BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780483|ref|YP_003064896.1| putative inner membrane
protein translocase component YidC [Candidatus Liberibacter asiaticus
str. psy62]
         (581 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780483|ref|YP_003064896.1| putative inner membrane protein translocase component YidC
           [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040160|gb|ACT56956.1| putative inner membrane protein translocase component YidC
           [Candidatus Liberibacter asiaticus str. psy62]
          Length = 581

 Score = 1192 bits (3085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/581 (100%), Positives = 581/581 (100%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD
Sbjct: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY
Sbjct: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF 180
           FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF
Sbjct: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF 180

Query: 181 KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS 240
           KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS
Sbjct: 181 KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS 240

Query: 241 SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGK 300
           SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGK
Sbjct: 241 SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGK 300

Query: 301 SITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF 360
           SITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF
Sbjct: 301 SITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF 360

Query: 361 GIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYK 420
           GIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYK
Sbjct: 361 GIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYK 420

Query: 421 THNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL 480
           THNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL
Sbjct: 421 THNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL 480

Query: 481 PFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLII 540
           PFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLII
Sbjct: 481 PFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLII 540

Query: 541 YWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ 581
           YWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ
Sbjct: 541 YWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ 581


>gi|315122061|ref|YP_004062550.1| putative inner membrane protein translocase component YidC
           [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495463|gb|ADR52062.1| putative inner membrane protein translocase component YidC
           [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 578

 Score =  923 bits (2385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/581 (76%), Positives = 501/581 (86%), Gaps = 3/581 (0%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           ME+NWNYF AIA+SV IVY WQ  YV PRIE +   +K   T+++   + N+   V ID+
Sbjct: 1   MEKNWNYFAAIAISVAIVYVWQLVYVQPRIEAIKEGKKTPLTIEK-QSIQNT--IVPIDN 57

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           RAQALS SPRVE+ +PSL GSINLKGAQFDDL+L+GY +DVS NSP+V LL+P NT+NAY
Sbjct: 58  RAQALSRSPRVEINSPSLAGSINLKGAQFDDLSLKGYRVDVSRNSPMVALLNPLNTENAY 117

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF 180
           FAEL+Y+ST N    PN NTVWNL+SG++LTP++PIKL FK+ANNILFER ISLDE+YLF
Sbjct: 118 FAELNYISTTNTTVFPNENTVWNLVSGQVLTPSSPIKLAFKSANNILFERIISLDENYLF 177

Query: 181 KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS 240
            IVDT+TNN  + I FSP G+I R+K Q  +N+FGVQEGFIAVLGD+SL+E+KYSDIEKS
Sbjct: 178 TIVDTITNNGTNLISFSPYGKITRYKLQKESNSFGVQEGFIAVLGDQSLIEKKYSDIEKS 237

Query: 241 SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGK 300
           S+SNFHESNSWLGISDKYWAS FIP KE SF S+F Y SDG ARYQA F  NEI + PGK
Sbjct: 238 SVSNFHESNSWLGISDKYWASAFIPPKEKSFQSRFDYFSDGRARYQANFKINEIILSPGK 297

Query: 301 SITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF 360
           S  TTN LF GAKE P I HYEK+L IPRFEMLIDWGWFYFIAKPMF LMSYFYNLVGNF
Sbjct: 298 STKTTNSLFVGAKELPIIQHYEKELEIPRFEMLIDWGWFYFIAKPMFALMSYFYNLVGNF 357

Query: 361 GIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYK 420
           GIAIMLTT+FVK LFFPLAKKQYVSTANMKNIQPKID LREKFKQ+ PQVLQK M+QLYK
Sbjct: 358 GIAIMLTTIFVKALFFPLAKKQYVSTANMKNIQPKIDALREKFKQASPQVLQKEMLQLYK 417

Query: 421 THNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL 480
           TH INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF+GWI+DLAA DPTNIFTLFGIL
Sbjct: 418 THKINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFFGWIQDLAAPDPTNIFTLFGIL 477

Query: 481 PFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLII 540
           PF LP F+HVGIWPIIMSLSMF+Q+KMSPPP DKGQA++LNWMPVVFVFALSSFPAGLII
Sbjct: 478 PFQLPEFIHVGIWPIIMSLSMFLQLKMSPPPTDKGQAIVLNWMPVVFVFALSSFPAGLII 537

Query: 541 YWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ 581
           YWSWSN+ISI+QQ VIMKM+GA+I +IDRLRS F+K+ NS+
Sbjct: 538 YWSWSNIISIIQQTVIMKMYGAKIDIIDRLRSMFAKSSNSK 578


>gi|86356094|ref|YP_467986.1| putative inner membrane protein translocase component YidC
           [Rhizobium etli CFN 42]
 gi|86280196|gb|ABC89259.1| putative inner membrane transmembrane protein [Rhizobium etli CFN
           42]
          Length = 597

 Score =  636 bits (1640), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 293/593 (49%), Positives = 391/593 (65%), Gaps = 17/593 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNI----------------QTVK 44
           ME N NYF+AIALSV+IV  WQ  Y+ PRIE     ++                  Q   
Sbjct: 1   MENNRNYFIAIALSVLIVLGWQFLYMNPRIEAQRKAQEAQKAQQQTEQTQQPAAGGQAPA 60

Query: 45  QPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
           Q +    S  A     R QAL  +PR+ +   +L GSINL GA+ DDL L+GYH  V  +
Sbjct: 61  QTSGAAPSGQAAATATREQALEKTPRIAIDTAALSGSINLAGARLDDLKLKGYHETVDDS 120

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           SP +TL SP+ TK+ YF EL Y+ +     +P  +T+W    G  LT  TP+ L + N  
Sbjct: 121 SPTITLFSPAETKDGYFTELGYIGSDTTGAVPGPSTLWTAPEGAKLTEKTPVTLSYTNDK 180

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVL 224
            + F RTIS+DE Y+F + D + N        S  GR+MR+   T  + + + EGFI V+
Sbjct: 181 GLTFTRTISVDERYMFTVADKIENTGQAPAALSSYGRVMRYNKPTTPSVYVLHEGFIGVI 240

Query: 225 GDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR 284
           GD  L+E KYS +EK ++S    +  WLGI+DKYWA+  +P + +++ ++F Y SDG  R
Sbjct: 241 GDDGLIESKYSAVEKEAVSPAKSAGGWLGITDKYWAATIVPPQSSAYEAKFSYFSDGQPR 300

Query: 285 YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAK 344
           YQA +  +  ++ PG+SI   N +FAGAKE P I  YE   +IP+F+ LIDWGWFYFI K
Sbjct: 301 YQADYKNDAFSVAPGQSIELKNLVFAGAKEVPVIDGYEASYSIPKFDRLIDWGWFYFITK 360

Query: 345 PMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK 404
           PMF LM +FY   GNFG+AI+ TT+ VK LFFPLA KQY S ANMK +QPK++EL+ KF 
Sbjct: 361 PMFKLMDFFYRFFGNFGVAILCTTIVVKALFFPLASKQYASMANMKRMQPKMEELKAKFG 420

Query: 405 QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKD 464
                 LQ+AM+QLYK   INP+AGCWP+ LQIP+FF++YKVI I++EMRHAPF+GWIKD
Sbjct: 421 DD-RMGLQQAMMQLYKDEKINPIAGCWPVALQIPIFFSLYKVIYITIEMRHAPFFGWIKD 479

Query: 465 LAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMP 524
           L+A DPT I  LFG+LPF  P F+H+G+WP+IM ++MF+QM+M+P P D  QAMI NWMP
Sbjct: 480 LSAPDPTTIVNLFGLLPFEAPTFLHLGVWPLIMGVTMFLQMRMNPTPPDPTQAMIFNWMP 539

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           +VF+F L+SFPAGL+IYW+W+N +S++QQ+VIMK HG +I L D LR  F + 
Sbjct: 540 LVFMFMLASFPAGLVIYWAWNNTLSVIQQSVIMKRHGVKIELFDNLRGLFRRK 592


>gi|150395307|ref|YP_001325774.1| putative inner membrane protein translocase component YidC
           [Sinorhizobium medicae WSM419]
 gi|166977420|sp|A6U5K9|OXAA_SINMW RecName: Full=Inner membrane protein oxaA
 gi|150026822|gb|ABR58939.1| 60 kDa inner membrane insertion protein [Sinorhizobium medicae
           WSM419]
          Length = 597

 Score =  627 bits (1617), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 294/592 (49%), Positives = 399/592 (67%), Gaps = 16/592 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMN-NERKNIQTVKQPN--QVDNSYAA-- 55
           ME N NYFVAIALSV+I+ AWQ FYV P++E+      K  Q   QP   Q     AA  
Sbjct: 2   MENNRNYFVAIALSVLILIAWQFFYVSPKMEKDRIAAEKAQQAQSQPGTQQAAPGQAAPG 61

Query: 56  ---------VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSP 106
                       + R QA+  S RV +  P+L GSINL GA+FDDL L+GY   V   SP
Sbjct: 62  QALPGGAIPSAAESRDQAIGKSARVAIDTPALSGSINLTGARFDDLKLKGYRETVDPKSP 121

Query: 107 IVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNI 166
           ++TL SP+ T + YF E+ Y+ +     +P   TVW L  G  LTP+TP+ L + N   I
Sbjct: 122 VITLFSPAETADGYFTEIGYIGSDATGSVPGPQTVWMLSGGDKLTPSTPVTLSYTNDKGI 181

Query: 167 LFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGD 226
            F RTIS+D+ Y+F++VD++ N++   +  S  GR+ R    +  + + + EGF+ V G+
Sbjct: 182 TFTRTISVDDRYMFEVVDSIKNDAAAAVSLSSYGRVTRFNKPSTPSIYVLHEGFVGVAGE 241

Query: 227 KSLVEQKYSDIE-KSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARY 285
             L E  YSD+E +  +     +  WLGI+DKYWA+  +P ++T F  +F + +DG  RY
Sbjct: 242 HGLQEVGYSDVEDEEPVEPGKSTGGWLGITDKYWAATIVPPQDTPFDIRFSHFADGRPRY 301

Query: 286 QAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKP 345
           Q+ + ++ +T+ PG+S    N +FAGAKE P + +YE   +IP F+ LIDWGWFYFI KP
Sbjct: 302 QSDYKSDAVTVAPGQSAEVKNLIFAGAKEVPVVDNYELTYSIPNFDKLIDWGWFYFITKP 361

Query: 346 MFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQ 405
           MF +M +F+ L GNFGIAI++TT+ VKL+FFPLA KQY S ANMK +QPK++EL++KF  
Sbjct: 362 MFKMMDFFFRLFGNFGIAILITTIVVKLIFFPLANKQYASMANMKKVQPKMEELKKKFGD 421

Query: 406 SPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDL 465
                LQ+AM+QLYK   INPLAGCWPIL+QIPVFFA+YKVI +++EMRHAPF+GWI+DL
Sbjct: 422 DR-MGLQQAMMQLYKEEKINPLAGCWPILIQIPVFFALYKVIYVTIEMRHAPFFGWIQDL 480

Query: 466 AAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPV 525
           +A DPT I  LFG+LPF  P F+H+GIWPI+M ++MF+QM+M+P P D  QAM+  WMPV
Sbjct: 481 SAPDPTTIINLFGLLPFEGPAFLHLGIWPIVMGVTMFLQMRMNPTPPDPTQAMLFTWMPV 540

Query: 526 VFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           VF F L+SFPAGL+IYW+W+N +SI+QQ +IMK  G ++ L D L+S FSK 
Sbjct: 541 VFTFMLASFPAGLVIYWAWNNTLSILQQGIIMKRQGVKVELFDNLKSLFSKK 592


>gi|209547692|ref|YP_002279609.1| inner membrane protein translocase component YidC [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209533448|gb|ACI53383.1| 60 kDa inner membrane insertion protein [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 597

 Score =  626 bits (1614), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 288/593 (48%), Positives = 391/593 (65%), Gaps = 17/593 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDN--------- 51
           ME+N NYF+AIALSV+IV  WQ  Y+ PRIE     ++  +  ++  QV           
Sbjct: 1   MEKNRNYFIAIALSVLIVLGWQFLYMNPRIEAQRKAQEAQKAQQKTEQVQQPAANGAAPA 60

Query: 52  -------SYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
                  S  AV      QAL+ +PRV +  P+L GSINL GA+ DDL L+GYH  V  +
Sbjct: 61  PTSGTAPSGQAVATATLEQALAKNPRVVIDTPALSGSINLAGARLDDLKLKGYHETVDDS 120

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           SP +TL SP+ TK+ YF EL Y+ +     +P ++T+W    G  LT  TP+ L + N  
Sbjct: 121 SPTITLFSPAETKDGYFTELGYIGSDATGNVPGASTLWTAPEGAKLTDKTPVTLSYTNDK 180

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVL 224
            + F RTIS+DE Y+F + D V N     +  S  GR+ R+   T  + + + EGFI V+
Sbjct: 181 GLTFTRTISVDERYMFTVADKVENTGQAPVSLSSYGRVTRYNKPTTPSVYVLHEGFIGVI 240

Query: 225 GDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR 284
           GD  LVE KY+  EK ++     +  WLGI+DKYWA+  IP + +++ ++F + +DG  R
Sbjct: 241 GDDGLVETKYTAAEKEAVMPPKSTGGWLGITDKYWAATIIPPQTSAYEARFSHFADGQPR 300

Query: 285 YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAK 344
           YQA +  +  T+ PG+SI   N +FAGAKE P I  YE   +IP+F+ LIDWGWFYFI K
Sbjct: 301 YQADYKDDAFTVAPGQSIELKNLVFAGAKEVPVIDGYETSYSIPKFDRLIDWGWFYFITK 360

Query: 345 PMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK 404
           PMF LM +FY   GNFG+AI+ TT+ VK LFFPLA KQY S ANMK +QPK++EL+ KF 
Sbjct: 361 PMFKLMDFFYRFFGNFGVAILCTTIVVKALFFPLASKQYASMANMKRMQPKMEELKAKFA 420

Query: 405 QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKD 464
                 LQ+A +QLYK   INP+AGCWP+ LQIP+FF++YKVI I++EMRHAPF+GWIKD
Sbjct: 421 DD-RMGLQQATMQLYKEEKINPIAGCWPVALQIPIFFSLYKVIYITIEMRHAPFFGWIKD 479

Query: 465 LAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMP 524
           L+A DPT I  LFG+LPF  P  +H+G+WP+IM ++MF+QM+M+P P D  QAMI  WMP
Sbjct: 480 LSAPDPTTIVNLFGLLPFEAPTILHLGVWPLIMGVTMFLQMRMNPTPPDPTQAMIFTWMP 539

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           +VF+F L+SFPAGL+IYW+W+N +S++QQ+VIMK  G ++ L D L+  F + 
Sbjct: 540 LVFMFMLASFPAGLVIYWAWNNTLSVIQQSVIMKRQGVKVELFDNLKGLFRRK 592


>gi|116250222|ref|YP_766060.1| inner membrane protein translocase component YidC [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|166977404|sp|Q1MM58|OXAA_RHIL3 RecName: Full=Inner membrane protein oxaA
 gi|115254870|emb|CAK05944.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 598

 Score =  625 bits (1611), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 289/593 (48%), Positives = 386/593 (65%), Gaps = 17/593 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNI----------------QTVK 44
           ME N NYF+AIALSV+IV  WQ  Y+ PRIE     ++                  QT  
Sbjct: 2   MENNRNYFIAIALSVLIVLGWQFLYMNPRIEAQRKAQEAQKAQQQTEQVQQPAAGGQTPA 61

Query: 45  QPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
           Q +    S  A       QAL  SPRV +  P+L GSINL GA+ DDL L+GYH  V  +
Sbjct: 62  QTSGAAPSGQAAATATLEQALQKSPRVVIDTPALSGSINLAGARLDDLKLKGYHETVDDS 121

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           SPI+TL SP+ TK+ YF EL Y+ +     +P  +T+W    G  LT  TP+ L + N  
Sbjct: 122 SPIITLFSPAETKDGYFTELGYIGSDATGSVPGPSTLWTAPEGAKLTEKTPVTLSYTNDK 181

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVL 224
            + F RTIS+DE Y+F + D + N        S  GR+ R+   T  + + + EGFI V+
Sbjct: 182 GLTFTRTISVDERYMFTVADKIENTGQAPAALSSYGRVTRYNKPTTPSVYVLHEGFIGVI 241

Query: 225 GDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR 284
           GD  L+E KYS +EK +++    +  WLGI+DKYWA+  +P +  ++ + F Y +DG  R
Sbjct: 242 GDDGLIETKYSAVEKEAVAPAKSTGGWLGITDKYWAATIVPPQSAAYEAHFSYFADGQPR 301

Query: 285 YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAK 344
           YQA +  +  T+ PG+SI   N +FAGAKE P I  YE   +IP+F+ LIDWGWFYFI K
Sbjct: 302 YQADYKDDAFTVAPGQSIELKNLVFAGAKEVPVIDGYEASYSIPKFDRLIDWGWFYFITK 361

Query: 345 PMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK 404
           PMF LM +F+   GNFG+AI+ TT+ VK LFFPLA KQY S ANMK +QPK++EL+ KF 
Sbjct: 362 PMFKLMDFFFRYFGNFGVAILCTTIVVKALFFPLASKQYASMANMKRMQPKMEELKAKFA 421

Query: 405 QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKD 464
                 LQ+A +QLYK   INP+AGCWP+ LQIP+FF++YKVI I++EMRHAPF+GWIKD
Sbjct: 422 DD-RMGLQQATMQLYKEEKINPIAGCWPVALQIPIFFSLYKVIYITIEMRHAPFFGWIKD 480

Query: 465 LAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMP 524
           L+A DPT I  LFG+LPF  P  +H+G+WP+IM ++MF+QM+M+P P D  QAMI NWMP
Sbjct: 481 LSAPDPTTIVNLFGLLPFEGPTLLHLGVWPLIMGVTMFVQMRMNPTPPDPTQAMIFNWMP 540

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           +VF+F L+SFPAGL+IYW+W+N +S+ QQ +IMK HG ++ L D L+  F + 
Sbjct: 541 LVFMFMLASFPAGLVIYWAWNNTLSVAQQGLIMKRHGVKVELFDNLKGLFRRK 593


>gi|222084728|ref|YP_002543257.1| preprotein translocase 60 kD membrane subunit [Agrobacterium
           radiobacter K84]
 gi|221722176|gb|ACM25332.1| preprotein translocase 60 kD membrane subunit [Agrobacterium
           radiobacter K84]
          Length = 600

 Score =  622 bits (1604), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 285/596 (47%), Positives = 393/596 (65%), Gaps = 20/596 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMN-------------------NERKNIQ 41
           ME   NYF+AIALSV+IV AWQ FY+ PR+E                      N      
Sbjct: 1   MENKRNYFIAIALSVLIVLAWQFFYMNPRLEAQRKAEQAAKLQQQTQQAQTTQNPAAGAT 60

