BLAST/PSIBLAST alignment of GI: 254780483 and GI: 86356094 at iteration 1
>gi|86356094|ref|YP_467986.1| putative inner membrane protein translocase component YidC [Rhizobium etli CFN 42] Length = 597
>gi|86280196|gb|ABC89259.1| putative inner membrane transmembrane protein [Rhizobium etli CFN 42] Length = 597
 Score =  636 bits (1640), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 293/593 (49%), Positives = 391/593 (65%), Gaps = 17/593 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNI----------------QTVK 44
           ME N NYF+AIALSV+IV  WQ  Y+ PRIE     ++                  Q   
Sbjct: 1   MENNRNYFIAIALSVLIVLGWQFLYMNPRIEAQRKAQEAQKAQQQTEQTQQPAAGGQAPA 60

Query: 45  QPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
           Q +    S  A     R QAL  +PR+ +   +L GSINL GA+ DDL L+GYH  V  +
Sbjct: 61  QTSGAAPSGQAAATATREQALEKTPRIAIDTAALSGSINLAGARLDDLKLKGYHETVDDS 120

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           SP +TL SP+ TK+ YF EL Y+ +     +P  +T+W    G  LT  TP+ L + N  
Sbjct: 121 SPTITLFSPAETKDGYFTELGYIGSDTTGAVPGPSTLWTAPEGAKLTEKTPVTLSYTNDK 180

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVL 224
            + F RTIS+DE Y+F + D + N        S  GR+MR+   T  + + + EGFI V+
Sbjct: 181 GLTFTRTISVDERYMFTVADKIENTGQAPAALSSYGRVMRYNKPTTPSVYVLHEGFIGVI 240

Query: 225 GDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR 284
           GD  L+E KYS +EK ++S    +  WLGI+DKYWA+  +P + +++ ++F Y SDG  R
Sbjct: 241 GDDGLIESKYSAVEKEAVSPAKSAGGWLGITDKYWAATIVPPQSSAYEAKFSYFSDGQPR 300

Query: 285 YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAK 344
           YQA +  +  ++ PG+SI   N +FAGAKE P I  YE   +IP+F+ LIDWGWFYFI K
Sbjct: 301 YQADYKNDAFSVAPGQSIELKNLVFAGAKEVPVIDGYEASYSIPKFDRLIDWGWFYFITK 360

Query: 345 PMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK 404
           PMF LM +FY   GNFG+AI+ TT+ VK LFFPLA KQY S ANMK +QPK++EL+ KF 
Sbjct: 361 PMFKLMDFFYRFFGNFGVAILCTTIVVKALFFPLASKQYASMANMKRMQPKMEELKAKFG 420

Query: 405 QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKD 464
                 LQ+AM+QLYK   INP+AGCWP+ LQIP+FF++YKVI I++EMRHAPF+GWIKD
Sbjct: 421 DD-RMGLQQAMMQLYKDEKINPIAGCWPVALQIPIFFSLYKVIYITIEMRHAPFFGWIKD 479

Query: 465 LAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMP 524
           L+A DPT I  LFG+LPF  P F+H+G+WP+IM ++MF+QM+M+P P D  QAMI NWMP
Sbjct: 480 LSAPDPTTIVNLFGLLPFEAPTFLHLGVWPLIMGVTMFLQMRMNPTPPDPTQAMIFNWMP 539

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQