Ca~p~~r~~~k~~~   95 (116)
T pfam02411        33 LLGVSG-AWIGNLTLLEPYRP------------IFILAAL--VALFFAW--RRIYRPVEACEPGTVCAVPQVRKTYKVIF   95 (116)
T ss_pred             HHCCCH-HHHHHHHHHHCCHH------------HHHHHHH--HHHHHHH--HHHHCCHHHCCCCCCCCCCCHHHHHHHHH
T ss_conf             962304-87743566502117------------9999999--9999999--99858652059998578811433788899


Q ss_pred             HHHHHHHHHHHHHHHHH
Q ss_conf             96899999998787999
Q gi|254780483|r  522 WMPVVFVFALSSFPAGL  538 (581)
Q Consensus       522 ~mp~~~~~~~~~~~~gl  538 (581)
                      |.-.++..++..||-=+
T Consensus        96 Wivt~~vl~~l~fPy~~  112 (116)
T pfam02411        96 WLVALLALVAVTFPYVI  112 (116)
T ss_pred             HHHHHHHHHHHHHHHHH
T ss_conf             99999999999737668


No 94 
>pfam03056 consensus
Probab=27.04  E-value=33  Score=12.68  Aligned_cols=56  Identities=18%  Similarity=0.372  Sum_probs=36.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHH
Q ss_conf             32016399999999999988899999999-9998887788899999731451156789999999850
Q gi|254780483|r  356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYV-STANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKT  421 (581)
Q Consensus       356 ~i~NyGiaIIllTilikli~~PLt~ks~~-Sm~kM~~lqP~i~~i~ekyk~d~~~~~~~e~m~ly~~  421 (581)
                      |..+-|+.++++-|++=++++|.-.+|.. -...||.|     .++.|+.     ..-+..|+|-+.
T Consensus       151 ~~~~i~vga~~~~i~~~i~~~~cl~~sl~~~~~~~~vl-----~lk~k~~-----~~~~~~~e~~~~  207 (213)
T pfam03056       151 WFIFIGVGALLLVIVIMIFVFPCLARSLVQVFLDMRVL-----LLKKKKM-----LQHRHLMELLKN  207 (213)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHHHH-----HHHHHHHHHHCC
T ss_conf             99999999999999999999999998899999987999-----9989889-----869999999736


No 95 
>PRK10476 multidrug resistance protein MdtN; Provisional
Probab=26.48  E-value=33  Score=12.61  Aligned_cols=35  Identities=9%  Similarity=0.173  Sum_probs=21.3

Q ss_pred             EECCEEEEEEECC-CCEEEEEEECCCCCCCCCCCCCEEE
Q ss_conf             9766499999769-9559999953571344788772688
Q gi|254780483|r   73 LKNPSLIGSINLK-GAQFDDLNLRGYHLDVSSNSPIVTL  110 (581)
Q Consensus        73 Iend~l~i~is~~-GG~I~~~~LK~Y~~~~~~ds~~v~L  110 (581)
                      |+.+.  +.|+++ +|.|.++..++. +...++..++.|
T Consensus        46 V~~~i--v~Is~~VsG~V~~V~V~eg-q~VkkGq~L~~L   81 (348)
T PRK10476         46 IDADV--VHVASEVGGRIVELAVTEN-QAVKKGDLLFRI   81 (348)
T ss_pred             EEEEE--EEEECCCCEEEEEEEECCC-CEECCCCEEEEE
T ss_conf             99799--9993434459999994699-986489789997


No 96 
>PRK12860 transcriptional activator FlhC; Provisional
Probab=26.31  E-value=34  Score=12.59  Aligned_cols=18  Identities=39%  Similarity=0.846  Sum_probs=16.4

Q ss_pred             HHHHHHH-CCCCHHHHHHH
Q ss_conf             9999850-48786788999
Q gi|254780483|r  415 MIQLYKT-HNINPLAGCWP  432 (581)
Q Consensus       415 ~m~ly~~-~~vnP~~GClP  432 (581)
                      ..+|||| .||+|=-|-||
T Consensus        40 LirLYKElrG~sPPKGmLP   58 (189)
T PRK12860         40 LIRLYKEVRGVSPPKGMLP   58 (189)
T ss_pred             HHHHHHHHCCCCCCCCCCC
T ss_conf             9999999808999988788


No 97 
>PRK09953 wcaD putative colanic acid biosynthesis protein; Provisional
Probab=25.81  E-value=34  Score=12.53  Aligned_cols=51  Identities=18%  Similarity=0.234  Sum_probs=25.7

Q ss_pred             EEEEEEECHHHHHHHHHHCCCCCCHHHHHHHHCCHHHH--HHHHHHHHHH-HHHHHHHHHH
Q ss_conf             89988500027887632201463101233320110356--8999999998-8763201639
Q gi|254780483|r  305 TNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFI--AKPMFMLMSY-FYNLVGNFGI  362 (581)
Q Consensus       305 ~~~lY~GPk~~~~L~~~~~~l~~~~l~~~vd~Gwf~~i--~kplf~~L~~-l~~~i~NyGi  362 (581)
                      ++.+|-|..-=   +..|++|.    -+++.||||+.+  +..++.+++. ++++-.|||.
T Consensus       311 ~f~ifNGAdvG---~tiDNGLY----lLi~YF~W~~vlL~~~~~~~~lk~Ml~~~~~n~~~  364 (405)
T PRK09953        311 SFGIFNGADVG---KTIDNGLY----LLIIYFSWFAVLLSLWYMGKVLKMMLNAFGDNRNF  364 (405)
T ss_pred             HCCCCCCHHHC---CCCCCCEE----EEEEHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             43763525534---60258628----97616889999999999999999998622777673


No 98 
>TIGR01726 HEQRo_perm_3TM amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family; InterPro: IPR010065   This entry represents one of several classes of multiple membrane spanning regions found in the inner membrane component of binding-protein-dependent transport systems. The region covered by this entry generally is predicted to contain three transmembrane helices. Substrate specificities attributed to members of this family include histidine, arginine, glutamine, glutamate, and (in Agrobacterium) the opines octopine and nopaline.; GO: 0005215 transporter activity, 0006810 transport, 0009276 1-2nm peptidoglycan-based cell wall, 0016021 integral to membrane.
Probab=25.29  E-value=35  Score=12.46  Aligned_cols=12  Identities=17%  Similarity=0.395  Sum_probs=5.1

Q ss_pred             HHHHHHHHHHHH
Q ss_conf             689999999878
Q gi|254780483|r  523 MPVVFVFALSSF  534 (581)
Q Consensus       523 mp~~~~~~~~~~  534 (581)
                      -|+++..|+.-|
T Consensus        55 ~PlLvqlf~~yf   66 (99)
T TIGR01726        55 TPLLVQLFFIYF   66 (99)
T ss_pred             HHHHHHHHHHHH
T ss_conf             079999999998


No 99 
>COG3901 NosR Regulator of nitric oxide reductase transcription [Transcription]
Probab=25.19  E-value=27  Score=13.27  Aligned_cols=18  Identities=11%  Similarity=0.078  Sum_probs=13.4

Q ss_pred             EEEECCCCEEEEEEECCCC
Q ss_conf             9997699559999953571
Q gi|254780483|r   80 GSINLKGAQFDDLNLRGYH   98 (581)
Q Consensus        80 i~is~~GG~I~~~~LK~Y~   98 (581)
                      +-++. -|.|+.++|.+|+
T Consensus        98 vglD~-qGvirG~KlvdH~  115 (482)
T COG3901          98 VGLDP-QGVIRGAKLVDHH  115 (482)
T ss_pred             EEECC-CCEEEEEEEECCC
T ss_conf             98757-7658411763167


No 100
>cd00927 Cyt_c_Oxidase_VIc Cytochrome c oxidase subunit VIc. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. The VIc subunit is found only in eukaryotes and its specific function remains unclear. It has been reported that the relative concentrations of some nuclear encoded CcO subunits, including subunit VIc, compared to those of the mitochondrial encoded subunits, are altered significantly during the progression of prostate cancer.
Probab=25.11  E-value=35  Score=12.44  Aligned_cols=29  Identities=10%  Similarity=0.098  Sum_probs=16.0

Q ss_pred             HHHHHHHHHHHHHHHCCC-CHHHHHHHHHHH
Q ss_conf             888778889999973145-115678999999
Q gi|254780483|r  388 NMKNIQPKIDELREKFKQ-SPPQVLQKAMIQ  417 (581)
Q Consensus       388 kM~~lqP~i~~i~ekyk~-d~~~~~~~e~m~  417 (581)
                      |.-+-.|+-++-.|=||+ |+ +|-=++|++
T Consensus        34 k~~v~~pRKkaYadFYknYD~-~kdFerMr~   63 (70)
T cd00927          34 KFLVNEPRKKAYADFYKTYDA-MKDFERMRK   63 (70)
T ss_pred             HHHHCCHHHHHHHHHHHCCCH-HHHHHHHHH
T ss_conf             999736988999999981691-779999997


No 101
>pfam10095 DUF2333 Uncharacterized protein conserved in bacteria (DUF2333). Members of this family of hypothetical bacterial proteins have no known function.
Probab=24.95  E-value=30  Score=12.95  Aligned_cols=22  Identities=9%  Similarity=0.200  Sum_probs=9.9

Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             99999999975137898876544
Q gi|254780483|r   13 LSVIIVYAWQNFYVYPRIEEMNN   35 (581)
Q Consensus        13 Ls~~ill~w~~~~~~p~~e~~~~   35 (581)
                      |..++++|| +|...|..-.+.+
T Consensus        25 ll~~~~lg~-~WS~eP~~fdv~~   46 (337)
T pfam10095        25 LLILYLLGI-YWSFEPAAFDVQT   46 (337)
T ss_pred             HHHHHHHHH-EEECCCCCCCHHH
T ss_conf             999999984-1426887788367


No 102
>PRK10189 hypothetical protein; Provisional
Probab=24.92  E-value=35  Score=12.42  Aligned_cols=29  Identities=17%  Similarity=0.283  Sum_probs=11.7

Q ss_pred             HHHHHHHHHHHHHHHH---HHHHHHHCCCCCC
Q ss_conf             9999999999999999---9999874799834
Q gi|254780483|r  537 GLIIYWSWSNVISIVQ---QAVIMKMHGAEIG  565 (581)
Q Consensus       537 gl~~y~~~~~~~~~~q---q~~i~~~~~~~~~  565 (581)
                      |+.+++.+..++-..-   -.|++|....||+
T Consensus       446 ~~~~~~~v~~vl~~~r~~~g~W~~k~~~~~~~  477 (481)
T PRK10189        446 GMFLDWAVRGVLFYWRMVTGRWLWKYPRSEPQ  477 (481)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHH
T ss_conf             69999999999999999479675568888721


No 103
>pfam04284 DUF441 Protein of unknown function (DUF441). Predicted to be an integral membrane protein.
Probab=24.85  E-value=36  Score=12.41  Aligned_cols=34  Identities=18%  Similarity=0.260  Sum_probs=23.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9988763201639999999999998889999999
Q gi|254780483|r  350 MSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQY  383 (581)
Q Consensus       350 L~~l~~~i~NyGiaIIllTilikli~~PLt~ks~  383 (581)
                      +.++.+.--|||+.|+.+.+++-+..-..+.+..
T Consensus        38 fp~le~~Gi~~Gi~iLti~vL~PiAsGkI~~~~l   71 (140)
T pfam04284        38 FPFLEKKGINWGVTILTIAVLVPIATGKIGFKDL   71 (140)
T ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHCCCCCCHHHH
T ss_conf             7999976953759999999987200487578999


No 104
>pfam07745 Glyco_hydro_53 Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
Probab=24.81  E-value=20  Score=14.25  Aligned_cols=66  Identities=6%  Similarity=0.148  Sum_probs=37.2

Q ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH-------------------HHCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             88877888999997314511567899999998-------------------50487867889999999999999999998
Q gi|254780483|r  388 NMKNIQPKIDELREKFKQSPPQVLQKAMIQLY-------------------KTHNINPLAGCWPILLQIPVFFAIYKVIS  448 (581)
Q Consensus       388 kM~~lqP~i~~i~ekyk~d~~~~~~~e~m~ly-------------------~~~~vnP~~GClP~l~q~p~~~a~~~~~~  448 (581)
                      .+..|+--|+.|.+||..|-   +=.|+-=-|                   ..+-+.|-|       |.-.+-.+...+.
T Consensus       213 tl~~l~~~l~~l~~~y~K~v---~VvEtayp~t~~~~D~~~N~~~~~~~~~~~yp~t~~G-------Q~~~l~~l~~~v~  282 (332)
T pfam07745       213 TLENLRTNLKDMASRYGKPV---MVVETAYPWTLEDGDGHGNPLPEYGFDLSGYPASVQG-------QATYLRDLAQLVS  282 (332)
T ss_pred             HHHHHHHHHHHHHHHHCCCE---EEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHH-------HHHHHHHHHHHHH
T ss_conf             39999999999999978967---9998168775656788888576422345799988899-------9999999999997


Q ss_pred             HHHHHCCCCCCCCCCC
Q ss_conf             7698628875341000
Q gi|254780483|r  449 ISLEMRHAPFWGWIKD  464 (581)
Q Consensus       449 ~~ielr~~~f~~Wi~d  464 (581)
                      +.- =|+..+|.|-+.
T Consensus       283 ~v~-~~G~GvfYWEP~  297 (332)
T pfam07745       283 AVP-SDGLGVFYWEPA  297 (332)
T ss_pred             HCC-CCEEEEEEECCC
T ss_conf             179-984799996154


No 105
>TIGR01523 ATPase-IID_K-Na potassium/sodium efflux P-type ATPase, fungal-type; InterPro: IPR006414   Initially described as a calcium efflux ATPase , more recent work has shown that the Schizosaccharomyces pombe CTA3 gene is in fact a potassium ion efflux pump . These sequences form the clade which represents the fungal P-type ATPases which are responsible for potassium and sodium efflux. The degree to which these pumps show preference for sodium or potassium varies. This group of ATPases has been classified by phylogentic analysis as type IID . ; GO: 0015662 ATPase activity coupled to transmembrane movement of ions phosphorylative mechanism, 0006812 cation transport, 0016021 integral to membrane.
Probab=24.73  E-value=31  Score=12.88  Aligned_cols=51  Identities=18%  Similarity=0.367  Sum_probs=29.6

Q ss_pred             HHHHHHHHHHHHHHHHH-----HHHHHHHH----------HHHHHHHHH-HHHHHHHHHHHHHHHCCCCH
Q ss_conf             76320163999999999-----99988899----------999999999-88877888999997314511
Q gi|254780483|r  354 YNLVGNFGIAIMLTTVF-----VKLLFFPL----------AKKQYVSTA-NMKNIQPKIDELREKFKQSP  407 (581)
Q Consensus       354 ~~~i~NyGiaIIllTil-----ikli~~PL----------t~ks~~Sm~-kM~~lqP~i~~i~ekyk~d~  407 (581)
                      |=++.|=|=+|.|+-=|     +..-.|||          --.++=||. -|-+-||-+   -||-..|.
T Consensus       762 ~LL~~NV~~~~~L~~GL~FRDE~~~SVFPlSPVE~LW~~~~TS~FP~MGLGlE~A~PD~---M~R~PHD~  828 (1001)
T TIGR01523       762 QLLVENVAEVLLLVVGLVFRDEVGKSVFPLSPVEVLWIIVVTSSFPAMGLGLEKAAPDL---MDRLPHDS  828 (1001)
T ss_pred             HHHHHHHHHHHHHHHHHHEEECCCCEECCCCHHHHHHHHHHHHCCCCHHCCHHHCCCCC---CCCCCCCC
T ss_conf             99999899898777621025047740057753787777787505530010023338630---15777987


No 106
>pfam05280 FlhC Flagellar transcriptional activator (FlhC). This family consists of several bacterial flagellar transcriptional activator (FlhC) proteins. FlhC combines with FlhD to form a regulatory complex in E. coli, this complex has been shown to be a global regulator involved in many cellular processes as well as a flagellar transcriptional activator.
Probab=24.49  E-value=36  Score=12.36  Aligned_cols=18  Identities=39%  Similarity=0.846  Sum_probs=16.3

Q ss_pred             HHHHHHH-CCCCHHHHHHH
Q ss_conf             9999850-48786788999
Q gi|254780483|r  415 MIQLYKT-HNINPLAGCWP  432 (581)
Q Consensus       415 ~m~ly~~-~~vnP~~GClP  432 (581)
                      ..+|||| .|++|=-|-||
T Consensus        40 LirLYKElrG~sPPKGmLP   58 (176)
T pfam05280        40 LIKLYKEVRGVSPPKGMLP   58 (176)
T ss_pred             HHHHHHHHCCCCCCCCCCC
T ss_conf             9999999728999988778


No 107
>pfam07358 DUF1482 Protein of unknown function (DUF1482). This family consists of several Enterobacterial proteins of around 60 residues in length. The function of this family is unknown.
Probab=24.37  E-value=28  Score=13.16  Aligned_cols=12  Identities=33%  Similarity=1.088  Sum_probs=5.7

Q ss_pred             HHCCCCHHHHHHHH
Q ss_conf             50487867889999
Q gi|254780483|r  420 KTHNINPLAGCWPI  433 (581)
Q Consensus       420 ~~~~vnP~~GClP~  433 (581)
                      .+.++.  |||+|.
T Consensus        34 ~EQki~--g~C~Pv   45 (57)
T pfam07358        34 AEQKIR--GGCYPV   45 (57)
T ss_pred             HHCCCC--CCCEEH
T ss_conf             865478--887133


No 108
>pfam05462 Dicty_CAR Slime mold cyclic AMP receptor. This family consists of cyclic AMP receptor (CAR) proteins from slime molds. CAR proteins are responsible for controlling development in Dictyostelium discoideum.
Probab=23.90  E-value=37  Score=12.28  Aligned_cols=99  Identities=19%  Similarity=0.308  Sum_probs=47.7

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCC-CCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHH-HHHHHCCCCCCCH
Q ss_conf             99999999999876986288753410-000335725666764102222027899999999999999-9997528877468
Q gi|254780483|r  437 IPVFFAIYKVISISLEMRHAPFWGWI-KDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSM-FIQMKMSPPPADK  514 (581)
Q Consensus       437 ~p~~~a~~~~~~~~ielr~~~f~~Wi-~dls~~d~~~~~~~~~~~p~~~~~~~~~~ilp~l~~~~m-~~~~k~~p~~~d~  514 (581)
                      +|+..+....+..+++-+| +| -|| .|++.+-  +       .-|++|.+.-+..=.|+.|.+. +..+-+...+.| 
T Consensus       126 iPlI~tII~la~~~y~~~G-~W-CWI~~~y~~yr--F-------~~Fy~Pf~iI~~~sailv~lt~ryty~vi~~~vs~-  193 (305)
T pfam05462       126 LPLISTIIMLSKNTIEPVG-NW-CWIGEQYVGYR--F-------GLFYGPFFIIWGTSAILVGLTSRYTYQVIRNSVSD-  193 (305)
T ss_pred             CCHHHHHHHHHCCCCCCCC-CE-EEECCCCCCEE--E-------EEEECCHHHHHHHHHHEEEEEHHHHHHHHHCCCCH-
T ss_conf             2199999999707723567-64-89748642157--7-------65300579987650331453078889998528880-


Q ss_pred             HHHHHHHH------HHHHHHHHHHHH------HHHHHHHHHHHHHH
Q ss_conf             99999999------689999999878------79999999999999
Q gi|254780483|r  515 GQAMILNW------MPVVFVFALSSF------PAGLIIYWSWSNVI  548 (581)
Q Consensus       515 ~q~~~~~~------mp~~~~~~~~~~------~~gl~~y~~~~~~~  548 (581)
                      .|.|-|.+      -.++|+ .++-|      --|+..|=.+.|++
T Consensus       194 ~k~kh~~yqFkl~nyI~vfl-vcWiFa~inri~n~~~~~~~~~n~l  238 (305)
T pfam05462       194 NKDKHMTYQFKLINYIIVFL-VCWVFAVVNRILNGLGYFPTAPNIL  238 (305)
T ss_pred             HHHHHHHEEEEEHHHHHHHH-HHHHHHHHHHHHCCCCCCHHHHHHH
T ss_conf             34312113553235799999-9999999999864566620699999


No 109
>TIGR02951 DMSO_dmsB dimethylsulfoxide reductase, chain B; InterPro: IPR014297   This family consists of the iron-sulphur subunit, or chain B, of the anaerobic dimethyl sulphoxide reductase enzyme. Chains A and B are catalytic, while chain C is a membrane anchor..
Probab=23.67  E-value=29  Score=13.03  Aligned_cols=16  Identities=19%  Similarity=0.447  Sum_probs=10.4

Q ss_pred             CCEEEEEEEEECC-CCE
Q ss_conf             8426999997168-835
Q gi|254780483|r  164 NNILFERTISLDE-HYL  179 (581)
Q Consensus       164 ~g~~i~kt~t~~~-~Y~  179 (581)
                      =|..++|+|++.+ +|.
T Consensus        29 vG~~fRRVyey~GG~w~   45 (162)
T TIGR02951        29 VGVLFRRVYEYEGGSWT   45 (162)
T ss_pred             CCCCCCEEEEEECCEEE
T ss_conf             46652237883289067


No 110
>pfam10319 7TM_GPCR_Srj Serpentine type 7TM GPCR chemoreceptor Srj. Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srj is part of the Str superfamily of chemoreceptors. The srj family is designated as the out-group based on its location in preliminary phylogenetic analyses of the entire superfamily. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'.
Probab=23.55  E-value=37  Score=12.24  Aligned_cols=17  Identities=29%  Similarity=0.458  Sum_probs=11.0

Q ss_pred             HHHH-HHHHHHHHHHHHH
Q ss_conf             9999-9999999999999
Q gi|254780483|r  430 CWPI-LLQIPVFFAIYKV  446 (581)
Q Consensus       430 ClP~-l~q~p~~~a~~~~  446 (581)
                      +.|+ ++.+|+.+-+..-
T Consensus       253 iIP~ilm~iP~~~~~~~P  270 (310)
T pfam10319       253 IIPICISFSPCLLAWYSP  270 (310)
T ss_pred             HHHHHHHHHHHHHHHHHH
T ss_conf             988999998899999999


No 111
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif. CDSP32 is a stress-inducible TRX, i.e., it acts as a TRX by reducing protein disulfides and is induced by environmental and oxidative stress conditions. It plays a critical role in plastid defense against oxidative damage, a role related to its function as a physiological electron donor to BAS1, a plastidic 2-cys peroxiredoxin. Plants lacking CDSP32 exhibit decreased photosystem II photochemical efficiencies and chlorophyll retention compared to WT controls, as well as an increased proportion of BAS1 in its overoxidized monomeric form.
Probab=23.50  E-value=38  Score=12.23  Aligned_cols=14  Identities=21%  Similarity=0.380  Sum_probs=5.3

Q ss_pred             HHHHHHHHHHHHCC
Q ss_conf             77888999997314
Q gi|254780483|r  391 NIQPKIDELREKFK  404 (581)
Q Consensus       391 ~lqP~i~~i~ekyk  404 (581)
                      .+.|.+++|-++|.
T Consensus        32 ~i~P~~e~La~~~~   45 (103)
T cd02985          32 KIYPTMVKLSRTCN   45 (103)
T ss_pred             HHHHHHHHHHHHCC
T ss_conf             63089999997779


No 112
>TIGR02794 tolA_full protein TolA; InterPro: IPR014161   TolA couples the inner membrane complex of itself with TolQ and TolR to the outer membrane complex of TolB and OprL (also called Pal). Most of the length of the protein consists of low-complexity sequence that may differ in both length and composition from one species to another, complicating efforts to discriminate TolA (the most divergent gene in the tol-pal system) from paralogs such as TonB. Selection of members of the seed alignment and criteria for setting scoring cut-offs are based largely on conserved operon structure. The Tol-Pal complex is required for maintaining outer membrane integrity, and is also involved in transport (uptake) of colicins and filamentous DNA, and implicated in pathogenesis. Transport is energized by the proton motive force. TolA is an inner membrane protein that interacts with periplasmic TolB and with outer membrane porins OmpC, PhoE and LamB..
Probab=23.39  E-value=38  Score=12.22  Aligned_cols=21  Identities=5%  Similarity=0.165  Sum_probs=8.3

Q ss_pred             HHHHHHH--HHHHHHHHH-HHCCC
Q ss_conf             9999999--999999997-51378
Q gi|254780483|r    7 YFVAIAL--SVIIVYAWQ-NFYVY   27 (581)
Q Consensus         7 ~iIai~L--s~~ill~w~-~~~~~   27 (581)
                      ++|.++|  +++++|.|. .++..
T Consensus         4 ~~~s~~lH~~l~~~L~~~~~~~~~   27 (452)
T TIGR02794         4 FLLSVLLHILLLGLLILGASLTHS   27 (452)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             999999999999999971233013


No 113
>pfam11037 Musclin Insulin-resistance promoting peptide in skeletal muscle. Musclin is a muscle derived secretory peptide which induces insulin resistance in vitro. It encodes a 130 amino acid sequence including a NH(2) terminal 30 amino acid signal sequence. Musclin expression level is tightly regulated by nutritional changes.
Probab=22.84  E-value=21  Score=14.04  Aligned_cols=22  Identities=23%  Similarity=0.146  Sum_probs=12.6

Q ss_pred             CCEEEEECCEEEE----EEECCCCEE
Q ss_conf             8728997664999----997699559
Q gi|254780483|r   68 SPRVELKNPSLIG----SINLKGAQF   89 (581)
Q Consensus        68 ~~~I~Iend~l~i----~is~~GG~I   89 (581)
                      .+.|.+|||+++-    +|+-.|.-+
T Consensus        65 deLVSLENdV~ETKKKRSF~gFGsPl   90 (132)
T pfam11037        65 DELVSLENDVTETKKKRSFSGFGSPL   90 (132)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCHH
T ss_conf             99986412666653115678779826


No 114
>pfam03273 Baculo_gp64 Baculovirus gp64 envelope glycoprotein family. This family includes the gp64 glycoprotein from baculovirus as well as other viruses.
Probab=22.82  E-value=39  Score=12.14  Aligned_cols=41  Identities=15%  Similarity=0.278  Sum_probs=20.9

Q ss_pred             HHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             123332011035689999999988763201639999999999998
Q gi|254780483|r  330 FEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLL  374 (581)
Q Consensus       330 l~~~vd~Gwf~~i~kplf~~L~~l~~~i~NyGiaIIllTilikli  374 (581)
                      |+++.||-+ +||+--|.   .++++.++||=+.+.++.++++++
T Consensus       462 L~di~~~~~-G~l~~~l~---~~~~g~~~~~~li~~vi~~l~cm~  502 (508)
T pfam03273       462 LTDILDYPS-GWLNGKLG---SLLLGHIGNFVLIFGVILFLVCMI  502 (508)
T ss_pred             HHHHHHCCC-HHHHHHHH---HHHHCCCCEEEHHHHHHHHHHHHC
T ss_conf             778651753-34543247---775567401302345677553010


No 115
>KOG0190 consensus
Probab=22.26  E-value=40  Score=12.06  Aligned_cols=19  Identities=37%  Similarity=0.616  Sum_probs=14.9

Q ss_pred             HHHHHHHHHHHHHHCCCCH
Q ss_conf             8877888999997314511
Q gi|254780483|r  389 MKNIQPKIDELREKFKQSP  407 (581)
Q Consensus       389 M~~lqP~i~~i~ekyk~d~  407 (581)
                      -+.|.|..+||-|+|+||+
T Consensus       399 Ck~laP~yeeLAe~~k~~~  417 (493)
T KOG0190         399 CKALAPIYEELAEKYKDDE  417 (493)
T ss_pred             HHHHHHHHHHHHHHHCCCC
T ss_conf             5655479999999965898


No 116
>COG1883 OadB Na+-transporting methylmalonyl-CoA/oxaloacetate decarboxylase, beta subunit [Energy production and conversion]
Probab=22.24  E-value=40  Score=12.06  Aligned_cols=37  Identities=32%  Similarity=0.279  Sum_probs=30.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999988899999999999888778889999
Q gi|254780483|r  363 AIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDEL  399 (581)
Q Consensus       363 aIIllTilikli~~PLt~ks~~Sm~kM~~lqP~i~~i  399 (581)
                      ||-+-+-+-.=++-|.+...|-=|+---.+||-+-++
T Consensus       151 aIy~t~~LAP~Ll~~iAvAAYSYMALVPiIQPpimka  187 (375)
T COG1883         151 AIYLTNKLAPELLGAIAVAAYSYMALVPIIQPPIMKA  187 (375)
T ss_pred             EEEECCCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHH
T ss_conf             6876022488888899999999887733014188888


No 117
>PRK11103 mannose-specific PTS system protein IID; Provisional
Probab=22.16  E-value=40  Score=12.05  Aligned_cols=13  Identities=15%  Similarity=0.674  Sum_probs=6.1

Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             9999999999999
Q gi|254780483|r  491 GIWPIIMSLSMFI  503 (581)
Q Consensus       491 ~ilp~l~~~~m~~  503 (581)
                      ++||++....+|.
T Consensus       236 ~LLPl~~t~~~y~  248 (277)
T PRK11103        236 GLVPLLLTFACMW  248 (277)
T ss_pred             HHHHHHHHHHHHH
T ss_conf             4799999999999


No 118
>KOG1517 consensus
Probab=22.07  E-value=40  Score=12.04  Aligned_cols=154  Identities=18%  Similarity=0.265  Sum_probs=67.1

Q ss_pred             HHHHHHHHHHCCCC---HHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCCCCCCCCCCCCCC---HHHHHHHH-HCCCCC
Q ss_conf             99999998504878---6788999999999999999999876986-2887534100003357---25666764-102222
Q gi|254780483|r  412 QKAMIQLYKTHNIN---PLAGCWPILLQIPVFFAIYKVISISLEM-RHAPFWGWIKDLAAAD---PTNIFTLF-GILPFY  483 (581)
Q Consensus       412 ~~e~m~ly~~~~vn---P~~GClP~l~q~p~~~a~~~~~~~~iel-r~~~f~~Wi~dls~~d---~~~~~~~~-~~~p~~  483 (581)
                      |---.++|=++|++   | ---|||.||  |+.+=--=++.-+-| |--.+--|+-||+-.=   || ++.|. -..+=.
T Consensus       453 QLTAFevWLd~gse~r~P-PeQLPiVLQ--VLLSQvHRlRAL~LL~RFLDlGpWAV~LaLsVGIFPY-VLKLLQS~a~EL  528 (1387)
T KOG1517         453 QLTAFEVWLDYGSESRTP-PEQLPIVLQ--VLLSQVHRLRALVLLARFLDLGPWAVDLALSVGIFPY-VLKLLQSSAREL  528 (1387)
T ss_pred             HHHHHHHHHHHCCCCCCC-HHHCCHHHH--HHHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCCHHHH-HHHHHCCCHHHH
T ss_conf             778999998706546898-375453999--9999989999999999876343145344200143799-999861663764


Q ss_pred             CHHHHHHHHHHHHHHH-------------HHHHHHHCCC-CCCCHHHHHHHHHHHHHHHHHHHHHHHH-----------H
Q ss_conf             0278999999999999-------------9999975288-7746899999999689999999878799-----------9
Q gi|254780483|r  484 LPGFMHVGIWPIIMSL-------------SMFIQMKMSP-PPADKGQAMILNWMPVVFVFALSSFPAG-----------L  538 (581)
Q Consensus       484 ~~~~~~~~ilp~l~~~-------------~m~~~~k~~p-~~~d~~q~~~~~~mp~~~~~~~~~~~~g-----------l  538 (581)
                      -|.  .+-|+.=++++             -+++-|-+.| +..+|.|+.|-.|   +...+..+|+-|           +
T Consensus       529 rpi--LVFIWAKILAvD~SCQ~dLvKe~g~~YF~~vL~~~~~~~~EqrtmaAF---VLAviv~nf~lGQ~acl~~~li~i  603 (1387)
T KOG1517         529 RPI--LVFIWAKILAVDPSCQADLVKENGYKYFLQVLDPSQAIPPEQRTMAAF---VLAVIVRNFKLGQKACLNGNLIGI  603 (1387)
T ss_pred             HHH--HHHHHHHHHHCCCHHHHHHHHCCCCEEEEEEECCCCCCCHHHHHHHHH---HHHHHHCCCCHHHHHHCCCCHHHH
T ss_conf             255--999889987148414788886067616899816767799888889999---999998154046787616218899


Q ss_pred             HHHHHHHHHHHHHHHHH------------HHHHCCCCCCHHHHHHHHH
Q ss_conf             99999999999999999------------9874799834798988885
Q gi|254780483|r  539 IIYWSWSNVISIVQQAV------------IMKMHGAEIGLIDRLRSTF  574 (581)
Q Consensus       539 ~~y~~~~~~~~~~qq~~------------i~~~~~~~~~~~~~~~~~~  574 (581)
                      +|+-....-..++-||+            -.|-+|.+.....++-.-+
T Consensus       604 Cle~lnd~~~pLLrQW~~icLG~LW~d~~~Arw~G~r~~AhekL~~~L  651 (1387)
T KOG1517         604 CLEHLNDDPEPLLRQWLCICLGRLWEDYDEARWSGRRDNAHEKLILLL  651 (1387)
T ss_pred             HHHHHCCCCCHHHHHHHHHHHHHHHHHCCHHHHCCCCCCHHHHHHHHH
T ss_conf             888743883079999999998887630626431040001789999985


No 119
>PRK12417 secY preprotein translocase subunit SecY; Reviewed
Probab=21.98  E-value=40  Score=12.02  Aligned_cols=14  Identities=50%  Similarity=0.883  Sum_probs=8.6

Q ss_pred             HHHCCCCHHHHHHHH
Q ss_conf             850487867889999
Q gi|254780483|r  419 YKTHNINPLAGCWPI  433 (581)
Q Consensus       419 y~~~~vnP~~GClP~  433 (581)
                      |=--|||| +|..|.
T Consensus       227 ylPlKvN~-aGVmPi  240 (399)
T PRK12417        227 YLSIKVNP-AGGIPI  240 (399)
T ss_pred             EEEEEECC-CCCHHH
T ss_conf             56675245-553189


No 120
>PRK13703 conjugal pilus assembly protein TraF; Provisional
Probab=21.92  E-value=40  Score=12.02  Aligned_cols=26  Identities=15%  Similarity=0.300  Sum_probs=15.2

Q ss_pred             HHHHHHHHHHHHHH------HHHHHHCCCCCCC
Q ss_conf             78999999999999------9997513789887
Q gi|254780483|r    5 WNYFVAIALSVIIV------YAWQNFYVYPRIE   31 (581)
Q Consensus         5 Kn~iIai~Ls~~il------l~w~~~~~~p~~e   31 (581)
                      ++.+++++|+..+.      -|| +||+.|..+
T Consensus         2 ~~~~~~~~l~~~~~~~~~k~~Gw-~WYnep~~~   33 (247)
T PRK13703          2 NKALLPLLLCCFIFPASGKDAGW-QWYNEKINP   33 (247)
T ss_pred             CHHHHHHHHHHHHCCCCCCCCCC-EECCCCCCC
T ss_conf             33699999998717655688761-421788666


No 121
>COG3976 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=21.90  E-value=40  Score=12.01  Aligned_cols=26  Identities=15%  Similarity=0.188  Sum_probs=20.4

Q ss_pred             CCEEEEEEECCCCEEEEEEECCCCCC
Q ss_conf             66499999769955999995357134
Q gi|254780483|r   75 NPSLIGSINLKGAQFDDLNLRGYHLD  100 (581)
Q Consensus        75 nd~l~i~is~~GG~I~~~~LK~Y~~~  100 (581)
                      +..+.+.+.-+||+|..++|.+|+++
T Consensus        61 ~g~lqv~vtIk~grItaikvl~h~~d   86 (135)
T COG3976          61 YGILQVQVTIKGGRITAIKVLKHPSD   86 (135)
T ss_pred             CCEEEEEEEEECCCEEEEEEECCCCC
T ss_conf             42689999982583888998448887


No 122
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion]
Probab=21.72  E-value=41  Score=11.99  Aligned_cols=16  Identities=38%  Similarity=0.694  Sum_probs=7.3

Q ss_pred             HHHHHHHHHHHHHHHH
Q ss_conf             9999999999999751
Q gi|254780483|r    9 VAIALSVIIVYAWQNF   24 (581)
Q Consensus         9 Iai~Ls~~ill~w~~~   24 (581)
                      ++++|+.++-..|.+.
T Consensus        21 ~~itl~~~~ss~w~y~   36 (275)
T COG3031          21 LAITLSVFLSSFWLYY   36 (275)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999999885


No 123
>pfam05934 MCLC Mid-1-related chloride channel (MCLC). This family consists of several mid-1-related chloride channels. mid-1-related chloride channel (MCLC) proteins function as a chloride channel when incorporated in the planar lipid bilayer.
Probab=21.46  E-value=35  Score=12.42  Aligned_cols=13  Identities=23%  Similarity=0.557  Sum_probs=9.0

Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             9999999999999
Q gi|254780483|r  430 CWPILLQIPVFFA  442 (581)
Q Consensus       430 ClP~l~q~p~~~a  442 (581)
                      -+|+++|+|++|-
T Consensus       349 eiPv~l~iPVLi~  361 (577)
T pfam05934       349 EIPAFFHLPVLIF  361 (577)
T ss_pred             HCCHHHCCHHHHH
T ss_conf             3626520369999


No 124
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only]
Probab=20.97  E-value=42  Score=11.88  Aligned_cols=50  Identities=18%  Similarity=0.334  Sum_probs=26.5

Q ss_pred             EEEECCEEEEEEECCCCEEEEEEECC-CCCCCCCCCCCEEEECCCCCCCCCEEEEECC
Q ss_conf             89976649999976995599999535-7134478877268854566655310000013
Q gi|254780483|r   71 VELKNPSLIGSINLKGAQFDDLNLRG-YHLDVSSNSPIVTLLSPSNTKNAYFAELDYV  127 (581)
Q Consensus        71 I~Iend~l~i~is~~GG~I~~~~LK~-Y~~~~~~ds~~v~Ll~~~~~~~~y~~~~G~~  127 (581)
                      -...++-+.+++|..|    +++.+. |.  .+...|.+.....++.. .+.-.+.|.
T Consensus        72 ~~~~~e~Lt~~V~~dg----slk~tGk~~--Kd~~nP~I~~gfe~n~~-s~~~~s~wl  122 (288)
T COG4814          72 YKAGTESLTMTVDVDG----SLKVTGKIS--KDAKNPIIEFGFEDNTA-SGLDQSKWL  122 (288)
T ss_pred             CCCCCCCEEEEECCCC----CEEEEEEEC--CCCCCCEEEEEEECCCC-CHHHHHHHH
T ss_conf             1334565699981788----378856613--45778718999863867-624578999