Query: 42  TVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDV 101
                     S    L  D++ A S + RV +  P+L GSINL+GA+FDDL L+ YH  V
Sbjct: 61  VDGAAPSSGQSAPTTLTHDQSVAKSAASRVAIDTPALSGSINLEGARFDDLQLKAYHETV 120

Query: 102 SSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFK 161
             +SPI+TL SP++TK+ YF EL YV +     +P  +TVW L SG  LT +TP+ L + 
Sbjct: 121 DKSSPIITLFSPADTKDGYFTELGYVGSDATGAVPGPSTVWTLASGSKLTDSTPVTLSYT 180

Query: 162 NANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFI 221
           N   I F RT+S+DE Y+F I D + N+    +  S  GR+ R+   T  + + + EGFI
Sbjct: 181 NDKGITFTRTVSVDERYMFTITDKIANSGQAPVSLSSYGRVTRYNKPTTPSAYVLHEGFI 240

Query: 222 AVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDG 281
            V+GD  L+E KY+  EK +++    +  WLGI+DKYWA+  +P +  ++ + F + +DG
Sbjct: 241 GVIGDDGLIETKYTAAEKEAVNPAKATGGWLGITDKYWAATIVPPQSGAYDAHFSHFADG 300

Query: 282 HARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYF 341
             RYQA +  + +T+ PG+S    + +FAGAKE P I  YE   +IP+F+ LIDWGWFYF
Sbjct: 301 QPRYQADYKQDAVTVAPGQSQELKSLVFAGAKEVPVIDRYETSYSIPKFDRLIDWGWFYF 360

Query: 342 IAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELRE 401
           I KPMF LM +F+   GNFG+AI+ TT+ VK LFFPLA KQY S ANMK +QPK++EL+ 
Sbjct: 361 ITKPMFKLMDFFFRYFGNFGVAILCTTIVVKGLFFPLASKQYASMANMKRMQPKMEELKA 420

Query: 402 KFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGW 461
           KF       LQ+A +QLYK   INP+AGCWP+LLQIP+FF++YKVI I++EMRHAPF+GW
Sbjct: 421 KFGDD-RMGLQQATMQLYKEEKINPIAGCWPVLLQIPIFFSLYKVIYITIEMRHAPFFGW 479

Query: 462 IKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILN 521
           I+DL+A DPT+I  LFG+LPF  P  +H+G+WP+IM ++MF+QM+M+P P D  QAMI N
Sbjct: 480 IQDLSAPDPTSIVNLFGLLPFTAPTILHLGVWPLIMGITMFLQMRMNPTPPDPTQAMIFN 539

Query: 522 WMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           WMP+VF+F L+SFPAGL+IYW+W+N +S++QQ++IMK HG ++ L D ++  F + 
Sbjct: 540 WMPLVFMFMLASFPAGLVIYWAWNNTLSVIQQSIIMKRHGVKVELFDNMKGLFKRK 595


>gi|241202849|ref|YP_002973945.1| inner membrane protein translocase component YidC [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240856739|gb|ACS54406.1| 60 kDa inner membrane insertion protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 597

 Score =  620 bits (1600), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 287/593 (48%), Positives = 385/593 (64%), Gaps = 17/593 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERK----------------NIQTVK 44
           ME N NYF+AIALSV+IV  WQ  Y+ PRIE     ++                  QT  
Sbjct: 1   MENNRNYFIAIALSVLIVLGWQFLYMNPRIEAQRKVQEAQKAQQQTEQVQQPAAGGQTPA 60

Query: 45  QPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
           QP+    +  A       QAL+ SPRV +   +L GSINL GA+ DDL L+GYH  V  +
Sbjct: 61  QPSGAAPTSQAAATATLEQALAKSPRVVIDTAALSGSINLAGARLDDLKLKGYHETVDDS 120

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           SPI+TL SP+ TK+ YF EL Y+ +     +P  +T+W    G  LT  TP+ L + N  
Sbjct: 121 SPIITLFSPAETKDGYFTELGYIGSDATGSVPGPSTLWTAPEGAKLTEKTPVTLSYTNDK 180

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVL 224
            + F RTIS+DE Y+F + D + N        +  GR+ R+   T  + + + EGFI V+
Sbjct: 181 GLTFTRTISVDERYMFTVADKIENAGQAPASLNSYGRVTRYNKPTTPSVYVLHEGFIGVI 240

Query: 225 GDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR 284
           GD  LVE KY+  EK ++     +  WLGI+DKYWA+  +P +   + + F + +DG  R
Sbjct: 241 GDDGLVETKYTAAEKEAVKPAKSTGGWLGITDKYWAATIVPPQSAPYEASFSHFADGQPR 300

Query: 285 YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAK 344
           YQA +  +  T+ PG+SI   N +FAGAKE P I  YE   +IP+F+ LIDWGWFYFI K
Sbjct: 301 YQADYKEDAFTVAPGQSIELKNLVFAGAKEVPVIDGYEASYSIPKFDRLIDWGWFYFITK 360

Query: 345 PMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK 404
           PMF LM +F+   GNFG+AI+ TT+ VKLLFFPLA KQY S ANMK +QPK++EL+ KF 
Sbjct: 361 PMFKLMDFFFRYFGNFGVAILCTTIVVKLLFFPLASKQYASMANMKRMQPKMEELKAKFA 420

Query: 405 QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKD 464
                 LQ+A +QLYK   INP+AGCWP+ LQIP+FF++YKVI I++EMRHAPF+GWIKD
Sbjct: 421 DD-RMGLQQATMQLYKEEKINPIAGCWPVALQIPIFFSLYKVIYITIEMRHAPFFGWIKD 479

Query: 465 LAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMP 524
           L+A DPT I  LFG+LPF  P  +H+G+WP+IM ++MF+QM+M+P P D  QAMI  WMP
Sbjct: 480 LSAPDPTTIVNLFGLLPFEAPTILHLGVWPLIMGVTMFLQMRMNPTPPDPTQAMIFTWMP 539

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           +VF+F L+SFPAGL+IYW+W+N +S+ QQ+VIMK HG ++ L D L+  F + 
Sbjct: 540 LVFMFMLASFPAGLVIYWAWNNTLSVAQQSVIMKRHGVKVELFDNLKGLFRRK 592


>gi|15964197|ref|NP_384550.1| putative inner membrane protein translocase component YidC
           [Sinorhizobium meliloti 1021]
 gi|15073373|emb|CAC41881.1| Putative inner-membrane transmembrane protein [Sinorhizobium
           meliloti 1021]
          Length = 595

 Score =  617 bits (1592), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 291/590 (49%), Positives = 395/590 (66%), Gaps = 14/590 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEE--------MNNERKNIQTVKQPNQVDNS 52
           ME N NYFVAIALSV+I+ AWQ FYV P++E+           ++   Q   QP     +
Sbjct: 2   MENNRNYFVAIALSVLILIAWQFFYVSPKMEKDRIAAEQAQQAQQTQQQPGAQPAAPGQA 61

Query: 53  YAAVLI----DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIV 108
                I    + R QA+  S RV +  P+L GSINL GA+FDDL L+GY   V   SP++
Sbjct: 62  LPGGAIPSAGESRDQAIGKSARVAIDTPALSGSINLTGARFDDLKLKGYRETVDPKSPVI 121

Query: 109 TLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILF 168
           TL SP+ T + YF E+ Y+ +     +P   T W L  G  LTP+TP+ L + N   I F
Sbjct: 122 TLFSPAETADGYFTEIGYIGSDATGSVPGPQTTWTLSGGDKLTPSTPVTLSYTNDKGITF 181

Query: 169 ERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKS 228
            RTIS+D+ Y+F++VD++ N +   +  S  GR+ R    T  + + + EGF+ V G+  
Sbjct: 182 ARTISVDDRYMFQVVDSIKNETAAPVSLSSYGRVTRFNKPTTPSIYVLHEGFVGVAGEHG 241

Query: 229 LVEQKYSDIEKSS-ISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA 287
           L E  YS +E    +     +  WLGI+DKYWA+  +P + T F  +F + +DG  RYQ+
Sbjct: 242 LQEVGYSKVEDDEPVEPGKSTGGWLGITDKYWAATIVPPQATPFDIRFSHFADGRPRYQS 301

Query: 288 KFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMF 347
            + ++ +T+ PG+S+   N +FAGAKE P + +YE   +IP F+ LIDWGWFYFI KPMF
Sbjct: 302 DYKSDAVTVAPGQSVELKNLVFAGAKEVPVVDNYEVAYSIPNFDKLIDWGWFYFITKPMF 361

Query: 348 MLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSP 407
            +M +F+ L GNFGIAI++TT+ VKL+FFPLA KQY S ANMK +QPK++EL++KF    
Sbjct: 362 KMMDFFFRLFGNFGIAILITTIVVKLIFFPLANKQYASMANMKKVQPKMEELKKKFGDDR 421

Query: 408 PQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAA 467
              LQ+AM+QLYK   INPLAGCWPIL+QIPVFFA+YKVI +++EMRHAPF+GWI+DL+A
Sbjct: 422 -MGLQQAMMQLYKEEKINPLAGCWPILIQIPVFFALYKVIYVTIEMRHAPFFGWIQDLSA 480

Query: 468 ADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVF 527
            DPT I  LFG+LPF  P F+H+GIWPIIM ++MF+QM+M+P P D  QAM+  WMPVVF
Sbjct: 481 PDPTTIINLFGLLPFEGPAFLHLGIWPIIMGVTMFLQMRMNPTPPDPTQAMLFTWMPVVF 540

Query: 528 VFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
            F L+SFPAGL+IYW+W+N +SI+QQ +IMK  G ++ L D L+S FSK 
Sbjct: 541 TFMLASFPAGLVIYWAWNNTLSILQQGIIMKRQGVKVELFDNLKSLFSKK 590


>gi|307301342|ref|ZP_07581104.1| YidC/Oxa1 family domain containing membrane protein insertase
           [Sinorhizobium meliloti BL225C]
 gi|307318012|ref|ZP_07597449.1| YidC/Oxa1 family domain containing membrane protein insertase
           [Sinorhizobium meliloti AK83]
 gi|38503127|sp|Q92SF5|OXAA_RHIME RecName: Full=Inner membrane protein oxaA
 gi|306896414|gb|EFN27163.1| YidC/Oxa1 family domain containing membrane protein insertase
           [Sinorhizobium meliloti AK83]
 gi|306903798|gb|EFN34385.1| YidC/Oxa1 family domain containing membrane protein insertase
           [Sinorhizobium meliloti BL225C]
          Length = 594

 Score =  617 bits (1592), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 291/590 (49%), Positives = 395/590 (66%), Gaps = 14/590 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEE--------MNNERKNIQTVKQPNQVDNS 52
           ME N NYFVAIALSV+I+ AWQ FYV P++E+           ++   Q   QP     +
Sbjct: 1   MENNRNYFVAIALSVLILIAWQFFYVSPKMEKDRIAAEQAQQAQQTQQQPGAQPAAPGQA 60

Query: 53  YAAVLI----DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIV 108
                I    + R QA+  S RV +  P+L GSINL GA+FDDL L+GY   V   SP++
Sbjct: 61  LPGGAIPSAGESRDQAIGKSARVAIDTPALSGSINLTGARFDDLKLKGYRETVDPKSPVI 120

Query: 109 TLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILF 168
           TL SP+ T + YF E+ Y+ +     +P   T W L  G  LTP+TP+ L + N   I F
Sbjct: 121 TLFSPAETADGYFTEIGYIGSDATGSVPGPQTTWTLSGGDKLTPSTPVTLSYTNDKGITF 180

Query: 169 ERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKS 228
            RTIS+D+ Y+F++VD++ N +   +  S  GR+ R    T  + + + EGF+ V G+  
Sbjct: 181 ARTISVDDRYMFQVVDSIKNETAAPVSLSSYGRVTRFNKPTTPSIYVLHEGFVGVAGEHG 240

Query: 229 LVEQKYSDIEKSS-ISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA 287
           L E  YS +E    +     +  WLGI+DKYWA+  +P + T F  +F + +DG  RYQ+
Sbjct: 241 LQEVGYSKVEDDEPVEPGKSTGGWLGITDKYWAATIVPPQATPFDIRFSHFADGRPRYQS 300

Query: 288 KFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMF 347
            + ++ +T+ PG+S+   N +FAGAKE P + +YE   +IP F+ LIDWGWFYFI KPMF
Sbjct: 301 DYKSDAVTVAPGQSVELKNLVFAGAKEVPVVDNYEVAYSIPNFDKLIDWGWFYFITKPMF 360

Query: 348 MLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSP 407
            +M +F+ L GNFGIAI++TT+ VKL+FFPLA KQY S ANMK +QPK++EL++KF    
Sbjct: 361 KMMDFFFRLFGNFGIAILITTIVVKLIFFPLANKQYASMANMKKVQPKMEELKKKFGDDR 420

Query: 408 PQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAA 467
              LQ+AM+QLYK   INPLAGCWPIL+QIPVFFA+YKVI +++EMRHAPF+GWI+DL+A
Sbjct: 421 -MGLQQAMMQLYKEEKINPLAGCWPILIQIPVFFALYKVIYVTIEMRHAPFFGWIQDLSA 479

Query: 468 ADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVF 527
            DPT I  LFG+LPF  P F+H+GIWPIIM ++MF+QM+M+P P D  QAM+  WMPVVF
Sbjct: 480 PDPTTIINLFGLLPFEGPAFLHLGIWPIIMGVTMFLQMRMNPTPPDPTQAMLFTWMPVVF 539

Query: 528 VFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
            F L+SFPAGL+IYW+W+N +SI+QQ +IMK  G ++ L D L+S FSK 
Sbjct: 540 TFMLASFPAGLVIYWAWNNTLSILQQGIIMKRQGVKVELFDNLKSLFSKK 589


>gi|222147367|ref|YP_002548324.1| putative inner membrane protein translocase component YidC
           [Agrobacterium vitis S4]
 gi|254772742|sp|B9JZK8|OXAA_AGRVS RecName: Full=Inner membrane protein oxaA
 gi|221734357|gb|ACM35320.1| inner membrane insertion protein [Agrobacterium vitis S4]
          Length = 620

 Score =  616 bits (1589), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 296/615 (48%), Positives = 397/615 (64%), Gaps = 39/615 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNER--------KNIQTVKQPNQVDNS 52
           ME N NY +AIALSV++V  WQ FY+ PRIE              K   T   P    N 
Sbjct: 2   MENNRNYLIAIALSVMVVLGWQFFYMNPRIEAQRQAEQAQQAQQAKTPATQATPGAAVNG 61

Query: 53  -----YAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPI 107
                  A     R  A++ S RVE+   +L GSINL GA+ DDL L+GYH  V   SPI
Sbjct: 62  ALPGQTQASATTSREDAVAKSARVEINTEALSGSINLTGARLDDLRLKGYHETVDKTSPI 121

Query: 108 VTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNIL 167
           +TLL+P++TK+ YFAE+ ++    +  +P  +TVW +  G+ LT TTP+ L + N   + 
Sbjct: 122 ITLLNPADTKDGYFAEIGFIGGEKSGSVPGPSTVWTVKDGQTLTETTPVTLTYTNETGLT 181

Query: 168 FERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDK 227
           F R IS+D+HY+F I DTV N     I  +P GR+ R+      +T+ + EGFI V+G  
Sbjct: 182 FSRKISVDKHYMFTIEDTVANAGGADISLAPYGRVTRYNKPAVASTYVLHEGFIGVMGSG 241

Query: 228 ----SLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
               + VE KY+ IEK + +N   +  WLGI+DKYWA+  +P +  ++ S+F + +DG A
Sbjct: 242 DGKFASVEAKYAAIEKENETNAKATGGWLGITDKYWAATLVPPQSLAYDSRFSHFTDGQA 301

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLA----------------- 326
           R+QA +  + +TI PG+S T    LFAGAKE P +  Y  D +                 
Sbjct: 302 RFQADYKNDPVTIAPGQSTTLKTLLFAGAKEVPVVDGYALDKSWFGQAFTNLFAGAKDTV 361

Query: 327 ----IPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQ 382
               IPRF++LIDWGWFYF+ KPMF LM +F+  VGNFG+AI+LTT+ VKLLFFPLA KQ
Sbjct: 362 QQYDIPRFDLLIDWGWFYFLTKPMFKLMDFFFRQVGNFGVAILLTTIAVKLLFFPLASKQ 421

Query: 383 YVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFA 442
           Y S ANMK +QPK++EL+ K        LQ+AM++LYKT  INP+AGCWP+LLQIPVFFA
Sbjct: 422 YASMANMKRMQPKMEELKAKHGDDR-MALQQAMMELYKTEKINPVAGCWPLLLQIPVFFA 480

Query: 443 IYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMF 502
           +YKVI I++EMRHAPF+GWI DL+A DPT+   LFG+LPF  P  +H+GIWPIIM ++MF
Sbjct: 481 LYKVIYITIEMRHAPFFGWIHDLSAPDPTSFVNLFGLLPFESPAMLHLGIWPIIMGITMF 540

Query: 503 IQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           +QM+M+P P D  QAM+ NWMP+VF F L SFPAGL+IYW+W+N +S++QQ++IMK HG 
Sbjct: 541 VQMRMNPTPPDPTQAMLFNWMPLVFTFMLGSFPAGLVIYWAWNNTLSVLQQSIIMKRHGV 600

Query: 563 EIGLIDRLRSTFSKN 577
           +I L D L+  F + 
Sbjct: 601 KIELFDNLKGLFQRK 615


>gi|325291817|ref|YP_004277681.1| inner membrane protein translocase component YidC [Agrobacterium
           sp. H13-3]
 gi|325059670|gb|ADY63361.1| putative inner membrane protein translocase component YidC
           [Agrobacterium sp. H13-3]
          Length = 600

 Score =  612 bits (1577), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 288/595 (48%), Positives = 401/595 (67%), Gaps = 19/595 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMN--NERKNIQTVKQPNQVDNSYAAVLI 58
           ME+N NYF+AIALSV+IV AWQ  Y+ PRIE+     E +  Q      Q     A  + 
Sbjct: 2   MEKNRNYFIAIALSVVIVLAWQFLYMNPRIEQQRRAEEARQAQQQTTQQQPAPGAAPGVT 61

Query: 59  DDRA---------------QALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSS 103
            D A               +A++ S RV +   ++ GSINL GA+FDD+ L+GYH  V  
Sbjct: 62  ADGAPPASSTQAAATATREEAIAKSQRVAIDTNAIAGSINLTGARFDDIRLKGYHETVDD 121

Query: 104 NSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNA 163
           +SPI+TL SPS+TK+ YF EL YV  A+   +P   TVW L SG  LT TTP+ L + N 
Sbjct: 122 SSPIITLFSPSDTKDGYFTELGYVGGADAGSVPGPATVWTLASGDKLTETTPVTLKYTNQ 181

