BLAST/PSIBLAST alignment of GI: 254780483 and GI: 116250222 at iteration 1
>gi|116250222|ref|YP_766060.1| inner membrane protein translocase component YidC [Rhizobium leguminosarum bv. viciae 3841] Length = 598
>gi|166977404|sp|Q1MM58|OXAA_RHIL3 RecName: Full=Inner membrane protein oxaA Length = 598
>gi|115254870|emb|CAK05944.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae 3841] Length = 598
 Score =  625 bits (1611), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 289/593 (48%), Positives = 386/593 (65%), Gaps = 17/593 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNI----------------QTVK 44
           ME N NYF+AIALSV+IV  WQ  Y+ PRIE     ++                  QT  
Sbjct: 2   MENNRNYFIAIALSVLIVLGWQFLYMNPRIEAQRKAQEAQKAQQQTEQVQQPAAGGQTPA 61

Query: 45  QPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
           Q +    S  A       QAL  SPRV +  P+L GSINL GA+ DDL L+GYH  V  +
Sbjct: 62  QTSGAAPSGQAAATATLEQALQKSPRVVIDTPALSGSINLAGARLDDLKLKGYHETVDDS 121

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           SPI+TL SP+ TK+ YF EL Y+ +     +P  +T+W    G  LT  TP+ L + N  
Sbjct: 122 SPIITLFSPAETKDGYFTELGYIGSDATGSVPGPSTLWTAPEGAKLTEKTPVTLSYTNDK 181

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVL 224
            + F RTIS+DE Y+F + D + N        S  GR+ R+   T  + + + EGFI V+
Sbjct: 182 GLTFTRTISVDERYMFTVADKIENTGQAPAALSSYGRVTRYNKPTTPSVYVLHEGFIGVI 241

Query: 225 GDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR 284
           GD  L+E KYS +EK +++    +  WLGI+DKYWA+  +P +  ++ + F Y +DG  R
Sbjct: 242 GDDGLIETKYSAVEKEAVAPAKSTGGWLGITDKYWAATIVPPQSAAYEAHFSYFADGQPR 301

Query: 285 YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAK 344
           YQA +  +  T+ PG+SI   N +FAGAKE P I  YE   +IP+F+ LIDWGWFYFI K
Sbjct: 302 YQADYKDDAFTVAPGQSIELKNLVFAGAKEVPVIDGYEASYSIPKFDRLIDWGWFYFITK 361

Query: 345 PMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK 404
           PMF LM +F+   GNFG+AI+ TT+ VK LFFPLA KQY S ANMK +QPK++EL+ KF 
Sbjct: 362 PMFKLMDFFFRYFGNFGVAILCTTIVVKALFFPLASKQYASMANMKRMQPKMEELKAKFA 421

Query: 405 QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKD 464
                 LQ+A +QLYK   INP+AGCWP+ LQIP+FF++YKVI I++EMRHAPF+GWIKD
Sbjct: 422 DD-RMGLQQATMQLYKEEKINPIAGCWPVALQIPIFFSLYKVIYITIEMRHAPFFGWIKD 480

Query: 465 LAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMP 524
           L+A DPT I  LFG+LPF  P  +H+G+WP+IM ++MF+QM+M+P P D  QAMI NWMP
Sbjct: