BLAST/PSIBLAST alignment of GI: 254780483 and GI: 222147367 at iteration 1
>gi|222147367|ref|YP_002548324.1| putative inner membrane protein translocase component YidC [Agrobacterium vitis S4] Length = 620
>gi|254772742|sp|B9JZK8|OXAA_AGRVS RecName: Full=Inner membrane protein oxaA Length = 620
>gi|221734357|gb|ACM35320.1| inner membrane insertion protein [Agrobacterium vitis S4] Length = 620
 Score =  616 bits (1589), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 296/615 (48%), Positives = 397/615 (64%), Gaps = 39/615 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNER--------KNIQTVKQPNQVDNS 52
           ME N NY +AIALSV++V  WQ FY+ PRIE              K   T   P    N 
Sbjct: 2   MENNRNYLIAIALSVMVVLGWQFFYMNPRIEAQRQAEQAQQAQQAKTPATQATPGAAVNG 61

Query: 53  -----YAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPI 107
                  A     R  A++ S RVE+   +L GSINL GA+ DDL L+GYH  V   SPI
Sbjct: 62  ALPGQTQASATTSREDAVAKSARVEINTEALSGSINLTGARLDDLRLKGYHETVDKTSPI 121

Query: 108 VTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNIL 167
           +TLL+P++TK+ YFAE+ ++    +  +P  +TVW +  G+ LT TTP+ L + N   + 
Sbjct: 122 ITLLNPADTKDGYFAEIGFIGGEKSGSVPGPSTVWTVKDGQTLTETTPVTLTYTNETGLT 181

Query: 168 FERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDK 227
           F R IS+D+HY+F I DTV N     I  +P GR+ R+      +T+ + EGFI V+G  
Sbjct: 182 FSRKISVDKHYMFTIEDTVANAGGADISLAPYGRVTRYNKPAVASTYVLHEGFIGVMGSG 241

Query: 228 ----SLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
               + VE KY+ IEK + +N   +  WLGI+DKYWA+  +P +  ++ S+F + +DG A
Sbjct: 242 DGKFASVEAKYAAIEKENETNAKATGGWLGITDKYWAATLVPPQSLAYDSRFSHFTDGQA 301

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLA----------------- 326
           R+QA +  + +TI PG+S T    LFAGAKE P +  Y  D +                 
Sbjct: 302 RFQADYKNDPVTIAPGQSTTLKTLLFAGAKEVPVVDGYALDKSWFGQAFTNLFAGAKDTV 361

Query: 327 ----IPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQ 382
               IPRF++LIDWGWFYF+ KPMF LM +F+  VGNFG+AI+LTT+ VKLLFFPLA KQ
Sbjct: 362 QQYDIPRFDLLIDWGWFYFLTKPMFKLMDFFFRQVGNFGVAILLTTIAVKLLFFPLASKQ 421

Query: 383 YVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFA 442
           Y S ANMK +QPK++EL+ K        LQ+AM++LYKT  INP+AGCWP+LLQIPVFFA
Sbjct: 422 YASMANMKRMQPKMEELKAKHGDDR-MALQQAMMELYKTEKINPVAGCWPLLLQIPVFFA 480

Query: 443 IYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMF 502
           +YKVI I++EMRHAPF+GWI DL+A DPT+   LFG+LPF  P  +H+GIWPIIM ++MF
Sbjct: 481 LYKVIYITIEMRHAPFFGWIHDLSAPDPTSFVNLFGLLPFESPAMLHLGIWPIIMGITMF 540

Query: 503 IQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           +QM+M+P P D  QAM+ NWMP+VF F L SFPAGL+IYW+W+N +S++QQ++IMK HG 
Sbjct: 541 VQMRMNPTPPDPTQAMLFNWMPLVFTFMLGSFPAGLVIYWAWNNTLSVLQQSIIMKRHGV 600

Query: 563 EIGLIDRLRSTFSKN 577
           +I L D L+  F + 
Sbjct: 601 KIELFDNLKGLFQRK 615