No 125
>KOG0637 consensus
Probab=20.76  E-value=42  Score=11.85  Aligned_cols=69  Identities=19%  Similarity=0.380  Sum_probs=47.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999988899999999999888778889999973145115678999999985048786788999999999999999
Q gi|254780483|r  365 MLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIY  444 (581)
Q Consensus       365 IllTilikli~~PLt~ks~~Sm~kM~~lqP~i~~i~ekyk~d~~~~~~~e~m~ly~~~~vnP~~GClP~l~q~p~~~a~~  444 (581)
                      -+.|++-.+-.+|...--...|.+            |-|.+||...-+.|.+++|. +||-  -||+-+.++-++ -++|
T Consensus       285 ~i~~lltW~a~f~f~LF~TDfmG~------------~vy~GDp~a~~~S~a~~~Y~-~GV~--~G~~GL~ins~~-lgi~  348 (498)
T KOG0637         285 LIVTLLTWIAWFPFLLFDTDFMGR------------EVYGGDPKADENSEAKKLYN-AGVR--MGCLGLMLNSIV-LGIY  348 (498)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCH------------HHHCCCCCCCCCHHHHHHHH-HCCC--CCHHHHHHHHHH-HHHH
T ss_conf             999999999999999998886045------------76578999995266899887-4344--235899998899-9999


Q ss_pred             HHHHH
Q ss_conf             99987
Q gi|254780483|r  445 KVISI  449 (581)
Q Consensus       445 ~~~~~  449 (581)
                      ..+..
T Consensus       349 S~~~~  353 (498)
T KOG0637         349 SLLVE  353 (498)
T ss_pred             HHHHH
T ss_conf             99999


No 126
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism]
Probab=20.63  E-value=30  Score=12.93  Aligned_cols=14  Identities=14%  Similarity=0.121  Sum_probs=8.5

Q ss_pred             CCCEEEEEEECCCC
Q ss_conf             99559999953571
Q gi|254780483|r   85 KGAQFDDLNLRGYH   98 (581)
Q Consensus        85 ~GG~I~~~~LK~Y~   98 (581)
                      -||+......++++
T Consensus       127 DG~D~~~~vh~~~~  140 (420)
T COG0499         127 DGGDLTKLVHLERP  140 (420)
T ss_pred             CCCCEEEEEECCCH
T ss_conf             47320210000548


No 127
>pfam04744 Monooxygenase_B Monooxygenase subunit B protein. Family of membrane associated monooxygenases (EC 1.13.12.-) which utilize O(2) to oxidize their substrate. Family members include both ammonia and methane monooxygenases involved in the oxidation of their respective substrates. These enzymes are multi-subunit complexes. This family represents the B subunit of the enzyme; the A subunit is thought to contain the active site..
Probab=20.46  E-value=43  Score=11.81  Aligned_cols=26  Identities=23%  Similarity=0.194  Sum_probs=10.6

Q ss_pred             CCCCCCEEEEEEEEEEECHHHHHHHH
Q ss_conf             45788603678998850002788763
Q gi|254780483|r  295 TILPGKSITTTNFLFAGAKEFPTIHH  320 (581)
Q Consensus       295 ~i~pg~~~~~~~~lY~GPk~~~~L~~  320 (581)
                      .|+||++.+.+...==..=|.++|..
T Consensus       320 pI~PGETk~v~v~a~dA~WEveRLs~  345 (381)
T pfam04744       320 PIAPGETKTVDVEAKDAAWEVQRLSD  345 (381)
T ss_pred             CCCCCCCEEEEEEEECHHHHHHHHHH
T ss_conf             76999625899997301455998887


No 128
>pfam05829 Adeno_PX Adenovirus late L2 mu core protein (Protein X). This family consists of several Adenovirus late L2 mu core protein or Protein X sequences.
Probab=20.38  E-value=36  Score=12.40  Aligned_cols=14  Identities=36%  Similarity=0.719  Sum_probs=6.9

Q ss_pred             HHHHHHHHHHHHHHHH
Q ss_conf             8899999999999999
Q gi|254780483|r  428 AGCWPILLQIPVFFAI  443 (581)
Q Consensus       428 ~GClP~l~q~p~~~a~  443 (581)
                      ||.||.|+  ||.-|.
T Consensus        14 GGfLPaLi--PiiAAa   27 (44)
T pfam05829        14 GGFLPALI--PIIAAA   27 (44)
T ss_pred             CCCHHHHH--HHHHHH
T ss_conf             66537899--999999


No 129
>PRK12722 transcriptional activator FlhC; Provisional
Probab=20.38  E-value=43  Score=11.80  Aligned_cols=36  Identities=28%  Similarity=0.681  Sum_probs=24.6

Q ss_pred             HHHHHHHHH-CCCCHHHHHHHH----------HHHHHHHHHHHHHHH
Q ss_conf             999999850-487867889999----------999999999999998
Q gi|254780483|r  413 KAMIQLYKT-HNINPLAGCWPI----------LLQIPVFFAIYKVIS  448 (581)
Q Consensus       413 ~e~m~ly~~-~~vnP~~GClP~----------l~q~p~~~a~~~~~~  448 (581)
                      .+..+|||+ +|++|=-|-||-          =|---+|+..|.++.
T Consensus        38 ~RLirLYkE~~G~sPPKGmLPfStDWFmtW~pNIHsSlF~n~y~~l~   84 (185)
T PRK12722         38 GRLIKLYKELRGVSPPKGMLPFSTDWFMTWEPNIHSSLFYNIYRFLL   84 (185)
T ss_pred             HHHHHHHHHHCCCCCCCCCCCCCHHHHHHHCHHHHHHHHHHHHHHHH
T ss_conf             99999999973899998788875889987020368999999999999


Done!