Query: 164 NNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAV 223
           N ++F RT+S+D+HY+  + D V N     + F+  GR+ R+        F + EGF+ V
Sbjct: 182 NGVVFSRTVSIDQHYMITVNDKVENPGQAPVSFATYGRVTRNNKPAIPPVFVIHEGFLGV 241

Query: 224 LG-DKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGH 282
            G D SL E+KY D+E++ ++    +  WLGI+DKYWA+  +P + T F +++ ++    
Sbjct: 242 SGKDGSLTEEKYKDVEETPVTIAKATGGWLGITDKYWAAAIVPPQMTPFETRYSHIKGNQ 301

Query: 283 ARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFI 342
             YQA F ++ +T+ PG+SI   + +FAGAKE P +  YE + +IP+F++LIDWGWFYFI
Sbjct: 302 PSYQADFKSDTMTVEPGQSIELKSLVFAGAKEVPLVDRYETEYSIPKFDLLIDWGWFYFI 361

Query: 343 AKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREK 402
            KPMF +M +F+   GNFG+AI+LTT+ VK LFFPLA KQY S ANMK +QPK++EL+ K
Sbjct: 362 TKPMFKMMDFFFRYFGNFGVAILLTTIVVKALFFPLASKQYASMANMKRMQPKMEELKAK 421

Query: 403 FKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWI 462
                   +Q+AM+QLYK   INP+AGCWP+LLQIPVFFA+YKVI +++EMRHAPF+GWI
Sbjct: 422 HGDDR-MAMQQAMMQLYKEEKINPVAGCWPMLLQIPVFFALYKVIYVTIEMRHAPFFGWI 480

Query: 463 KDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNW 522
            DL+A DPT++F LFG+LP+ +P F+ +G+WP++M ++MF+QM+M+P P D  QAMI  W
Sbjct: 481 HDLSAPDPTSLFNLFGLLPYDVPHFLMIGVWPLVMGITMFLQMRMNPTPPDPTQAMIFTW 540

Query: 523 MPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           MP++F F L+SFPAGL+IYW+W+N +SI QQA+IMK HGA+I L D L+  F + 
Sbjct: 541 MPLIFTFMLASFPAGLVIYWAWNNTLSISQQALIMKRHGAKIELFDNLKGLFKRK 595


>gi|327192535|gb|EGE59487.1| inner membrane transmembrane protein [Rhizobium etli CNPAF512]
          Length = 597

 Score =  611 bits (1575), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 291/593 (49%), Positives = 392/593 (66%), Gaps = 17/593 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNI----------------QTVK 44
           ME N NYF+AIALSV+IV  WQ  Y+ PRIE     ++                   T  
Sbjct: 1   MENNRNYFIAIALSVLIVLGWQFLYMNPRIEAQRKAQEAQKAQQQTEQVQQPAAGGATPA 60

Query: 45  QPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
             +    S  AV      QAL+ +PRV +  P+L GSINL GA+ DDL L+GYH  V  +
Sbjct: 61  PTSGTAPSGQAVATATLEQALAKTPRVAIDTPALSGSINLAGARLDDLKLKGYHETVDDS 120

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           SPI+TL SP+ TK+ YF EL Y+ +     +P ++T+W    G  LT  TP+ L + N  
Sbjct: 121 SPIITLFSPAETKDGYFTELGYIGSDATGSVPGASTLWTAPEGAKLTEKTPVTLSYTNDK 180

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVL 224
            + F RTIS+DE Y+F I D V N     +  S  GR+ R+   T  + + + EGFI V+
Sbjct: 181 GLTFTRTISVDERYMFTIADKVANTGQAPVSLSSYGRVTRYNKPTTPSAYVLHEGFIGVI 240

Query: 225 GDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR 284
           GD  L+E KY+ +EK ++     +  WLGI+DKYWA+  +P + +++ ++F + +DG  R
Sbjct: 241 GDDGLIESKYTAVEKEAVMPAKSTGGWLGITDKYWAATIVPPQASAYEARFSHFADGQPR 300

Query: 285 YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAK 344
           YQA +  +  TI PG+SI   N +FAGAKE P I  YE   +IPRF+ LIDWGWFYFI K
Sbjct: 301 YQADYKDDAFTIAPGQSIELKNLVFAGAKEVPVIDGYEASYSIPRFDRLIDWGWFYFITK 360

Query: 345 PMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK 404
           PMF LM +F+   GNFG+AI+ TT+ VK LFFPLA KQY S ANMK +QPK++EL+ KF 
Sbjct: 361 PMFKLMDFFFRFFGNFGVAILCTTIVVKALFFPLASKQYASMANMKRMQPKMEELKAKFG 420

Query: 405 QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKD 464
                 LQ+A +QLYK   INP+AGCWP+ LQIP+FF++YKVI I++EMRHAPF+GWI+D
Sbjct: 421 DD-RMGLQQATMQLYKEEKINPIAGCWPVALQIPIFFSLYKVIYITIEMRHAPFFGWIQD 479

Query: 465 LAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMP 524
           L+A DPT I  LFG+LPF  P F+H+G+WP+IM ++MF+QM+M+P P D  QAMI NWMP
Sbjct: 480 LSAPDPTTIVNLFGLLPFTAPTFLHLGVWPLIMGVTMFLQMRMNPTPPDPTQAMIFNWMP 539

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           +VF+F L+SFPAGL+IYW+W+N +S++QQ+VIMK HG +I L D L+  F + 
Sbjct: 540 LVFMFMLASFPAGLVIYWAWNNTLSVIQQSVIMKRHGVKIELFDNLKGLFRRK 592


>gi|227820669|ref|YP_002824639.1| putative inner membrane protein translocase component YidC
           [Sinorhizobium fredii NGR234]
 gi|254773017|sp|C3MF49|OXAA_RHISN RecName: Full=Inner membrane protein oxaA
 gi|227339668|gb|ACP23886.1| putative inner membrane protein translocase component YidC
           [Sinorhizobium fredii NGR234]
          Length = 592

 Score =  610 bits (1574), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 294/588 (50%), Positives = 397/588 (67%), Gaps = 13/588 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEE--MNNERKNIQTVKQPNQVDNSY----- 53
           ME N NYFVAIALSV+I+ AWQ FYV PR+++  +  E+       QP Q          
Sbjct: 2   MENNRNYFVAIALSVLILVAWQYFYVNPRMDKDRIAAEKAQQTQQVQPQQGGQQPAPGQA 61

Query: 54  ---AAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTL 110
               AV  + R QA++ S RV +  P+L GSINL GA+FDDL L+GYH  V   SP++TL
Sbjct: 62  LPGGAVPGESRDQAVAKSARVAIDTPALSGSINLTGARFDDLKLKGYHETVDPKSPVITL 121

Query: 111 LSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFER 170
            SP+ T + YF E+ Y+    +  +P   TVW L  G+ LTP TP+ L + N   I F R
Sbjct: 122 FSPAETADGYFTEIGYIGNDASGSVPGPQTVWTLSGGEKLTPATPVTLTYTNDKGITFAR 181

Query: 171 TISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLV 230
           TIS+DE+Y+F++VD++ N+    +  S  GR+ R    T  + + + EGFI V G  SL 
Sbjct: 182 TISIDENYMFQVVDSIKNDGSAPVSLSSYGRVTRFNKPTTPSIYVLHEGFIGVAGG-SLQ 240

Query: 231 EQKYSDIEKS-SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKF 289
           E  YS IE++  +     +  W GI+DKYWA+  +P +ET F  +F + +DG  R+Q+ +
Sbjct: 241 EVGYSKIEENLPVEPGKTTGGWHGITDKYWAAAIVPPQETPFDIRFSHFTDGRPRFQSDY 300

Query: 290 SANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFML 349
             + +T+ PG+S    N +FAGAKE   +  Y    AIP+FE LIDWGWF+FI +PMF +
Sbjct: 301 KGDAVTVAPGQSAEVKNLVFAGAKEVQVVDTYTTAYAIPKFEKLIDWGWFWFITQPMFKM 360

Query: 350 MSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQ 409
           M +F+ L GNFG+AI++TT+ VKL+FFPLA KQY S ANMK +QPK++EL++KF      
Sbjct: 361 MDFFFRLFGNFGVAILVTTIVVKLIFFPLANKQYASMANMKKVQPKMEELKKKFGDDR-M 419

Query: 410 VLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAAD 469
            LQ+AM+QLYK   INPLAGCWPIL+QIPVFFA+YKVI I++EMRHAPF+GWI+DL+A D
Sbjct: 420 GLQQAMMQLYKDEKINPLAGCWPILIQIPVFFALYKVIYITIEMRHAPFFGWIRDLSAPD 479

Query: 470 PTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVF 529
           PT I  LFG+LPF  P F+H+GIWPIIM ++MF+QM+M+P P D  QAM+  WMP+VF F
Sbjct: 480 PTTIVNLFGLLPFDGPAFLHLGIWPIIMGVTMFLQMRMNPTPPDPTQAMLFTWMPLVFTF 539

Query: 530 ALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
            L+SFPAGL+IYW+W+N +SI QQ++IMK  G +I L D L+  F+K 
Sbjct: 540 MLASFPAGLVIYWAWNNTLSITQQSIIMKRQGVKIELFDNLKGLFTKR 587


>gi|190890108|ref|YP_001976650.1| inner membrane transmembrane protein [Rhizobium etli CIAT 652]
 gi|254773016|sp|B3Q040|OXAA_RHIE6 RecName: Full=Inner membrane protein oxaA
 gi|190695387|gb|ACE89472.1| inner membrane transmembrane protein [Rhizobium etli CIAT 652]
          Length = 598

 Score =  608 bits (1569), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 290/593 (48%), Positives = 394/593 (66%), Gaps = 17/593 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQP-------------- 46
           ME N NYF+AIALSV+IV  WQ  Y+ PRIE     ++  +  +Q               
Sbjct: 2   MENNRNYFIAIALSVLIVLGWQFLYMNPRIEAQRKAQEAQKAQQQTEQVQQPAAGGATPA 61

Query: 47  --NQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
             +    S  AV      QAL+ +PRV +  P+L GSINL GA+ DDL L+GYH  V  +
Sbjct: 62  PASGTAPSGQAVATATLEQALAKTPRVAIDTPALSGSINLAGARLDDLKLKGYHETVDDS 121

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           SPI+TL SP+ TK+ YF EL Y+ +     +P ++T+W    G  LT  TP+ L + N  
Sbjct: 122 SPIITLFSPAETKDGYFTELGYIGSDATGSVPGASTLWTAPEGAKLTEKTPVTLSYTNDK 181

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVL 224
            + F RTIS+DE Y+F I D V N     +  S  GR+ R+   T  + + + EGFI V+
Sbjct: 182 GLTFTRTISVDERYMFTIADKVANTGQAPVSLSSYGRVTRYNKPTTPSAYVLHEGFIGVI 241

Query: 225 GDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR 284
           GD  L+E KY+ +EK ++     +  WLGI+DKYWA+  +P + +++ ++F + SDG  R
Sbjct: 242 GDDGLIESKYTAVEKEAVMPAKSTGGWLGITDKYWAATIVPPQASAYEARFSHFSDGQPR 301

Query: 285 YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAK 344
           YQA +  +  T+ PG+S+   N +FAGAKE P I  YE   +IPRF+ LIDWGWFYFI K
Sbjct: 302 YQADYKDDAFTVAPGQSVELKNLVFAGAKEVPVIDGYEASYSIPRFDRLIDWGWFYFITK 361

Query: 345 PMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK 404
           PMF LM +F+   GNFG+AI+ TT+ VK LFFPLA KQY S ANMK +QPK++EL+ KF 
Sbjct: 362 PMFKLMDFFFRFFGNFGVAILCTTIVVKALFFPLASKQYASMANMKRMQPKMEELKAKFG 421

Query: 405 QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKD 464
                 LQ+A +QLYK   INP+AGCWP+ LQIP+FF++YKVI I++EMRHAPF+GWI+D
Sbjct: 422 DD-RMGLQQATMQLYKEEKINPIAGCWPVALQIPIFFSLYKVIYITIEMRHAPFFGWIQD 480

Query: 465 LAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMP 524
           L+A DPT I  LFG+LPF  P F+H+G+WP+IM ++MF+QM+M+P P D  QAMI NWMP
Sbjct: 481 LSAPDPTTIVNLFGLLPFTAPTFLHLGVWPLIMGVTMFLQMRMNPTPPDPTQAMIFNWMP 540

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           +VF+F L+SFPAGL+IYW+W+N +S++QQ+VIMK HG +I L D L+  F + 
Sbjct: 541 LVFMFMLASFPAGLVIYWAWNNTLSVIQQSVIMKRHGVKIELFDNLKGLFRRK 593


>gi|159184283|ref|NP_353415.2| putative inner membrane protein translocase component YidC
           [Agrobacterium tumefaciens str. C58]
 gi|38503098|sp|Q8UIB3|OXAA_AGRT5 RecName: Full=Inner membrane protein oxaA
 gi|159139609|gb|AAK86200.2| preprotein translocase 60 kD membrane subunit [Agrobacterium
           tumefaciens str. C58]
          Length = 599

 Score =  605 bits (1560), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 282/595 (47%), Positives = 399/595 (67%), Gaps = 19/595 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEM---NNERKNIQTVKQPNQVDNSYAAVL 57
           ME+N NYF+AIALSV+IV AWQ  Y+ PRIE+       R+  Q   Q      +     
Sbjct: 1   MEKNRNYFIAIALSVVIVLAWQFLYMNPRIEQQRRAEEARQAQQQTTQQQPAPGAAPGAT 60

Query: 58  IDD--------------RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSS 103
           ++               R +A++ + RV +   ++ GSINL GA+FDD+ L+GYH  V  
Sbjct: 61  VEGAPPASSTQAAATATREEAIARTQRVAIDTNAIAGSINLTGARFDDIRLKGYHETVDD 120

Query: 104 NSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNA 163
           +SPI+TL SP++TK+ YF EL YV+      +P   TVW L SG  LT TTP+ L + N+
Sbjct: 121 SSPIITLFSPADTKDGYFTELGYVAAQEVGGVPGPTTVWTLASGDKLTETTPVTLTYTNS 180

Query: 164 NNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAV 223
             ++F RT+S+DEHY+  I D V N     I F+  GR+ R+        F + EGF+ V
Sbjct: 181 KGVVFSRTVSIDEHYMLSIADKVENPGQAAISFATYGRVTRNNKPVIPPVFVIHEGFLGV 240

Query: 224 LG-DKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGH 282
            G D SL E+KY D+E+  ++    +  WLGI+DKYWA+  +P + T F +++ +++   
Sbjct: 241 SGKDGSLTEKKYKDVEEEPVTVAKATGGWLGITDKYWAAAIVPPQTTPFETRYSHITGNQ 300

Query: 283 ARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFI 342
             YQA F ++ +T+  G+SI   + +FAGAKE P +  YE + ++P+F++LIDWGWFYFI
Sbjct: 301 PSYQADFKSDSMTVEAGQSIELKSLVFAGAKEVPLVDRYETEYSVPKFDLLIDWGWFYFI 360

Query: 343 AKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREK 402
            KPMF +M +F+   GNFG+AI+LTT+ VK LFFPLA KQY S ANMK +QPK++EL+ K
Sbjct: 361 TKPMFKMMDFFFRYFGNFGVAILLTTIVVKALFFPLASKQYASMANMKRMQPKMEELKAK 420

Query: 403 FKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWI 462
                   +Q+AM+QLYK   INP+AGCWP+LLQIPVFFA+YKVI +++EMRHAPF+GWI
Sbjct: 421 HGDDR-MAMQQAMMQLYKEEKINPVAGCWPMLLQIPVFFALYKVIYVTIEMRHAPFFGWI 479

Query: 463 KDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNW 522
            DL+A DPT++F LFG+LP+ +P F+ +G+WP++M ++MF+QM+M+P P D  QAMI  W
Sbjct: 480 HDLSAPDPTSLFNLFGLLPYDVPHFLMIGVWPLVMGITMFLQMRMNPTPPDPTQAMIFTW 539

Query: 523 MPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           MP++F F L+SFPAGL+IYW+W+N +SI QQA+IMK HGA+I L D ++  F + 
Sbjct: 540 MPLIFTFMLASFPAGLVIYWAWNNTLSISQQALIMKRHGAKIELFDNIKGLFKRK 594


>gi|163757863|ref|ZP_02164952.1| putative inner membrane protein translocase component YidC [Hoeflea
           phototrophica DFL-43]
 gi|162285365|gb|EDQ35647.1| putative inner membrane protein translocase component YidC [Hoeflea
           phototrophica DFL-43]
          Length = 605

 Score =  574 bits (1479), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 278/603 (46%), Positives = 391/603 (64%), Gaps = 34/603 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQT----------------VK 44
           ME N NYFVAI LSV+++  WQ  YV P+IE    ER+  Q                   
Sbjct: 1   METNRNYFVAILLSVLVLIGWQYLYVSPKIER---EREAAQALQAEQAATQPGATGAGTT 57

Query: 45  QPNQVDNS-------YAAVLIDD----RAQALSMSPRVELKNPSLIGSINLKGAQFDDLN 93
            P  V  S          V+  +    R  AL+ S R+ +  P+L GSINL GA+ DDL 
Sbjct: 58  TPGAVSGSAPGGETAMPGVVAPETGLSREDALAQSERIAIDTPALSGSINLTGARIDDLL 117

Query: 94  LRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPT 153
           L  Y   +   SP + L SP+   + YFAE+ +++ A++   P  +TVW+   G+ LT  
Sbjct: 118 LSEYRETIDPESPNIRLFSPAQQADGYFAEVGFIADADSGPAPGPDTVWSAAPGQTLTQG 177

Query: 154 TPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTATN 212
           +P+ L + N   +LF R IS+D+H+LF+  DT++N+S      +  GR+ R  +PQTA  
Sbjct: 178 SPVTLTYDNGAGLLFTRKISVDDHFLFQFEDTISNSSSQTASVAGYGRVTRFFRPQTA-G 236

Query: 213 TFGVQEGFIAVLGDKSLVEQKYSDIEKSSI-SNFHESNSWLGISDKYWASVFIPSKETSF 271
            + + EG I V+G++ L E  YSD+E++ I +    +  W+GI+DKYWA+  +P +   F
Sbjct: 237 IYVLHEGLIGVIGEEGLQEIDYSDVEETPILAQPKATAGWMGITDKYWAAALVPPQGAGF 296

Query: 272 HSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFE 331
            ++F + +DG ARYQA F  +   I  G S+T+T  +FAGAKE P I  YE    I  F+
Sbjct: 297 DTRFAHFTDGRARYQADFRTDAQAIAAGGSVTSTTLVFAGAKEVPIIEGYESQFNILNFD 356

Query: 332 MLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKN 391
           ++IDWGWFYFI KPMF ++ + + L+GNFG+AI+ TTV VKL+FFPLA K YVS ANMK 
Sbjct: 357 LMIDWGWFYFITKPMFWMIDFLFKLLGNFGLAILATTVIVKLIFFPLANKSYVSMANMKK 416

Query: 392 IQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISL 451
           +QPK++EL+ K        LQ+ M++LYK   INP+AGCWP+LLQIPVFFA+YKV+ +++
Sbjct: 417 VQPKLEELKAKHGDDR-MALQQGMMELYKKEKINPVAGCWPVLLQIPVFFALYKVLYVTI 475

Query: 452 EMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP 511
           EMRHAPF+GWI+DL+A DPT++F LFG+LP+ +PGF+ +G+WP+IM ++MF+QM+M+P P
Sbjct: 476 EMRHAPFFGWIQDLSAPDPTSLFNLFGLLPYDVPGFLLIGVWPLIMGITMFLQMRMNPTP 535

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLR 571
            D  QAMI  WMPVVF F L++FPAGL+IYW+W+N +SI+QQ  IMK  GA+I L D L 
Sbjct: 536 PDPTQAMIFTWMPVVFTFMLATFPAGLVIYWAWNNTLSILQQGFIMKRQGAKIELWDNLM 595

Query: 572 STF 574
           + F
Sbjct: 596 ALF 598


>gi|153008692|ref|YP_001369907.1| putative inner membrane protein translocase component YidC
           [Ochrobactrum anthropi ATCC 49188]
 gi|151560580|gb|ABS14078.1| 60 kDa inner membrane insertion protein [Ochrobactrum anthropi ATCC
           49188]
          Length = 607

 Score =  570 bits (1470), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 275/602 (45%), Positives = 384/602 (63%), Gaps = 26/602 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERK-----------------NIQTV 43
           ME N N+F+ IALS++++  WQ FY+ P+ E    + +                 +  T 
Sbjct: 1   MENNRNFFITIALSILVLTLWQVFYLGPKTEAQREQARIEEQQQQKQQATQQQAQSGDTP 60

Query: 44  KQPNQVDN------SYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGY 97
           + P    N        AA     R  A++ + RVE+  PSL GSINL GA+ DDL L+ Y
Sbjct: 61  QMPATSGNIPGHSDVAAAGGTLTREAAVAQTQRVEIDTPSLRGSINLTGARLDDLFLKRY 120

Query: 98  HLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIK 157
           H  V  NSP + LL+PS  K  YF EL +        +P  NTVW +     LTP+TP+ 
Sbjct: 121 HETVDDNSPQIELLAPSALKQGYFVELGFTGNDTTGPVPGPNTVWTVEGNNKLTPSTPVT 180

Query: 158 LVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR-HKPQTATNTFGV 216
           L + N  NI F+R IS+D+ Y+F + DT+TNN+   I  +  GR+ R ++P+ A+ T+ +
Sbjct: 181 LTYTNEKNITFKRVISVDDAYMFAVEDTITNNTGAPISLASYGRVTRFNQPEHASATYVL 240

Query: 217 QEGFIAVLGDKSLVEQKYSDIEKSSISNFHE-SNSWLGISDKYWASVFIPSKETSFHSQF 275
            EG I V+G   L E KYS +E     +F + S  WLGI+DKYWA+  +P ++  F  +F
Sbjct: 241 HEGLIGVMGQDGLQEIKYSKVEDDKDISFKDVSGGWLGITDKYWAATLVPPQDEKFTGRF 300

Query: 276 KYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLID 335
            + ++   RYQ  F    +TI PG++ T  N +FAGAK    I  YE+ L I +FE+LID
Sbjct: 301 SHFTNDRPRYQTDFLGAPMTIAPGQAQTLKNHVFAGAKVVSNIKAYEEKLGIKQFELLID 360

Query: 336 WGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPK 395
           WGWFYFI KPMF L+ + Y   GNFG+AI++ TV +K LFFPLA K Y S A MK +QPK
Sbjct: 361 WGWFYFITKPMFYLIDWIYKFSGNFGVAILVVTVLLKGLFFPLANKSYKSMARMKLVQPK 420

Query: 396 IDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRH 455
           + E+REK+     +  Q+ M++LYK   INPLAGCWP+L+QIPVFFA+YKV+ +++EMRH
Sbjct: 421 LTEIREKYADDKMKQ-QQEMMRLYKEEKINPLAGCWPVLVQIPVFFALYKVLYVTIEMRH 479

Query: 456 APFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKG 515
           APF+GWI+DLAA DPT++F LFG+LPF +P F+ +G+WP++M ++MF+QM+M+P P D  
Sbjct: 480 APFFGWIQDLAAPDPTSLFNLFGLLPFGVPHFLMIGVWPLLMGITMFLQMRMNPTPPDPT 539

Query: 516 QAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFS 575
           QA I  WMPV+F F L+SFPAGL+IYW+W+N++SI QQ +IMK  G +I L D L+  F 
Sbjct: 540 QAAIFTWMPVIFTFMLASFPAGLVIYWAWNNLLSITQQGIIMKRQGVKIELFDNLKGLFK 599

Query: 576 KN 577
           + 
Sbjct: 600 RK 601


>gi|13474029|ref|NP_105597.1| putative inner membrane protein translocase component YidC
           [Mesorhizobium loti MAFF303099]
 gi|38503148|sp|Q98D88|OXAA_RHILO RecName: Full=Inner membrane protein oxaA
 gi|14024781|dbj|BAB51383.1| mlr4812 [Mesorhizobium loti MAFF303099]
          Length = 603

 Score =  568 bits (1463), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 273/599 (45%), Positives = 379/599 (63%), Gaps = 23/599 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNN----ERKNIQTVKQPNQVDNSYAA- 55
           ME N N+F+ IALSV+I+  WQ FYV PR E        E++ ++  K+  +  N  A  
Sbjct: 1   MENNRNFFITIALSVLILAVWQYFYVLPRSEAQREAARVEQQRVEEQKKAAEAANPGAGT 60

Query: 56  ----------------VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHL 99
                           V +  R QAL+ S RV++  PSL GSINL GA+ DDL L+ Y  
Sbjct: 61  PAPAPGTIPNAPGGDTVTVAGRDQALAASKRVKIDTPSLEGSINLTGARLDDLKLKHYTE 120

Query: 100 DVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLV 159
            V  NSP + LL+P      YFAE+ +V       +P + TVWN+     L+P+TP+ L 
Sbjct: 121 TVDKNSPEIELLNPQALPTGYFAEIGFVGNDKTGAVPGAETVWNVDGNPTLSPSTPVTLT 180

Query: 160 FKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEG 219
           + N   + F+RT S+D +Y+F + DTV N+    +     GR+ R+      +T+ + EG
Sbjct: 181 YTNDKGLTFKRTFSVDANYMFTVSDTVQNSGSSAVSLFNYGRVTRYDKPAVASTYVLHEG 240

Query: 220 FIAVLGDKSLVEQKYSDIEKS-SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYL 278
            I   G + L E KY+ IEK         ++ WLGI+DKYWA   +P+++  F  ++ + 
Sbjct: 241 LIGFTGTEGLQEHKYASIEKDKQYQPGKATDGWLGITDKYWAVTLVPTEKQPFQPRYAFF 300

Query: 279 SDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGW 338
            DG  RYQ+ F  + I +  G+S T    +FAGAKE   I+ Y +D  I RF++LIDWGW
Sbjct: 301 EDGRHRYQSDFLTDAINVEAGQSATVETEVFAGAKEVAKINAYAEDRHIKRFDLLIDWGW 360

Query: 339 FYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDE 398
           F+FI KPMF L+   Y  +GNFG+AI+ TTV VK LFFPLA K Y S ANMK +QPK+ E
Sbjct: 361 FHFITKPMFWLIDTLYKFLGNFGLAILATTVIVKALFFPLANKSYASMANMKKVQPKMLE 420

Query: 399 LREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF 458
           +REK+     +  Q+AM++LYKT  INPLAGCWP+ LQIPVFF++YKV+ I++EMRHAPF
Sbjct: 421 IREKYADDKMK-QQQAMMELYKTEKINPLAGCWPVALQIPVFFSLYKVLYITIEMRHAPF 479

Query: 459 WGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAM 518
           +GWI+DLAA DPT++F LFG++P  LP  + +G+WP+IM ++MF+QM+M+P P D  QA 
Sbjct: 480 FGWIQDLAAPDPTSLFNLFGLIPVTLPHMLMIGVWPLIMGVTMFLQMRMNPTPPDPTQAA 539

Query: 519 ILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           I  WMPV+F F ++ FPAGL+IYW+W+N++SI+QQ VIMK  GA+I L D L + F K 
Sbjct: 540 IFTWMPVIFTFMMAGFPAGLVIYWAWNNMLSILQQGVIMKRQGAKIELWDNLMALFKKK 598


>gi|260461161|ref|ZP_05809410.1| 60 kDa inner membrane insertion protein [Mesorhizobium
           opportunistum WSM2075]
 gi|259033195|gb|EEW34457.1| 60 kDa inner membrane insertion protein [Mesorhizobium
           opportunistum WSM2075]
          Length = 603

 Score =  567 bits (1461), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 272/598 (45%), Positives = 381/598 (63%), Gaps = 23/598 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNN----ERKNIQTVKQPNQVDNSYA-- 54
           ME N N+F+ IALSV+I+  WQ FY+ PR+E+       E++ ++  K+  +  N  A  
Sbjct: 1   MENNRNFFITIALSVLILTLWQVFYMNPRVEQQREAAKIEQQRVEEQKKAAEATNPGAAT 60

Query: 55  ---------------AVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHL 99
                          AV    R QAL+ S RV++  PSL GSINL GA+ DDL L+ Y  
Sbjct: 61  PAPAPGTIPNAPGGDAVTAAGRDQALAASKRVKIDTPSLEGSINLTGARLDDLKLKHYTE 120

Query: 100 DVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLV 159
            V  NSP + LL+P      YFAE+ +V       +P S+TVW++     L+P+TP+ L 
Sbjct: 121 TVDKNSPEIELLNPQALPTGYFAEIGFVGNDKTGAVPGSDTVWSVEGNPTLSPSTPVTLT 180

Query: 160 FKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEG 219
           + N   + F+R  S+D +Y+F + DTV N+    +     GR+ R+      +T+ + EG
Sbjct: 181 YTNDKGLTFKRVFSVDANYMFTVTDTVQNSGASAVSLFNYGRVTRYDKPAVASTYVLHEG 240

Query: 220 FIAVLGDKSLVEQKYSDIE-KSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYL 278
            I V G + L E KY+ IE +  ++    ++ WLGI+DKYWA   +P+++  F  ++ + 
Sbjct: 241 LIGVTGTEGLAEYKYAKIESEKQVTPGKSTDGWLGITDKYWAVTLVPTEKQPFQPRYAFF 300

Query: 279 SDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGW 338
            DG  RYQ+ F  + I +  G+S T    +FAGAKE   I+ YE D  I +F ++IDWGW
Sbjct: 301 EDGRHRYQSDFLTDAINVDAGQSATVETEIFAGAKEVAKINAYEADRHIRQFNLVIDWGW 360

Query: 339 FYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDE 398
           FYFI KPMF L+   Y   GNFG+AI+ TTV VK LFFPLA K Y S ANMK +QPK+ E
Sbjct: 361 FYFITKPMFWLIDTLYKFFGNFGLAILATTVIVKALFFPLANKSYASMANMKKVQPKMLE 420

Query: 399 LREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF 458
           +REK+     +  Q+AM++LYKT  INPLAGCWP+ LQIPVFF++YKV+ I++EMRHAPF
Sbjct: 421 IREKYADDKMK-QQQAMMELYKTEKINPLAGCWPVALQIPVFFSLYKVLYITIEMRHAPF 479

Query: 459 WGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAM 518
           +GWI+DLAA DPT+IF LFG++P  LP  + +G+WP+IM ++MF+QM+M+P P D  QA 
Sbjct: 480 FGWIQDLAAPDPTSIFNLFGLVPVTLPHMLMIGVWPLIMGVTMFLQMRMNPTPPDPTQAA 539

Query: 519 ILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSK 576
           I  WMPV+F F ++ FPAGL+IYW+W+N +SI+QQ +IMK  GA+I L D L + F K
Sbjct: 540 IFTWMPVIFTFMMAGFPAGLVIYWAWNNTLSILQQGLIMKRQGAKIELWDNLVALFRK 597


>gi|239832645|ref|ZP_04680974.1| Inner membrane protein oxaA [Ochrobactrum intermedium LMG 3301]
 gi|239824912|gb|EEQ96480.1| Inner membrane protein oxaA [Ochrobactrum intermedium LMG 3301]
          Length = 624

 Score =  566 bits (1458), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 275/604 (45%), Positives = 386/604 (63%), Gaps = 29/604 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERK--------------------NI 40
           ME N N+F+ IALS++++  WQ FY+ P+ E    + +                    N 
Sbjct: 15  MENNRNFFITIALSILVLTLWQVFYLGPKSEAQREQARIEEQQQQKQQATQQQAQGSQNG 74

Query: 41  QTVKQPNQVDN--SYAAVLIDD----RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNL 94
            T + P    N   ++ V        R  A++ + R+E+  PSL GSINL GA+ DD+ L
Sbjct: 75  DTPQMPAASGNVPGHSDVAAGGGTLTREAAVAQTQRIEIDTPSLRGSINLTGARLDDIFL 134

Query: 95  RGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTT 154
           + YH  V +NSP + LL+PS  +  YF EL +        +P  NTVW +     LT T 
Sbjct: 135 KNYHETVDNNSPNIELLAPSPLQQGYFVELGFTGNETTGPVPGPNTVWTVEGNNRLTQTA 194

Query: 155 PIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR-HKPQTATNT 213
           P+ L + N  NI F+R IS+DE Y+F + DT+ NNS   I  +  GR+ R ++P+ A+ T
Sbjct: 195 PVTLTYTNEKNITFKRIISVDESYMFSVEDTIVNNSGAPISLASYGRVTRFNQPEHASAT 254

Query: 214 FGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHE-SNSWLGISDKYWASVFIPSKETSFH 272
           + + EG I V+G   L E KYS IE +   +F +    WLGI+DKYWA+  IP ++  F 
Sbjct: 255 YVLHEGLIGVMGQDGLQEIKYSKIEDNKDISFKDVQGGWLGITDKYWAATLIPPQDEKFT 314

Query: 273 SQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEM 332
            +F + ++   RYQA F    +TI PG++ T  N +FAGAK    I +YE+ L I +FE+
Sbjct: 315 GRFSHFTNDRPRYQADFLGAPMTIAPGQTQTVKNHVFAGAKVVSLIKNYEETLGIKQFEL 374

Query: 333 LIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNI 392
           LIDWGWFYFI KPMF L+ + Y   GNFG+AI++ TV +K LFFPLA K Y S A MK +
Sbjct: 375 LIDWGWFYFITKPMFYLIDWIYKFSGNFGVAILVVTVLLKGLFFPLANKSYKSMARMKLV 434

Query: 393 QPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLE 452
           QPK+ E+REK+     +  Q+ M++LYK   INPLAGCWP+L+QIPVFFA+YKV+ +++E
Sbjct: 435 QPKLTEIREKYADDKMR-QQQEMMKLYKEEKINPLAGCWPVLVQIPVFFALYKVLYVTIE 493

Query: 453 MRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPA 512
           MRHAPF+GWI+DLAA DPT++F LFG+LPF +P F+ +G+WP++M ++MF+QM+M+P P 
Sbjct: 494 MRHAPFFGWIQDLAAPDPTSLFNLFGLLPFAVPHFLMIGVWPLLMGITMFLQMRMNPTPP 553

Query: 513 DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRS 572
           D  QA I  WMPV+F F L+SFPAGL+IYW+W+N++SI QQ +IMK  G +I L D L+S
Sbjct: 554 DPTQAAIFTWMPVIFTFMLASFPAGLVIYWAWNNLLSITQQGIIMKRQGVKIELFDNLKS 613

Query: 573 TFSK 576
            F +
Sbjct: 614 LFKR 617


>gi|294853976|ref|ZP_06794648.1| preprotein translocase YidC subunit [Brucella sp. NVSL 07-0026]
 gi|294819631|gb|EFG36631.1| preprotein translocase YidC subunit [Brucella sp. NVSL 07-0026]
          Length = 610

 Score =  566 bits (1458), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 274/606 (45%), Positives = 387/606 (63%), Gaps = 33/606 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQ--------------- 45
           ME   N+F+ IALS++I+  WQ FY+ P+ E    E+  I+  ++               
Sbjct: 1   MENKRNFFITIALSILILALWQVFYLGPKTEA-QREQARIEEQQRQAQQAAQNRQASSST 59

Query: 46  -------------PNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDL 92
                        P Q D   A   +  R  A++ SPR+E+  PSL GSINL GA+ DDL
Sbjct: 60  GDTPQMPANPDSIPGQGDTKAAGAPLT-RDAAIAQSPRIEIDTPSLRGSINLTGARLDDL 118

Query: 93  NLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTP 152
            L+ YH  VS  SP + LL+PS+ K  YF EL +        +P  NTVW +     LTP
Sbjct: 119 YLKKYHETVSDKSPEIELLAPSSLKQGYFVELGFTGNDATGAVPGPNTVWVVEGNNKLTP 178

Query: 153 TTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR-HKPQTAT 211
           +TP+ L + N  N+ F+R IS+D+ Y+F + DT+ NN    +  +  GR+ R ++P+ A+
Sbjct: 179 STPVTLTYTNDKNLTFKRVISVDDAYMFTVDDTIINNGGSTVSLASYGRVTRFNQPEHAS 238

Query: 212 NTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHES-NSWLGISDKYWASVFIPSKETS 270
            T+ + EG I V+G   L E KYS IE +   +F +    W+GI+DKYWA+  IP ++  
Sbjct: 239 ATYVLHEGLIGVMGQDGLQEIKYSKIEDNKDISFKDVIGGWVGITDKYWAATLIPPQDEK 298

Query: 271 FHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRF 330
           F  +F + ++   RYQ+   +  +T+ PG+S    N +FAGAK   TI +YE    I +F
Sbjct: 299 FTGRFSHFTNDRPRYQSDLLSAPLTVAPGQSQKIQNRVFAGAKVVNTIQNYETKYHIKQF 358

Query: 331 EMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMK 390
           ++LIDWGWFYFI KPMF L+ + Y   GNFG+AI++ TV +K LFFPLA K Y S A MK
Sbjct: 359 DLLIDWGWFYFITKPMFYLIDWIYKFTGNFGVAILVVTVLLKALFFPLANKSYKSMARMK 418

Query: 391 NIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISIS 450
            +QPK+ E+REK+     +  Q+AM++LYK   INPLAGCWP+L+QIPVFFA+YKV+ ++
Sbjct: 419 LMQPKMTEIREKYADDKMK-QQQAMMELYKREKINPLAGCWPVLVQIPVFFALYKVLYVT 477

Query: 451 LEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPP 510
           +EMRHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G+WPIIM ++MF+QM+M+P 
Sbjct: 478 IEMRHAPFFGWIQDLAAPDPTSIFNLFGLLPYTVPHFLMIGVWPIIMGITMFLQMRMNPT 537

Query: 511 PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL 570
           P D  QA I  WMP++F F L+SFPAGL+IYW+W+N +SI+QQ+VIMK  G +I L D L
Sbjct: 538 PPDPTQAAIFTWMPIIFTFMLASFPAGLVIYWAWNNTLSIIQQSVIMKRQGVKIELFDNL 597

Query: 571 RSTFSK 576
           +  F +
Sbjct: 598 KGLFRR 603


>gi|306846225|ref|ZP_07478787.1| inner membrane protein translocase component YidC [Brucella sp.
           BO1]
 gi|306273476|gb|EFM55337.1| inner membrane protein translocase component YidC [Brucella sp.
           BO1]
          Length = 610

 Score =  565 bits (1457), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 273/607 (44%), Positives = 388/607 (63%), Gaps = 33/607 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQ--------------- 45
           ME   N+F+ IALS++I+  WQ FY+ P+ E    E+  I+  ++               
Sbjct: 1   MENKRNFFITIALSILILTLWQVFYLGPKTEA-QREQARIEEQQRQAQQAAQNRQASSST 59

Query: 46  -------------PNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDL 92
                        P Q D   A   +  R  A++ SPR+E+  PSL GSINL GA+ DDL
Sbjct: 60  GDTPQMPANPDSIPGQGDTKAAGAPLT-RDAAIAQSPRIEIDTPSLRGSINLTGARLDDL 118

Query: 93  NLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTP 152
            L+ YH  VS  SP + LL+PS+ K  YF EL +        +P  NTVW +   K LTP
Sbjct: 119 YLKKYHETVSDKSPEIELLAPSSLKQGYFVELGFTGNDATGTVPGPNTVWVVEGNKKLTP 178

Query: 153 TTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR-HKPQTAT 211
           +TP+ L + N  N+ F+R IS+D+ Y+F + DT+ N+    +  +  GR+ R ++P+ A+
Sbjct: 179 STPVTLTYTNDKNLTFKRVISVDDAYMFTVDDTIINDGGSTVSLASYGRVTRFNQPEHAS 238

Query: 212 NTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHES-NSWLGISDKYWASVFIPSKETS 270
            T+ + EG I V+G   L E KY+ IE +   +F +    W+GI+DKYWA+  IP ++  
Sbjct: 239 ATYVLHEGLIGVMGQDGLQEIKYAKIEDNKDISFKDVIGGWVGITDKYWAATLIPPQDEK 298

Query: 271 FHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRF 330
           F  +F + ++   RYQ+   +  +T+ PG+S    N +FAGAK   TI +YE    I +F
Sbjct: 299 FTGRFSHFTNDRPRYQSDLLSAPLTVAPGQSQKIQNRVFAGAKVVNTIQNYETKYHIKQF 358

Query: 331 EMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMK 390
           ++LIDWGWFYFI KPMF L+ + Y   GNFG+AI++ TV +K LFFPLA K Y S A MK
Sbjct: 359 DLLIDWGWFYFITKPMFYLIDWIYKFTGNFGVAILVVTVLLKALFFPLANKSYKSMARMK 418

Query: 391 NIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISIS 450
            +QPK+ E+REK+     +  Q+AM++LYK   INPLAGCWP+L+QIPVFFA+YKV+ ++
Sbjct: 419 LMQPKMTEIREKYADDKMK-QQQAMMELYKREKINPLAGCWPVLVQIPVFFALYKVLYVT 477

Query: 451 LEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPP 510
           +EMRHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G+WPIIM ++MF+QM+M+P 
Sbjct: 478 IEMRHAPFFGWIQDLAAPDPTSIFNLFGLLPYTVPHFLMIGVWPIIMGITMFLQMRMNPT 537

Query: 511 PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL 570
           P D  QA I  WMP++F F L+SFPAGL+IYW+W+N +SI+QQ+VIMK  G +I L D L
Sbjct: 538 PPDPTQAAIFTWMPIIFTFMLASFPAGLVIYWAWNNTLSIIQQSVIMKRQGVKIELFDNL 597

Query: 571 RSTFSKN 577
           +  F + 
Sbjct: 598 KGLFRRK 604


>gi|254712779|ref|ZP_05174590.1| putative inner membrane protein translocase component YidC
           [Brucella ceti M644/93/1]
 gi|254715848|ref|ZP_05177659.1| putative inner membrane protein translocase component YidC
           [Brucella ceti M13/05/1]
 gi|261217609|ref|ZP_05931890.1| inner membrane protein oxaA [Brucella ceti M13/05/1]
 gi|261320486|ref|ZP_05959683.1| inner membrane protein oxaA [Brucella ceti M644/93/1]
 gi|260922698|gb|EEX89266.1| inner membrane protein oxaA [Brucella ceti M13/05/1]
 gi|261293176|gb|EEX96672.1| inner membrane protein oxaA [Brucella ceti M644/93/1]
          Length = 609

 Score =  565 bits (1456), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 273/605 (45%), Positives = 387/605 (63%), Gaps = 32/605 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQ--------------- 45
           ME   N+F+ IALS++I+  WQ FY+ P+ E    E+  I+  ++               
Sbjct: 1   MENKRNFFITIALSILILALWQVFYLGPKTEA-QREQARIEEQQRQAQQAAQNRQASSTG 59

Query: 46  ------------PNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLN 93
                       P Q D   A   +  R  A++ SPR+E+  PSL GSINL GA+ DDL 
Sbjct: 60  DTPQMPANPDSIPGQGDTKAAGAPLT-RDAAIAQSPRIEIDTPSLRGSINLTGARLDDLY 118

Query: 94  LRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPT 153
           L+ YH  VS  SP + LL+PS+ K  YF EL +        +P  NTVW +     LTP+
Sbjct: 119 LKKYHETVSDKSPEIELLAPSSLKQGYFVELGFTGNDATGAVPGPNTVWVVEGNNKLTPS 178

Query: 154 TPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR-HKPQTATN 212
           TP+ L + N  N+ F+R IS+D+ Y+F + DT+ NN    +  +  GR+ R ++P+ A+ 
Sbjct: 179 TPVTLTYTNDKNLTFKRVISVDDAYMFTVDDTIINNGGSTVSLASYGRVTRFNQPEHASA 238

Query: 213 TFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHES-NSWLGISDKYWASVFIPSKETSF 271
           T+ + EG I V+G   L E KY+ IE +   +F +    W+GI+DKYWA+  IP ++  F
Sbjct: 239 TYVLHEGLIGVMGQDGLQEIKYAKIEDNKDISFKDVIGGWVGITDKYWAATLIPPQDEKF 298

Query: 272 HSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFE 331
             +F + ++   RYQ+   +  +T+ PG+S    N +FAGAK   TI +YE    I +F+
Sbjct: 299 TGRFSHFTNDRPRYQSDLLSAPLTVAPGQSQKIQNRVFAGAKVVNTIQNYETKYHIKQFD 358

Query: 332 MLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKN 391
           +LIDWGWFYFI KPMF L+ + Y   GNFG+AI++ TV +K LFFPLA K Y S A MK 
Sbjct: 359 LLIDWGWFYFITKPMFYLIDWIYKFTGNFGVAILVVTVLLKALFFPLANKSYKSMARMKL 418

Query: 392 IQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISL 451
           +QPK+ E+REK+     +  Q+AM++LYK   INPLAGCWP+L+QIPVFFA+YKV+ +++
Sbjct: 419 MQPKMTEIREKYADDKMK-QQQAMMELYKREKINPLAGCWPVLVQIPVFFALYKVLYVTI 477

Query: 452 EMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP 511
           EMRHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G+WPIIM ++MF+QM+M+P P
Sbjct: 478 EMRHAPFFGWIQDLAAPDPTSIFNLFGLLPYTVPHFLMIGVWPIIMGITMFLQMRMNPTP 537

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLR 571
            D  QA I  WMP++F F L+SFPAGL+IYW+W+N +SI+QQ+VIMK  G +I L D L+
Sbjct: 538 PDPTQAAIFTWMPIIFTFMLASFPAGLVIYWAWNNTLSIIQQSVIMKRQGVKIELFDNLK 597

Query: 572 STFSK 576
             F +
Sbjct: 598 GLFRR 602


>gi|225686778|ref|YP_002734750.1| putative inner membrane protein translocase component YidC
           [Brucella melitensis ATCC 23457]
 gi|256262088|ref|ZP_05464620.1| inner membrane protein [Brucella melitensis bv. 2 str. 63/9]
 gi|225642883|gb|ACO02796.1| Inner membrane protein oxaA [Brucella melitensis ATCC 23457]
 gi|263091777|gb|EEZ16108.1| inner membrane protein [Brucella melitensis bv. 2 str. 63/9]
 gi|326411186|gb|ADZ68250.1| putative inner membrane protein translocase component YidC
           [Brucella melitensis M28]
 gi|326554477|gb|ADZ89116.1| putative inner membrane protein translocase component YidC
           [Brucella melitensis M5-90]
          Length = 610

 Score =  565 bits (1455), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 273/606 (45%), Positives = 387/606 (63%), Gaps = 33/606 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQ--------------- 45
           ME   N+F+ IALS++I+  WQ FY+ P+ E    E+  I+  ++               
Sbjct: 1   MENKRNFFITIALSILILALWQVFYLGPKTEA-QREQARIEEQQRQAQQAAQNRQASSST 59

Query: 46  -------------PNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDL 92
                        P Q D   A   +  R  A++ SPR+E+  PSL GSINL GA+ DDL
Sbjct: 60  GDTPQMPANPDSIPGQGDTKAAGAPLT-RDAAIAQSPRIEIDTPSLRGSINLTGARLDDL 118

Query: 93  NLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTP 152
            L+ YH  VS  SP + LL+PS+ K  YF EL +        +P  NTVW +     LTP
Sbjct: 119 YLKKYHETVSDKSPEIELLAPSSLKQGYFVELGFTGNDATGAVPGPNTVWVVEGNNKLTP 178

Query: 153 TTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR-HKPQTAT 211
           +TP+ L + N  N+ F+R IS+D+ Y+F + DT+ NN    +  +  GR+ R ++P+ A+
Sbjct: 179 STPVTLTYTNDKNLTFKRVISVDDAYMFTVDDTIINNGGSTVSLASYGRVTRFNQPEHAS 238

Query: 212 NTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHES-NSWLGISDKYWASVFIPSKETS 270
            T+ + EG I V+G   L E KY+ IE +   +F +    W+GI+DKYWA+  IP ++  
Sbjct: 239 ATYVLHEGLIGVMGQDGLQEIKYAKIEDNKDISFKDVIGGWVGITDKYWAATLIPPQDEK 298

Query: 271 FHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRF 330
           F  +F + ++   RYQ+   +  +T+ PG+S    N +FAGAK   TI +YE    I +F
Sbjct: 299 FTGRFSHFTNDRPRYQSDLLSAPLTVAPGQSQKIQNRVFAGAKVVNTIQNYETKYHIKQF 358

Query: 331 EMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMK 390
           ++LIDWGWFYFI KPMF L+ + Y   GNFG+AI++ TV +K LFFPLA K Y S A MK
Sbjct: 359 DLLIDWGWFYFITKPMFYLIDWIYKFTGNFGVAILVVTVLLKALFFPLANKSYKSMARMK 418

Query: 391 NIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISIS 450
            +QPK+ E+REK+     +  Q+AM++LYK   INPLAGCWP+L+QIPVFFA+YKV+ ++
Sbjct: 419 LMQPKMTEIREKYADDKMK-QQQAMMELYKRERINPLAGCWPVLVQIPVFFALYKVLYVT 477

Query: 451 LEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPP 510
           +EMRHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G+WPIIM ++MF+QM+M+P 
Sbjct: 478 IEMRHAPFFGWIQDLAAPDPTSIFNLFGLLPYTVPHFLMIGVWPIIMGITMFLQMRMNPT 537

Query: 511 PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL 570
           P D  QA I  WMP++F F L+SFPAGL+IYW+W+N +SI+QQ+VIMK  G +I L D L
Sbjct: 538 PPDPTQAAIFTWMPIIFTFMLASFPAGLVIYWAWNNTLSIIQQSVIMKRQGVKIELFDNL 597

Query: 571 RSTFSK 576
           +  F +
Sbjct: 598 KGLFRR 603


>gi|62317852|ref|YP_223705.1| putative inner membrane protein translocase component YidC
           [Brucella abortus bv. 1 str. 9-941]
 gi|83269831|ref|YP_419122.1| putative inner membrane protein translocase component YidC
           [Brucella melitensis biovar Abortus 2308]
 gi|163845137|ref|YP_001622792.1| putative inner membrane protein translocase component YidC
           [Brucella suis ATCC 23445]
 gi|189023102|ref|YP_001932843.1| putative inner membrane protein translocase component YidC
           [Brucella abortus S19]
 gi|225629472|ref|ZP_03787505.1| Inner membrane protein oxaA [Brucella ceti str. Cudo]
 gi|237817392|ref|ZP_04596384.1| Inner membrane protein oxaA [Brucella abortus str. 2308 A]
 gi|254690662|ref|ZP_05153916.1| putative inner membrane protein translocase component YidC
           [Brucella abortus bv. 6 str. 870]
 gi|254696033|ref|ZP_05157861.1| putative inner membrane protein translocase component YidC
           [Brucella abortus bv. 3 str. Tulya]
 gi|254699142|ref|ZP_05160970.1| putative inner membrane protein translocase component YidC
           [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700218|ref|ZP_05162046.1| putative inner membrane protein translocase component YidC
           [Brucella suis bv. 5 str. 513]
 gi|254705520|ref|ZP_05167348.1| putative inner membrane protein translocase component YidC
           [Brucella pinnipedialis M163/99/10]
 gi|254710751|ref|ZP_05172562.1| putative inner membrane protein translocase component YidC
           [Brucella pinnipedialis B2/94]
 gi|254732586|ref|ZP_05191164.1| putative inner membrane protein translocase component YidC
           [Brucella abortus bv. 4 str. 292]
 gi|256015782|ref|YP_003105791.1| putative inner membrane protein translocase component YidC
           [Brucella microti CCM 4915]
 gi|256029134|ref|ZP_05442748.1| putative inner membrane protein translocase component YidC
           [Brucella pinnipedialis M292/94/1]
 gi|256058817|ref|ZP_05449033.1| putative inner membrane protein translocase component YidC
           [Brucella neotomae 5K33]
 gi|256111044|ref|ZP_05452106.1| putative inner membrane protein translocase component YidC
           [Brucella melitensis bv. 3 str. Ether]
 gi|256157326|ref|ZP_05455244.1| putative inner membrane protein translocase component YidC
           [Brucella ceti M490/95/1]
 gi|256253696|ref|ZP_05459232.1| putative inner membrane protein translocase component YidC
           [Brucella ceti B1/94]
 gi|256255844|ref|ZP_05461380.1| putative inner membrane protein translocase component YidC
           [Brucella abortus bv. 9 str. C68]
 gi|260167774|ref|ZP_05754585.1| putative inner membrane protein translocase component YidC
           [Brucella sp. F5/99]
 gi|260545087|ref|ZP_05820908.1| inner membrane protein [Brucella abortus NCTC 8038]
 gi|260756233|ref|ZP_05868581.1| inner membrane protein oxaA [Brucella abortus bv. 6 str. 870]
 gi|260760398|ref|ZP_05872746.1| inner membrane protein oxaA [Brucella abortus bv. 4 str. 292]
 gi|260763638|ref|ZP_05875970.1| inner membrane protein oxaA [Brucella abortus bv. 2 str. 86/8/59]
 gi|260882057|ref|ZP_05893671.1| inner membrane protein oxaA [Brucella abortus bv. 9 str. C68]
 gi|261216465|ref|ZP_05930746.1| inner membrane protein oxaA [Brucella abortus bv. 3 str. Tulya]
 gi|261220833|ref|ZP_05935114.1| inner membrane protein oxaA [Brucella ceti B1/94]
 gi|261312924|ref|ZP_05952121.1| inner membrane protein oxaA [Brucella pinnipedialis M163/99/10]
 gi|261318319|ref|ZP_05957516.1| inner membrane protein oxaA [Brucella pinnipedialis B2/94]
 gi|261322754|ref|ZP_05961951.1| inner membrane protein oxaA [Brucella neotomae 5K33]
 gi|261750713|ref|ZP_05994422.1| inner membrane protein oxaA [Brucella suis bv. 5 str. 513]
 gi|261757211|ref|ZP_06000920.1| inner membrane protein [Brucella sp. F5/99]
 gi|265986117|ref|ZP_06098674.1| inner membrane protein oxaA [Brucella pinnipedialis M292/94/1]
 gi|265992579|ref|ZP_06105136.1| inner membrane protein oxaA [Brucella melitensis bv. 3 str. Ether]
 gi|265995811|ref|ZP_06108368.1| inner membrane protein oxaA [Brucella ceti M490/95/1]
 gi|297249212|ref|ZP_06932913.1| preprotein translocase YidC subunit [Brucella abortus bv. 5 str.
           B3196]
 gi|62198045|gb|AAX76344.1| inner-membrane protein, 60 kDa [Brucella abortus bv. 1 str. 9-941]
 gi|82940105|emb|CAJ13152.1| 60 kDa inner membrane protein [Brucella melitensis biovar Abortus
           2308]
 gi|163675860|gb|ABY39970.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|189021676|gb|ACD74397.1| 60 kDa inner membrane protein [Brucella abortus S19]
 gi|225615968|gb|EEH13017.1| Inner membrane protein oxaA [Brucella ceti str. Cudo]
 gi|237788205|gb|EEP62421.1| Inner membrane protein oxaA [Brucella abortus str. 2308 A]
 gi|255998442|gb|ACU50129.1| putative inner membrane protein translocase component YidC
           [Brucella microti CCM 4915]
 gi|260098358|gb|EEW82232.1| inner membrane protein [Brucella abortus NCTC 8038]
 gi|260670716|gb|EEX57656.1| inner membrane protein oxaA [Brucella abortus bv. 4 str. 292]
 gi|260674059|gb|EEX60880.1| inner membrane protein oxaA [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676341|gb|EEX63162.1| inner membrane protein oxaA [Brucella abortus bv. 6 str. 870]
 gi|260871585|gb|EEX78654.1| inner membrane protein oxaA [Brucella abortus bv. 9 str. C68]
 gi|260918072|gb|EEX84933.1| inner membrane protein oxaA [Brucella abortus bv. 3 str. Tulya]
 gi|260919417|gb|EEX86070.1| inner membrane protein oxaA [Brucella ceti B1/94]
 gi|261297542|gb|EEY01039.1| inner membrane protein oxaA [Brucella pinnipedialis B2/94]
 gi|261298734|gb|EEY02231.1| inner membrane protein oxaA [Brucella neotomae 5K33]
 gi|261301950|gb|EEY05447.1| inner membrane protein oxaA [Brucella pinnipedialis M163/99/10]
 gi|261737195|gb|EEY25191.1| inner membrane protein [Brucella sp. F5/99]
 gi|261740466|gb|EEY28392.1| inner membrane protein oxaA [Brucella suis bv. 5 str. 513]
 gi|262550108|gb|EEZ06269.1| inner membrane protein oxaA [Brucella ceti M490/95/1]
 gi|262763449|gb|EEZ09481.1| inner membrane protein oxaA [Brucella melitensis bv. 3 str. Ether]
 gi|264658314|gb|EEZ28575.1| inner membrane protein oxaA [Brucella pinnipedialis M292/94/1]
 gi|297173081|gb|EFH32445.1| preprotein translocase YidC subunit [Brucella abortus bv. 5 str.
           B3196]
          Length = 610

 Score =  565 bits (1455), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 273/606 (45%), Positives = 387/606 (63%), Gaps = 33/606 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQ--------------- 45
           ME   N+F+ IALS++I+  WQ FY+ P+ E    E+  I+  ++               
Sbjct: 1   MENKRNFFITIALSILILALWQVFYLGPKTEA-QREQARIEEQQRQAQQAAQNRQASSST 59

Query: 46  -------------PNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDL 92
                        P Q D   A   +  R  A++ SPR+E+  PSL GSINL GA+ DDL
Sbjct: 60  GDTPQMPANPDSIPGQGDTKAAGAPLT-RDAAIAQSPRIEIDTPSLRGSINLTGARLDDL 118

Query: 93  NLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTP 152
            L+ YH  VS  SP + LL+PS+ K  YF EL +        +P  NTVW +     LTP
Sbjct: 119 YLKKYHETVSDKSPEIELLAPSSLKQGYFVELGFTGNDATGAVPGPNTVWVVEGNNKLTP 178

Query: 153 TTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR-HKPQTAT 211
           +TP+ L + N  N+ F+R IS+D+ Y+F + DT+ NN    +  +  GR+ R ++P+ A+
Sbjct: 179 STPVTLTYTNDKNLTFKRVISVDDAYMFTVDDTIINNGGSTVSLASYGRVTRFNQPEHAS 238

Query: 212 NTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHES-NSWLGISDKYWASVFIPSKETS 270
            T+ + EG I V+G   L E KY+ IE +   +F +    W+GI+DKYWA+  IP ++  
Sbjct: 239 ATYVLHEGLIGVMGQDGLQEIKYAKIEDNKDISFKDVIGGWVGITDKYWAATLIPPQDEK 298

Query: 271 FHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRF 330
           F  +F + ++   RYQ+   +  +T+ PG+S    N +FAGAK   TI +YE    I +F
Sbjct: 299 FTGRFSHFTNDRPRYQSDLLSAPLTVAPGQSQKIQNRVFAGAKVVNTIQNYETKYHIKQF 358

Query: 331 EMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMK 390
           ++LIDWGWFYFI KPMF L+ + Y   GNFG+AI++ TV +K LFFPLA K Y S A MK
Sbjct: 359 DLLIDWGWFYFITKPMFYLIDWIYKFTGNFGVAILVVTVLLKALFFPLANKSYKSMARMK 418

Query: 391 NIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISIS 450
            +QPK+ E+REK+     +  Q+AM++LYK   INPLAGCWP+L+QIPVFFA+YKV+ ++
Sbjct: 419 LMQPKMTEIREKYADDKMK-QQQAMMELYKREKINPLAGCWPVLVQIPVFFALYKVLYVT 477

Query: 451 LEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPP 510
           +EMRHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G+WPIIM ++MF+QM+M+P 
Sbjct: 478 IEMRHAPFFGWIQDLAAPDPTSIFNLFGLLPYTVPHFLMIGVWPIIMGITMFLQMRMNPT 537

Query: 511 PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL 570
           P D  QA I  WMP++F F L+SFPAGL+IYW+W+N +SI+QQ+VIMK  G +I L D L
Sbjct: 538 PPDPTQAAIFTWMPIIFTFMLASFPAGLVIYWAWNNTLSIIQQSVIMKRQGVKIELFDNL 597

Query: 571 RSTFSK 576
           +  F +
Sbjct: 598 KGLFRR 603


>gi|161621071|ref|YP_001594957.1| putative inner membrane protein translocase component YidC
           [Brucella canis ATCC 23365]
 gi|254703339|ref|ZP_05165167.1| putative inner membrane protein translocase component YidC
           [Brucella suis bv. 3 str. 686]
 gi|260567731|ref|ZP_05838200.1| inner membrane protein oxaA [Brucella suis bv. 4 str. 40]
 gi|261753969|ref|ZP_05997678.1| inner membrane protein oxaA [Brucella suis bv. 3 str. 686]
 gi|161337882|gb|ABX64186.1| Inner membrane protein oxaA [Brucella canis ATCC 23365]
 gi|260154396|gb|EEW89477.1| inner membrane protein oxaA [Brucella suis bv. 4 str. 40]
 gi|261743722|gb|EEY31648.1| inner membrane protein oxaA [Brucella suis bv. 3 str. 686]
          Length = 610

 Score =  563 bits (1452), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 272/606 (44%), Positives = 388/606 (64%), Gaps = 33/606 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQ--------------- 45
           ME   N+F+ IALS++I+  WQ FY+ P+ E +  E+  I+  ++               
Sbjct: 1   MENKRNFFITIALSILILALWQVFYLGPKTE-VQREQARIEEQQRQAQQAAQNRQASSST 59

Query: 46  -------------PNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDL 92
                        P Q D   A   +  R  A++ SPR+E+  PSL GSINL GA+ DDL
Sbjct: 60  GDTPQMPANPDSIPGQGDTKAAGAPLT-RDAAIAQSPRIEIDTPSLRGSINLTGARLDDL 118

Query: 93  NLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTP 152
            L+ YH  VS  SP + LL+PS+ K  YF EL +        +P  NTVW +     LTP
Sbjct: 119 YLKKYHETVSDKSPEIELLAPSSLKQGYFVELGFTGNDATGAVPGPNTVWVVEGNNKLTP 178

Query: 153 TTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR-HKPQTAT 211
           +TP+ L + N  N+ F+R IS+D+ Y+F + DT+ NN    +  +  GR+ R ++P+ A+
Sbjct: 179 STPVTLTYTNDKNLTFKRVISVDDAYMFTVDDTIINNGGSTVSLASYGRVTRFNQPEHAS 238

Query: 212 NTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHES-NSWLGISDKYWASVFIPSKETS 270
            T+ + EG I V+G   L E KY+ I+ +   +F +    W+GI+DKYWA+  IP ++  
Sbjct: 239 ATYVLHEGLIGVMGQDGLQEIKYAKIKDNKDISFKDVIGGWVGITDKYWAATLIPPQDEK 298

Query: 271 FHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRF 330
           F  +F + ++   RYQ+   +  +T+ PG+S    N +FAGAK   TI +YE    I +F
Sbjct: 299 FTGRFSHFTNDRPRYQSDLLSAPLTVAPGQSQKIQNRVFAGAKVVNTIQNYETKYHIKQF 358

Query: 331 EMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMK 390
           ++LIDWGWFYFI KPMF L+ + Y   GNFG+AI++ TV +K LFFPLA K Y S A MK
Sbjct: 359 DLLIDWGWFYFITKPMFYLIDWIYKFTGNFGVAILVVTVLLKALFFPLANKSYKSMARMK 418

Query: 391 NIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISIS 450
            +QPK+ E+REK+     +  Q+AM++LYK   INPLAGCWP+L+QIPVFFA+YKV+ ++
Sbjct: 419 LMQPKMTEIREKYADDKMK-QQQAMMELYKREKINPLAGCWPVLVQIPVFFALYKVLYVT 477

Query: 451 LEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPP 510
           +EMRHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G+WPIIM ++MF+QM+M+P 
Sbjct: 478 IEMRHAPFFGWIQDLAAPDPTSIFNLFGLLPYTVPHFLMIGVWPIIMGITMFLQMRMNPT 537

Query: 511 PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL 570
           P D  QA I  WMP++F F L+SFPAGL+IYW+W+N +SI+QQ+VIMK  G +I L D L
Sbjct: 538 PPDPTQAAIFTWMPIIFTFMLASFPAGLVIYWAWNNTLSIIQQSVIMKRQGVKIELFDNL 597

Query: 571 RSTFSK 576
           +  F +
Sbjct: 598 KGLFRR 603


>gi|254720149|ref|ZP_05181960.1| putative inner membrane protein translocase component YidC
           [Brucella sp. 83/13]
 gi|265985155|ref|ZP_06097890.1| inner membrane protein oxaA [Brucella sp. 83/13]
 gi|306839545|ref|ZP_07472352.1| inner membrane protein translocase component YidC [Brucella sp. NF
           2653]
 gi|264663747|gb|EEZ34008.1| inner membrane protein oxaA [Brucella sp. 83/13]
 gi|306405377|gb|EFM61649.1| inner membrane protein translocase component YidC [Brucella sp. NF
           2653]
          Length = 610

 Score =  563 bits (1452), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 272/607 (44%), Positives = 387/607 (63%), Gaps = 33/607 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQ--------------- 45
           ME   N+F+ IALS++I+  WQ FY+ P+ E    E+  I+  ++               
Sbjct: 1   MENKRNFFITIALSILILALWQVFYLGPKTEA-QREQARIEEQQRQAQQAAQNRQASSST 59

Query: 46  -------------PNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDL 92
                        P Q D   A   +  R  A++ SPR+E+  PSL GSINL GA+ DDL
Sbjct: 60  GDTPQMPANPDSIPGQGDTKAAGAPLT-RDAAIAQSPRIEIDTPSLRGSINLTGARLDDL 118

Query: 93  NLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTP 152
            L+ YH  VS  SP + LL+PS+ K  YF EL +        +P  NTVW +     LTP
Sbjct: 119 YLKKYHETVSDKSPEIELLAPSSLKQGYFVELGFTGNDATGTVPGPNTVWVVEGNNKLTP 178

Query: 153 TTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR-HKPQTAT 211
           +TP+ L + N  N+ F+R IS+D+ Y+F + DT+ N+    +  +  GR+ R ++P+ A+
Sbjct: 179 STPVTLTYTNDKNLTFKRVISVDDAYMFTVDDTIINDGGSTVSLASYGRVTRFNQPEHAS 238

Query: 212 NTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHES-NSWLGISDKYWASVFIPSKETS 270
            T+ + EG I V+G   L E KY+ IE +   +F +    W+GI+DKYWA+  IP ++  
Sbjct: 239 ATYVLHEGLIGVMGQDGLQEIKYAKIEDNKDISFKDVIGGWVGITDKYWAATLIPPQDEK 298

Query: 271 FHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRF 330
           F  +F + ++   RYQ+   +  +T+ PG+S    N +FAGAK   TI +YE    I +F
Sbjct: 299 FTGRFSHFTNDRPRYQSDLLSAPLTVAPGQSQKIQNRVFAGAKVVNTIQNYETKYHIKQF 358

Query: 331 EMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMK 390
           ++LIDWGWFYFI KPMF L+ + Y   GNFG+AI++ TV +K LFFPLA K Y S A MK
Sbjct: 359 DLLIDWGWFYFITKPMFYLIDWIYKFTGNFGVAILVVTVLLKALFFPLANKSYKSMARMK 418

Query: 391 NIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISIS 450
            +QPK+ E+REK+     +  Q+AM++LYK   INPLAGCWP+L+QIPVFFA+YKV+ ++
Sbjct: 419 LMQPKMTEIREKYADDKMK-QQQAMMELYKREKINPLAGCWPVLVQIPVFFALYKVLYVT 477

Query: 451 LEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPP 510
           +EMRHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G+WPIIM ++MF+QM+M+P 
Sbjct: 478 IEMRHAPFFGWIQDLAAPDPTSIFNLFGLLPYTVPHFLMIGVWPIIMGITMFLQMRMNPT 537

Query: 511 PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL 570
           P D  QA I  WMP++F F L+SFPAGL+IYW+W+N +SI+QQ+VIMK  G +I L D L
Sbjct: 538 PPDPTQAAIFTWMPIIFTFMLASFPAGLVIYWAWNNTLSIIQQSVIMKRQGVKIELFDNL 597

Query: 571 RSTFSKN 577
           +  F + 
Sbjct: 598 KGLFRRK 604


>gi|148558174|ref|YP_001257934.1| putative inner membrane protein translocase component YidC
           [Brucella ovis ATCC 25840]
 gi|148369459|gb|ABQ62331.1| inner-membrane protein, 60 kDa [Brucella ovis ATCC 25840]
          Length = 610

 Score =  563 bits (1451), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 272/607 (44%), Positives = 387/607 (63%), Gaps = 33/607 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQ--------------- 45
           ME   N+F+ IALS++I+  WQ FY+ P+ E    E+  I+  ++               
Sbjct: 1   MENKRNFFITIALSILILALWQVFYLGPKTEA-QREQARIEEQQRQAQQAAQNRQASSST 59

Query: 46  -------------PNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDL 92
                        P Q D   A   +  R  A++ SPR+E+  PSL GSINL GA+ DDL
Sbjct: 60  GDTPQMPANPDSIPGQGDTKAAGAPLT-RDAAIAQSPRIEIDTPSLRGSINLTGARLDDL 118

Query: 93  NLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTP 152
            L+ YH  VS  SP + LL+PS+ K  YF EL +        +P  NTVW +     LTP
Sbjct: 119 YLKKYHETVSDKSPEIELLAPSSLKQGYFVELGFAGNDATGAVPGPNTVWVVEGNNKLTP 178

Query: 153 TTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR-HKPQTAT 211
           +TP+ L + N  ++ F+R IS+D+ Y+F + DT+ NN    +  +  GR+ R ++P+ A+
Sbjct: 179 STPVTLTYTNDKSLTFKRVISVDDAYMFTVDDTIINNGGSTVSLASYGRVTRFNQPEHAS 238

Query: 212 NTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHES-NSWLGISDKYWASVFIPSKETS 270
            T+ + EG I V+G   L E KY+ IE +   +F +    W+GI+DKYWA+  IP ++  
Sbjct: 239 ATYVLHEGLIGVMGQDGLQEIKYAKIEDNKDISFKDVIGGWVGITDKYWAATLIPPQDEK 298

Query: 271 FHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRF 330
           F  +F + ++   RYQ+   +  +T+ PG+S    N +FAGAK   TI +YE    I +F
Sbjct: 299 FTGRFSHFTNDRPRYQSDLLSAPLTVAPGQSQKIQNRVFAGAKVVNTIQNYETKYHIKQF 358

Query: 331 EMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMK 390
           ++LIDWGWFYFI KPMF L+ + Y   GNFG+AI++ TV +K LFFPLA K Y S A MK
Sbjct: 359 DLLIDWGWFYFITKPMFYLIDWIYKFTGNFGVAILVVTVLLKALFFPLANKSYKSMARMK 418

Query: 391 NIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISIS 450
            +QPK+ E+REK+     +  Q+AM++LYK   INPLAGCWP+L+QIPVFFA+YKV+ ++
Sbjct: 419 LMQPKMTEIREKYADDKMK-QQQAMMELYKREKINPLAGCWPVLVQIPVFFALYKVLYVT 477

Query: 451 LEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPP 510
           +EMRHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G+WPIIM ++MF+QM+M+P 
Sbjct: 478 IEMRHAPFFGWIQDLAAPDPTSIFNLFGLLPYTVPHFLMIGVWPIIMGITMFLQMRMNPT 537

Query: 511 PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL 570
           P D  QA I  WMP++F F L+SFPAGL+IYW+W+N +SI+QQ+VIMK  G +I L D L
Sbjct: 538 PPDPTQAAIFTWMPIIFTFMLASFPAGLVIYWAWNNTLSIIQQSVIMKRQGVKIELFDNL 597

Query: 571 RSTFSKN 577
           +  F + 
Sbjct: 598 KGLFRRK 604


>gi|23500746|ref|NP_700186.1| putative inner membrane protein translocase component YidC
           [Brucella suis 1330]
 gi|38503028|sp|Q8FV29|OXAA_BRUSU RecName: Full=Inner membrane protein oxaA
 gi|23464400|gb|AAN34191.1| inner-membrane protein, 60 kDa [Brucella suis 1330]
          Length = 610

 Score =  563 bits (1450), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 272/606 (44%), Positives = 387/606 (63%), Gaps = 33/606 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQ--------------- 45
           ME   N+F+ IALS++I+  WQ FY+ P+ E    E+  I+  ++               
Sbjct: 1   MENKRNFFITIALSILILALWQVFYLGPKTEA-QREQARIEEQQRQAQQAAQNRQASSST 59

Query: 46  -------------PNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDL 92
                        P Q D   A   +  R  A++ SPR+E+  PSL GSINL GA+ DDL
Sbjct: 60  GDTPQMPANPDSIPGQGDTKAAGAPLT-RDAAIAQSPRIEIDTPSLRGSINLTGARLDDL 118

Query: 93  NLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTP 152
            L+ YH  VS  SP + LL+PS+ K  YF EL +        +P  NTVW +     LTP
Sbjct: 119 YLKKYHETVSDKSPEIELLAPSSLKQGYFVELGFTGNDATGAVPGPNTVWVVEGNNKLTP 178

Query: 153 TTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR-HKPQTAT 211
           +TP+ L + N  N+ F+R IS+D+ Y+F + DT+ NN    +  +  GR+ R ++P+ A+
Sbjct: 179 STPVTLTYTNDKNLTFKRVISVDDAYMFTVDDTIINNGGSTVSLASYGRVTRFNQPEHAS 238

Query: 212 NTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHES-NSWLGISDKYWASVFIPSKETS 270
            T+ + EG I V+G   L E KY+ I+ +   +F +    W+GI+DKYWA+  IP ++  
Sbjct: 239 ATYVLHEGLIGVMGQDGLQEIKYAKIKDNKDISFKDVIGGWVGITDKYWAATLIPPQDEK 298

Query: 271 FHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRF 330
           F  +F + ++   RYQ+   +  +T+ PG+S    N +FAGAK   TI +YE    I +F
Sbjct: 299 FTGRFSHFTNDRPRYQSDLLSAPLTVAPGQSQKIQNRVFAGAKVVNTIQNYETKYHIKQF 358

Query: 331 EMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMK 390
           ++LIDWGWFYFI KPMF L+ + Y   GNFG+AI++ TV +K LFFPLA K Y S A MK
Sbjct: 359 DLLIDWGWFYFITKPMFYLIDWIYKFTGNFGVAILVVTVLLKALFFPLANKSYKSMARMK 418

Query: 391 NIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISIS 450
            +QPK+ E+REK+     +  Q+AM++LYK   INPLAGCWP+L+QIPVFFA+YKV+ ++
Sbjct: 419 LMQPKMTEIREKYADDKMK-QQQAMMELYKREKINPLAGCWPVLVQIPVFFALYKVLYVT 477

Query: 451 LEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPP 510
           +EMRHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G+WPIIM ++MF+QM+M+P 
Sbjct: 478 IEMRHAPFFGWIQDLAAPDPTSIFNLFGLLPYTVPHFLMIGVWPIIMGITMFLQMRMNPT 537

Query: 511 PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL 570
           P D  QA I  WMP++F F L+SFPAGL+IYW+W+N +SI+QQ+VIMK  G +I L D L
Sbjct: 538 PPDPTQAAIFTWMPIIFTFMLASFPAGLVIYWAWNNTLSIIQQSVIMKRQGVKIELFDNL 597

Query: 571 RSTFSK 576
           +  F +
Sbjct: 598 KGLFRR 603


>gi|114706827|ref|ZP_01439727.1| putative inner membrane transmembrane protein [Fulvimarina pelagi
           HTCC2506]
 gi|114537775|gb|EAU40899.1| putative inner membrane transmembrane protein [Fulvimarina pelagi
           HTCC2506]
          Length = 603

 Score =  563 bits (1450), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 278/599 (46%), Positives = 382/599 (63%), Gaps = 26/599 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERK------NIQTVKQPNQVDN--- 51
           ME N N+ +A+ALS++++  WQ   + PR++E   + +      ++QT + P   D    
Sbjct: 1   MEMNRNFLIAMALSIMVLVGWQFLVIGPRMDEQQRQNEIAQNEGSLQTPQTPAGSDQDSL 60

Query: 52  ---SYAAVLI--------DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLD 100
              S    ++          R Q ++   RV +  P L GSINL GA+ DDL L+ YH  
Sbjct: 61  TAPSGRESMVPSPNLPQNQSREQVIAGGNRVTIDTPELTGSINLTGARLDDLRLKHYHET 120

Query: 101 VSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVF 160
           V  +SP + LLSP    N YFAE   +      +L  +NT W    G  LTP TP+ L  
Sbjct: 121 VDDSSPTIVLLSPEELPNGYFAEYGLIQPGTG-QLVGANTEWQAEDGAELTPDTPVTLTA 179

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEG 219
              + +   R IS+D++++F   DTV N     ++ SP GRI R+ KP+ A   F + EG
Sbjct: 180 TTESGLTVTRRISVDDNFMFTYEDTVENTGDAAVQVSPYGRIARYSKPEVAA-AFVLFEG 238

Query: 220 FIAVLGDKSLVEQKYSDIEKSSISNFHESNS--WLGISDKYWASVFIPSKETSFHSQFKY 277
            + V G++ L E  YSDIE  +      S+   WLGI+DKYWA+  +P     F SQF Y
Sbjct: 239 LLGVFGEEGLDEVSYSDIEDDTRLRQPASSGGGWLGITDKYWATALVPEVGRDFESQFLY 298

Query: 278 LSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWG 337
            ++G + YQ +F ++ ++I PG + +  N  FAGAKE   I+ YE+ L I +F  LIDWG
Sbjct: 299 RTNGRSHYQTEFVSDPVSIAPGAAASMVNRTFAGAKEVDKINAYEEQLNIRQFGQLIDWG 358

Query: 338 WFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKID 397
           WFYFI +PMF  + Y Y LVGNFGIAI+  TV +KL+FFPLA K Y S A MK IQPK+ 
Sbjct: 359 WFYFITRPMFTALDYIYRLVGNFGIAILAVTVILKLIFFPLANKSYKSMARMKTIQPKVM 418

Query: 398 ELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAP 457
           ELRE+FK    Q  Q+ M+QLY++  INP AGCWPIL+QIPVFFA+YKV+ +++EMRHAP
Sbjct: 419 ELRERFKDDR-QKQQQEMMQLYRSEKINPAAGCWPILIQIPVFFALYKVLYVTIEMRHAP 477

Query: 458 FWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQA 517
           F+GWI+DLAA DPT+IF LFG+LP+ +PG + +G+WP++M L+MFIQM+++P P D  QA
Sbjct: 478 FFGWIQDLAAPDPTSIFNLFGLLPYDVPGILLIGVWPLLMGLTMFIQMRLNPTPPDPTQA 537

Query: 518 MILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSK 576
           MI  WMPVVF F L++FPAGL+IYW+W+N +SI+QQ+VIMK +GA+I L D LR  F +
Sbjct: 538 MIFTWMPVVFTFMLATFPAGLVIYWTWNNFLSIIQQSVIMKRNGAKIELFDNLRGMFKR 596


>gi|161511178|ref|NP_541252.2| putative inner membrane protein translocase component YidC
           [Brucella melitensis bv. 1 str. 16M]
 gi|256043891|ref|ZP_05446811.1| putative inner membrane protein translocase component YidC
           [Brucella melitensis bv. 1 str. Rev.1]
 gi|260565068|ref|ZP_05835553.1| inner membrane protein oxaA [Brucella melitensis bv. 1 str. 16M]
 gi|265990314|ref|ZP_06102871.1| inner membrane protein oxaA [Brucella melitensis bv. 1 str. Rev.1]
 gi|38503114|sp|Q8YDA3|OXAA_BRUME RecName: Full=Inner membrane protein oxaA
 gi|260152711|gb|EEW87804.1| inner membrane protein oxaA [Brucella melitensis bv. 1 str. 16M]
 gi|263000983|gb|EEZ13673.1| inner membrane protein oxaA [Brucella melitensis bv. 1 str. Rev.1]
          Length = 610

 Score =  563 bits (1450), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 273/606 (45%), Positives = 386/606 (63%), Gaps = 33/606 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQ--------------- 45
           ME   N+F+ IALS++I+  WQ FY+ P+ E    E+  I+  ++               
Sbjct: 1   MENKRNFFITIALSILILALWQVFYLGPKTEA-QREQARIEEQQRQAQQAAQNRQASSST 59

Query: 46  -------------PNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDL 92
                        P Q D   A   +  R  A++ SPR+E+  PSL GSINL GA+ DDL
Sbjct: 60  GDTPQMPANPDSIPGQGDTKAAGAPLT-RDAAIAQSPRIEIDTPSLRGSINLTGARLDDL 118

Query: 93  NLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTP 152
            L+ YH  VS  SP + LL+PS+ K  YF EL +        +P  NTVW +     LTP
Sbjct: 119 YLKKYHETVSDKSPEIELLAPSSLKQGYFVELGFTGNDATGAVPGPNTVWVVEGNNKLTP 178

Query: 153 TTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR-HKPQTAT 211
           +TP+ L + N  N+ F+R IS+D+ Y+F + DT+ NN    +  +  GR+ R ++P+ A+
Sbjct: 179 STPVTLTYTNDKNLTFKRVISVDDAYMFTVDDTIINNGGSTVSLASYGRVTRFNQPEHAS 238

Query: 212 NTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHES-NSWLGISDKYWASVFIPSKETS 270
            T+ + EG I V+G   L E KY+ IE +   +F +    W+GI+DKYWA+  IP ++  
Sbjct: 239 ATYVLHEGLIGVMGQDGLQEIKYAKIEDNKDISFKDVIGGWVGITDKYWAATLIPPQDEK 298

Query: 271 FHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRF 330
           F  +F + ++   RYQ+   +  +T+ PG+S    N +FAGAK   TI +YE    I +F
Sbjct: 299 FTGRFSHFTNDRPRYQSDLLSAPLTVAPGQSQKIQNRVFAGAKVVNTIQNYETKYHIKQF 358

Query: 331 EMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMK 390
           ++LIDWGWFYFI KPMF L+ + Y   GNFG+AI++ TV +K LFFPLA K Y S A MK
Sbjct: 359 DLLIDWGWFYFITKPMFYLIDWIYKFTGNFGVAILVVTVLLKALFFPLANKSYKSMARMK 418

Query: 391 NIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISIS 450
            +QPK+ E+REK+     +  Q+AM++LYK   INPLAGCWP+L+QIPVFFA+YKV+ ++
Sbjct: 419 LMQPKMTEIREKYADDKMK-QQQAMMELYKREKINPLAGCWPVLVQIPVFFALYKVLYVT 477

Query: 451 LEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPP 510
           +EMRHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G+WPIIM + MF+QM+M+P 
Sbjct: 478 IEMRHAPFFGWIQDLAAPDPTSIFNLFGLLPYTVPHFLMIGVWPIIMGIIMFLQMRMNPT 537

Query: 511 PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL 570
           P D  QA I  WMP++F F L+SFPAGL+IYW+W+N +SI+QQ+VIMK  G +I L D L
Sbjct: 538 PPDPTQAAIFTWMPIIFTFMLASFPAGLVIYWAWNNTLSIIQQSVIMKRQGVKIELFDNL 597

Query: 571 RSTFSK 576
           +  F +
Sbjct: 598 KGLFRR 603


>gi|110632737|ref|YP_672945.1| putative inner membrane protein translocase component YidC
           [Mesorhizobium sp. BNC1]
 gi|110283721|gb|ABG61780.1| protein translocase subunit yidC [Chelativorans sp. BNC1]
          Length = 609

 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 276/606 (45%), Positives = 376/606 (62%), Gaps = 31/606 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIE-------------EMNNERKNIQTVKQP- 46
           ME N N  + IALSV+I+  WQ FYV PR++             +   E+   Q    P 
Sbjct: 1   MENNRNLLITIALSVVILTLWQVFYVNPRVDAQREAAQIEAQRAQETEEKLGTQGADIPA 60

Query: 47  -------NQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHL 99
                    V  S        R +AL+ + RV +  P L G+INL GA+ DDL L+ Y +
Sbjct: 61  PGATPGSTAVPGSAIPRTQVTRQEALAGAERVTIDTPRLAGTINLAGARLDDLLLKDYRV 120

Query: 100 DVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLV 159
            V  +SP + LL P+     YF E+ Y   A+   +P  +TVW L  G  L+P +P+ L 
Sbjct: 121 TVDKDSPNIDLLGPAGLPEGYFVEVGYTGNASTGAVPGPDTVWQLQEGSTLSPGSPVTLS 180

Query: 160 FKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR-HKPQTATNTFGVQE 218
           F N   + F RT ++DE+YLF I DT+ N + + +     GR  R  +P+TA   + + E
Sbjct: 181 FTNDRGLTFLRTFAVDENYLFTITDTIRNAAGEPVEIRNYGRTTRFGQPKTA-GIYILHE 239

Query: 219 GFIAVLGDKSLVEQKYSDI-EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKY 277
           GFI VLG++ L E  YS   E   +     ++ WLGI+DKYWA   +P  +  F  +F Y
Sbjct: 240 GFIGVLGEEGLREVDYSTAQEDGQVLPGKSADGWLGITDKYWAVTMVPRAQKDFEPRFAY 299

Query: 278 LSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWG 337
            SDG  RYQA +  + +T+ PG        +FAGAKE   +  YE    I +FE+LIDWG
Sbjct: 300 FSDGRERYQADYLTDPVTVAPGGEAKIETLVFAGAKEVHVVDAYETQHNIRQFELLIDWG 359

Query: 338 WFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKID 397
           WFYFI KPMF L+ + + L+GNFG+AI+ TTVFVKL+FFPLA K Y S ANMK +QP + 
Sbjct: 360 WFYFITKPMFYLIDWLFRLLGNFGVAILATTVFVKLVFFPLANKSYKSMANMKKVQPALL 419

Query: 398 ELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAP 457
           E+REK+     +  Q+AM++LYK   INPLAGCWPIL+QIPVFFA+YKV+ +++EMRHAP
Sbjct: 420 EIREKYADDKMK-QQQAMMELYKKEKINPLAGCWPILIQIPVFFALYKVLYVTIEMRHAP 478

Query: 458 FWGWIKDLAAADPTNIFTLFGILPF------YLPGFMHVGIWPIIMSLSMFIQMKMSPPP 511
           F+GWI+DL+A DPT IF LFG+LPF          F+ +G+WPIIM ++MF+QM+M+P P
Sbjct: 479 FFGWIQDLSAPDPTTIFNLFGLLPFDPSQVPVFGPFLMLGVWPIIMGITMFLQMRMNPTP 538

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLR 571
            D  QAMI NWMPV+F F L++FPAGL+IYW+W+N++SI+QQ VIMK  GA+I L D + 
Sbjct: 539 PDPTQAMIFNWMPVIFTFMLATFPAGLVIYWAWNNLLSIIQQGVIMKRQGAKIELWDNMV 598

Query: 572 STFSKN 577
           + F + 
Sbjct: 599 NLFRRK 604


>gi|90419893|ref|ZP_01227802.1| putative inner membrane protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335934|gb|EAS49682.1| putative inner membrane protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 609

 Score =  550 bits (1417), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 268/605 (44%), Positives = 375/605 (61%), Gaps = 30/605 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQ-TVKQPN---QVDNSYAAV 56
           M+ N N+ +A+ LS+ ++  WQ   V PR+E    E +  Q TV Q +   Q   + A  
Sbjct: 1   MQNNRNFLIAMILSIGVLVGWQFLVVSPRMEAQRLETEAAQPTVAQNDGSLQTPQTPAGT 60

Query: 57  LIDD-----------------------RAQALSMSPRVELKNPSLIGSINLKGAQFDDLN 93
             D+                       R QA++   RV +  P+L GSINL GA+ DDL 
Sbjct: 61  PQDNVAAPAGRESVVPEQDALPATDETREQAIAAGSRVAIDTPALSGSINLTGARLDDLR 120

Query: 94  LRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPT 153
           L+ YH  V  +SP + LLSP    + YFAE  Y+      ELP  +T+W    G+ LTP 
Sbjct: 121 LKNYHETVDDSSPTIVLLSPERLPSGYFAEFGYLGRDAG-ELPGPSTIWQAEGGQSLTPN 179

Query: 154 TPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNT 213
           +P+ L   N   + FERTIS+D+ ++F   DT+ N     +  S  GR+ R+      + 
Sbjct: 180 SPVTLTATNGAGVTFERTISVDDRFMFTYEDTIRNEGSAPLTLSSYGRVTRYSKPEVASV 239

Query: 214 FGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNS-WLGISDKYWASVFIPSKETSFH 272
           + + EG + V GD  L E KYS IE        +S+S WLGI+DKYWA+  +P     F 
Sbjct: 240 YVLFEGLLGVFGDDGLSEIKYSTIEDDQRYTPPKSSSGWLGITDKYWATTLVPEAGRPFQ 299

Query: 273 SQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEM 332
           S+F Y++DG   YQ ++  + +T+ PG + T  +  FAGAK    I  YE+   I +F  
Sbjct: 300 SRFLYMTDGRPHYQTEYVTDPVTVEPGATATNVSRTFAGAKVVSDIDSYEERYDIRQFGQ 359

Query: 333 LIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNI 392
           LIDWGWFYFI +PMF  + + Y+++GNFG+AI+  TV +KL+FFPLA K Y S A MKN+
Sbjct: 360 LIDWGWFYFITRPMFHALDWLYSVIGNFGVAILAVTVVLKLIFFPLANKSYKSMARMKNM 419

Query: 393 QPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLE 452
           QPKI E+RE+FK    Q  Q+ M+++Y+   INP AGCWPIL+QIPVFFA+YKV+ +++E
Sbjct: 420 QPKIMEMRERFKDDK-QKQQQEMMRIYREEKINPAAGCWPILIQIPVFFALYKVLYVTIE 478

Query: 453 MRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPA 512
           MRHAPF+GWI+DLAA DPT+IF LFG++P  LP  + VG+WPI+M ++MF+QM+++P P 
Sbjct: 479 MRHAPFFGWIQDLAAPDPTSIFNLFGLIPLELPHLLMVGVWPILMGITMFVQMRLNPTPP 538

Query: 513 DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRS 572
           D  Q MI  WMPVVF F L+SFPAGL+IYW+W+N++S++QQ+VIMK +G +I L D LR 
Sbjct: 539 DPTQQMIFTWMPVVFTFMLASFPAGLVIYWTWNNLLSVIQQSVIMKRNGTKIELWDNLRG 598

Query: 573 TFSKN 577
            F + 
Sbjct: 599 MFRRK 603


>gi|17984422|gb|AAL53516.1| 60 kDa inner membrane protein yidc [Brucella melitensis bv. 1 str.
           16M]
          Length = 588

 Score =  546 bits (1408), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 256/534 (47%), Positives = 358/534 (67%), Gaps = 4/534 (0%)

Query: 46  PNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNS 105
           P Q D   A   +  R  A++ SPR+E+  PSL GSINL GA+ DDL L+ YH  VS  S
Sbjct: 51  PGQGDTKAAGAPLT-RDAAIAQSPRIEIDTPSLRGSINLTGARLDDLYLKKYHETVSDKS 109

Query: 106 PIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANN 165
           P + LL+PS+ K  YF EL +        +P  NTVW +     LTP+TP+ L + N  N
Sbjct: 110 PEIELLAPSSLKQGYFVELGFTGNDATGAVPGPNTVWVVEGNNKLTPSTPVTLTYTNDKN 169

Query: 166 ILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR-HKPQTATNTFGVQEGFIAVL 224
           + F+R IS+D+ Y+F + DT+ NN    +  +  GR+ R ++P+ A+ T+ + EG I V+
Sbjct: 170 LTFKRVISVDDAYMFTVDDTIINNGGSTVSLASYGRVTRFNQPEHASATYVLHEGLIGVM 229

Query: 225 GDKSLVEQKYSDIEKSSISNFHES-NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
           G   L E KY+ IE +   +F +    W+GI+DKYWA+  IP ++  F  +F + ++   
Sbjct: 230 GQDGLQEIKYAKIEDNKDISFKDVIGGWVGITDKYWAATLIPPQDEKFTGRFSHFTNDRP 289

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
           RYQ+   +  +T+ PG+S    N +FAGAK   TI +YE    I +F++LIDWGWFYFI 
Sbjct: 290 RYQSDLLSAPLTVAPGQSQKIQNRVFAGAKVVNTIQNYETKYHIKQFDLLIDWGWFYFIT 349

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           KPMF L+ + Y   GNFG+AI++ TV +K LFFPLA K Y S A MK +QPK+ E+REK+
Sbjct: 350 KPMFYLIDWIYKFTGNFGVAILVVTVLLKALFFPLANKSYKSMARMKLMQPKMTEIREKY 409

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
                +  Q+AM++LYK   INPLAGCWP+L+QIPVFFA+YKV+ +++EMRHAPF+GWI+
Sbjct: 410 ADDKMK-QQQAMMELYKREKINPLAGCWPVLVQIPVFFALYKVLYVTIEMRHAPFFGWIQ 468

Query: 464 DLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWM 523
           DLAA DPT+IF LFG+LP+ +P F+ +G+WPIIM + MF+QM+M+P P D  QA I  WM
Sbjct: 469 DLAAPDPTSIFNLFGLLPYTVPHFLMIGVWPIIMGIIMFLQMRMNPTPPDPTQAAIFTWM 528

Query: 524 PVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           P++F F L+SFPAGL+IYW+W+N +SI+QQ+VIMK  G +I L D L+  F + 
Sbjct: 529 PIIFTFMLASFPAGLVIYWAWNNTLSIIQQSVIMKRQGVKIELFDNLKGLFRRK 582


>gi|319780382|ref|YP_004139858.1| membrane protein insertase, YidC/Oxa1 family domain containing
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317166270|gb|ADV09808.1| membrane protein insertase, YidC/Oxa1 family domain containing
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 603

 Score =  546 bits (1407), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 273/599 (45%), Positives = 380/599 (63%), Gaps = 23/599 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNN----ERKNIQTVKQ----------- 45
           ME N N+F+ IALSV+I+  WQ FYV PR E        E++ ++  K+           
Sbjct: 1   MENNRNFFITIALSVLILAVWQYFYVLPRSEAQREAARVEQQRVEEQKKAAGTNPGTDTG 60

Query: 46  ----PNQVDNSYA--AVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHL 99
               P  + N+    AV    R QAL+ + R ++  PSL GSINL GA+ DDL L+ Y  
Sbjct: 61  TPAAPGAIPNAPGTDAVTPAGREQALATTTRAKIDTPSLEGSINLTGARLDDLKLKHYTE 120

Query: 100 DVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLV 159
            V  NSP ++LL+P+   N Y+AE+ +V       +P   TVW +     LTPTTP+ L 
Sbjct: 121 TVDKNSPEISLLNPAALPNGYYAEIGFVGNDKTGAVPGPETVWAVDGNATLTPTTPVTLT 180

Query: 160 FKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEG 219
           + N   + F+RT S+D +Y+F + DTV N     +  S  GR+ R       +T+ + EG
Sbjct: 181 YSNDKGLTFKRTFSVDTNYMFTVSDTVQNAGTAAVSLSNYGRVTRFDKPLVASTYVLHEG 240

Query: 220 FIAVLGDKSLVEQKYSDIEKS-SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYL 278
            I   G + L E KY+ IEK    +    ++ WLGI+DKYWA   +P+++  F  ++ Y 
Sbjct: 241 LIGFTGTEGLQEHKYASIEKDKQFTPGKSTDGWLGITDKYWAVTLVPTEKQPFQPRYAYF 300

Query: 279 SDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGW 338
            DG  RYQ+ F  + IT+  G+S T  + +FAGAKE   I+ Y +D  I RF++LIDWGW
Sbjct: 301 EDGRHRYQSDFLTDPITVDAGQSATVESEIFAGAKEVGKINAYAEDRHIKRFDLLIDWGW 360

Query: 339 FYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDE 398
           F+FI KPMF L+   Y   GNFG+AI+ TTV VK +F+PLA K Y S ANMK +QPK+ E
Sbjct: 361 FHFITKPMFWLIDTLYKFFGNFGLAILATTVIVKAIFYPLANKSYASMANMKKVQPKMLE 420

Query: 399 LREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF 458
           +REK+     +  Q+AM++LYKT  INPLAGCWP+ LQIPVFF++YKV+ I++EMRHAPF
Sbjct: 421 IREKYADDKMK-QQQAMMELYKTEKINPLAGCWPVALQIPVFFSLYKVLYITIEMRHAPF 479

Query: 459 WGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAM 518
           +GWI+DLAA DPT++F LFG++P  LP  + +G+WP+IM ++MF+QM+M+P P D  QA 
Sbjct: 480 FGWIQDLAAPDPTSLFNLFGLIPVTLPHMLMIGVWPLIMGVTMFLQMRMNPTPPDPTQAA 539

Query: 519 ILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           I  WMPV+F F ++ FPAGL+IYW+W+N +SI+QQ +IMK  GA+I L D L + F K 
Sbjct: 540 IFTWMPVIFTFMMAGFPAGLVIYWAWNNTLSILQQGIIMKRQGAKIELWDNLVALFRKK 598


>gi|299132593|ref|ZP_07025788.1| membrane protein insertase [Afipia sp. 1NLS2]
 gi|298592730|gb|EFI52930.1| membrane protein insertase [Afipia sp. 1NLS2]
          Length = 611

 Score =  531 bits (1369), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 267/606 (44%), Positives = 369/606 (60%), Gaps = 32/606 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMN-------------NERKNIQTVKQPN 47
           M  N N  +A+ LS +I+ AWQ FY  P++E+               N      T + P 
Sbjct: 1   MTDNRNTIIAVVLSGLILLAWQYFYNMPQMEKQRAAQQTQMQAANPANSSAPAATTQTPA 60

Query: 48  QVDNS----------YAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGY 97
               +            A  + DRA+ ++ SPRV++  PSLIGSI LKGA+ DD+    Y
Sbjct: 61  AGSAAPTPASPGAEQQQAAPVKDRAEVIASSPRVKIDTPSLIGSIALKGARIDDVAFVKY 120

Query: 98  HLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWNLISGKILTPTTPI 156
              V   SP   L SP+ TK  Y+AE  +V  A  + +LP  +TVW       LTPTTP+
Sbjct: 121 RETVDPKSPAEVLFSPTGTKAPYYAEFGFVPAAGASAKLPGLDTVWTQQGSNALTPTTPV 180

Query: 157 KLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGV 216
            L + N   ++F RT+S+DE Y+F I D V N+        P G I RH     +  + +
Sbjct: 181 VLTYDNGEGLVFTRTLSVDEKYVFTIKDEVANSGTAPATLYPFGLISRHGLPETSGYYIL 240

Query: 217 QEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFK 276
            EG I VLGDK L E  Y  ++++  S F  SN+WLGI+DKYWA+  +P    S  ++F 
Sbjct: 241 HEGPIGVLGDKGLQEYTYKKMDETKASEFKVSNAWLGITDKYWAATLLPDPAASLTARFS 300

Query: 277 YLSDGHAR-YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLID 335
               G  R YQ  +  + +T+  G   TTT  LFAGAKE  T+  Y+K L + RFE+LID
Sbjct: 301 SKLSGTTRVYQTDYLLDPVTVQAGGHATTTTRLFAGAKEVATVDAYDKQLKLNRFELLID 360

Query: 336 WGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPK 395
           WGWFYFI KPMF  + + Y L GNFG+AI+L TV VK +FFPLA K Y S A MK +QP+
Sbjct: 361 WGWFYFITKPMFWTIDHLYRLFGNFGVAILLVTVIVKAIFFPLANKSYASMAKMKAVQPQ 420

Query: 396 IDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRH 455
           +  L+EK+     +  Q+ M+ +YK   INP+AGC PI +QIPVFFA+YKV+ I++EMRH
Sbjct: 421 LAALKEKYPDDKVK-QQQEMMDIYKKEKINPIAGCLPIAIQIPVFFALYKVLFITIEMRH 479

Query: 456 APFWGWIKDLAAADPTNIFTLFGILPF------YLPGFMHVGIWPIIMSLSMFIQMKMSP 509
           APF+GWI DL+A DPT++F LFG+LP+       +  ++ +G WP+IM ++M+ QMK++P
Sbjct: 480 APFFGWIHDLSAPDPTHVFNLFGLLPYDPSAVPIIGHYLAIGAWPLIMGVTMWFQMKLNP 539

Query: 510 PPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDR 569
            P D  Q MI +WMPV+F F L+SFPAGL+IYW+W+N +S++QQ+ IMK +G +I L D 
Sbjct: 540 APPDATQKMIFDWMPVIFTFMLASFPAGLVIYWAWNNTLSVIQQSAIMKKNGVKIELFDN 599

Query: 570 LRSTFS 575
           L+STF+
Sbjct: 600 LKSTFA 605


>gi|304392412|ref|ZP_07374353.1| inner membrane protein OxaA [Ahrensia sp. R2A130]
 gi|303295516|gb|EFL89875.1| inner membrane protein OxaA [Ahrensia sp. R2A130]
          Length = 612

 Score =  531 bits (1368), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 265/613 (43%), Positives = 380/613 (61%), Gaps = 34/613 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSY---AAVL 57
           M+   N+ +A  LS+ +V+AWQ   + PR+E      +  Q V++    +      A   
Sbjct: 1   MDNQRNFILAAVLSLGVVFAWQALVINPRMEAERAAIEAQQKVEEARTAEAESVPGATTA 60

Query: 58  IDDRAQALSMSP-------------------------RVELKNPSLIGSINLKGAQFDDL 92
               A+A +  P                         RV L +P L GS+NL+G + DDL
Sbjct: 61  PQTGAEAGAGVPAGQATSGDGAVPGAAPAASAQSSAGRVPLASPRLEGSVNLQGGRIDDL 120

Query: 93  NLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTP 152
            L  Y   V   SP + LL+P+   +AYFAE  Y       +LP  +T+W L +G+ LTP
Sbjct: 121 RLLDYRETVDDTSPNIQLLTPAGNPDAYFAEFGYSPNEAAGQLPGPSTIWQLAAGERLTP 180

Query: 153 TTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTAT 211
            T I L + N   + F RTI++D+ Y+F I   V N S   +   P GRI R+ KP+TA 
Sbjct: 181 ETSISLQYVNDKGLTFTRTIAMDDDYMFTIEQRVKNESGTDVSLRPYGRIARYGKPETA- 239

Query: 212 NTFGVQEGFIAVLGDKSLVEQKYSDIEKSS-ISNFHESNSWLGISDKYWASVFIPSKET- 269
             + + EG I  +G++ L E  Y DIE    I+    S+ WLGI+DKYWA+  IP  +  
Sbjct: 240 GIYVLHEGLIGSVGEQGLDEVDYGDIEDDKRITKEPASSGWLGITDKYWATALIPQTKDG 299

Query: 270 -SFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIP 328
            +F + + Y S G   YQ+ + A+ ++I  G+    T   FAGAK+   I  Y ++L IP
Sbjct: 300 GTFTAHYNYYSAGTPFYQSDYLASALSIPNGQEQGVTTRFFAGAKKVDIIDAYAENLEIP 359

Query: 329 RFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTAN 388
            F+ +IDWGWFY++ KP+F+LM++ Y+L+GNFG+AI++ TV VK +FFPLA K Y S AN
Sbjct: 360 LFDKIIDWGWFYWLTKPLFLLMNWVYHLIGNFGVAILVVTVLVKAVFFPLANKSYASMAN 419

Query: 389 MKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVIS 448
           MK +QP++  +RE+ K    +  Q AM++LYK   INP AGCWP+L+QIPVFFAIYKVI 
Sbjct: 420 MKKVQPQMTAIREQHKDDA-KAQQAAMMKLYKEEKINPAAGCWPVLIQIPVFFAIYKVIY 478

Query: 449 ISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMS 508
           +++EMRHAPF+GWI+DL+A DPT+IF LFG+LPF +P F+ +G+WP++M ++MF+QM+M+
Sbjct: 479 VTIEMRHAPFFGWIQDLSAPDPTSIFNLFGLLPFEVPLFLMIGVWPLLMGITMFVQMQMN 538

Query: 509 PPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLID 568
           P P D  QAMI  W+PVVF F L++FPAGL+IYW+W+N +SI+QQ +IMK  GA+I L D
Sbjct: 539 PAPPDPTQAMIFKWLPVVFTFMLATFPAGLVIYWAWNNFLSIIQQGLIMKRQGAKIELWD 598

Query: 569 RLRSTFSKNYNSQ 581
            L+  FSK  +++
Sbjct: 599 NLKGIFSKKTDAE 611


>gi|254473802|ref|ZP_05087197.1| 60 kDa inner membrane insertion protein [Pseudovibrio sp. JE062]
 gi|211957188|gb|EEA92393.1| 60 kDa inner membrane insertion protein [Pseudovibrio sp. JE062]
          Length = 603

 Score =  529 bits (1363), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 264/599 (44%), Positives = 379/599 (63%), Gaps = 26/599 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEM---------NNERKNIQT--------- 42
           M  N N  VAI LS++++  WQ F   P++E           N+ ++   +         
Sbjct: 1   MNDNRNMIVAIVLSLVVLLGWQYFIAGPQLEAQQEAQQAQLANDAQQAGSSSPVALPEGA 60

Query: 43  ---VKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHL 99
              V  P     + A   +  R QAL+ SPR+ +  PSL GS+NLKGA+ DDL L+GY  
Sbjct: 61  SGQVTAPGTESGTAAQSFVS-REQALAASPRLTIDTPSLSGSVNLKGAKLDDLRLKGYRQ 119

Query: 100 DVSSNSPIVTLLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWNLISGKILTPTTPIKL 158
            ++ +S  V L SP  +   Y+AE  +V+     I+LPN+ TVW   +   LTP++PI L
Sbjct: 120 TIAKDSETVVLFSPKGSPAPYYAEHGWVADPGVQIKLPNAETVWTAETSGNLTPSSPIVL 179

Query: 159 VFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQE 218
            + N   ++F+RT S+DE+Y+F +   V NNS   ++  P G I R+        F + E
Sbjct: 180 NWDNGEGLVFKRTFSVDENYMFTVDQEVQNNSGQNVQLYPYGLIARNGEPETAGFFVLHE 239

Query: 219 GFIAVLGDKSLVEQKYSD-IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKY 277
           G I V+GD+ L E  YSD I+  SI     +  WLG +DKYWA+  IP+  T F   F Y
Sbjct: 240 GLIGVIGDEGLQEINYSDLIDDGSIRPGRANMGWLGFTDKYWAATLIPTPGTEFQPNFSY 299

Query: 278 LSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWG 337
            +     +Q+ +  +   ++ G  IT ++ L+AGAK    I  Y+    I  F+++IDWG
Sbjct: 300 NARTQ-NFQSDYLGSATQVVDGAKITNSSLLYAGAKITSLIDGYQNSYDILNFDLMIDWG 358

Query: 338 WFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKID 397
           WFYF+ KPMF  + + Y+LVGNFGIAI+L TV VK +FFPLA K YVS + MK +QPK+ 
Sbjct: 359 WFYFLTKPMFWTIDWLYSLVGNFGIAILLVTVIVKAIFFPLANKSYVSMSRMKLVQPKMT 418

Query: 398 ELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAP 457
           E+REK+K    Q  Q+AM++LYKT  INPLAGC P+L+QIPVFF++YKV+ +++EMRHAP
Sbjct: 419 EIREKYKDDK-QKQQQAMMELYKTEKINPLAGCLPMLIQIPVFFSLYKVLFVTIEMRHAP 477

Query: 458 FWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQA 517
           F+GWI+DL+A DPT IF LFG++P+  P F+ +G+WP+IM ++MF+QMKM+P PA+  Q 
Sbjct: 478 FFGWIQDLSAPDPTTIFNLFGLIPWDPPTFLMIGVWPLIMGITMFLQMKMNPAPAEPAQQ 537

Query: 518 MILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSK 576
           MI NWMPV+F F L++FPAGL+IYW+W+N +S++QQ VIM+  G ++ L D L++TF +
Sbjct: 538 MIFNWMPVIFTFMLATFPAGLVIYWAWNNTLSVLQQGVIMRRQGVKLELFDNLKATFKR 596


>gi|254502069|ref|ZP_05114220.1| 60Kd inner membrane protein [Labrenzia alexandrii DFL-11]
 gi|222438140|gb|EEE44819.1| 60Kd inner membrane protein [Labrenzia alexandrii DFL-11]
          Length = 608

 Score =  524 bits (1350), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 260/601 (43%), Positives = 370/601 (61%), Gaps = 26/601 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEE---------------------MNNERKN 39
           +  N N  +AI LS+I++ AWQ FY  P++E                      +N +   
Sbjct: 2   ISENRNTILAIVLSLIVLLAWQYFYAGPQLERQQAALQAQQEAEAAQQSAPGGVNPDAPT 61

Query: 40  IQTVKQPNQVDNSYAAVL-IDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYH 98
                    V  S  +      R QALS + RV +  P L GSINL G + DDL L+ YH
Sbjct: 62  PSVAGSGTTVAPSATSPQGFASREQALSATQRVVIDTPRLEGSINLTGGRLDDLRLKDYH 121

Query: 99  LDVSSNSPIVTLLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWNLISGKILTPTTPIK 157
             V  +SP + L SP+ + N Y+++  +V+ A  +I LP  +T+W++     LTP+TP+ 
Sbjct: 122 ETVDRSSPTIVLFSPTGSPNPYYSDYGWVADAGASITLPGPDTIWSVNGSSDLTPSTPLT 181

Query: 158 LVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQ 217
           L + N   ++F RT S+DE+Y+F +  +VTNNS D +   P G I R      T  + + 
Sbjct: 182 LSWDNGEGLVFNRTFSVDENYMFDVTQSVTNNSGDVVTLYPYGLIARKGIPETTGIWILH 241

Query: 218 EGFIAVLGDKSLVEQKYSDIEKSS-ISNFHESNSWLGISDKYWASVFIPSKETSFHSQFK 276
           EG + V G++ LVE  YSD+E+   +        WLGI+DKYWA+  IP+    F   F 
Sbjct: 242 EGLLGVFGEEGLVEVDYSDLEEDGPVRPAAVDRGWLGITDKYWAATLIPTPGQEFQPGFS 301

Query: 277 YLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDW 336
           Y +     +QA +  N + +  G    T+++LFAGAKE   +  YE  L+I RFE+LIDW
Sbjct: 302 YAAQ-SGNFQADYLGNAVVVPAGGVGETSSYLFAGAKETNLLDAYEASLSIERFELLIDW 360

Query: 337 GWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKI 396
           GWFYF+ KPMF  + + ++  GNFG+AI+L TV +KL FFPLA K YVS + MK +QP++
Sbjct: 361 GWFYFLTKPMFYAIDFLFHYFGNFGVAILLVTVIIKLFFFPLANKSYVSMSKMKLVQPQM 420

Query: 397 DELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHA 456
            E+REK+     Q  Q+A+++LYK   INPLAGC PIL+QIPVFFA+YKV+ +++EMRHA
Sbjct: 421 TEIREKYADDR-QKQQQALMELYKKEKINPLAGCLPILIQIPVFFALYKVLFVTIEMRHA 479

Query: 457 PFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQ 516
           PF+GWI+DL+A DPT++F LFG++P+  P  + +G+WP+IM ++MF+QMKM+P P D  Q
Sbjct: 480 PFFGWIQDLSAPDPTSLFNLFGLIPWDPPQLLMLGVWPLIMGITMFVQMKMNPAPPDPTQ 539

Query: 517 AMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSK 576
            MI  WMPVVF F L+SFPAGL+IYW+W+N +SI QQ VIM   G ++ L D + S F +
Sbjct: 540 QMIFTWMPVVFTFMLASFPAGLVIYWAWNNSLSIAQQWVIMSRQGVKVELWDNIGSMFKR 599

Query: 577 N 577
            
Sbjct: 600 K 600


>gi|118589754|ref|ZP_01547159.1| putative inner membrane protein translocase component YidC [Stappia
           aggregata IAM 12614]
 gi|118437840|gb|EAV44476.1| putative inner membrane protein translocase component YidC [Stappia
           aggregata IAM 12614]
          Length = 606

 Score =  524 bits (1350), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 259/599 (43%), Positives = 372/599 (62%), Gaps = 24/599 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIE------------------EMNNERKNIQT 42
           +  N N  +AI LS+I++  WQ F   P++E                  +  N  K   T
Sbjct: 2   ISENRNTILAIVLSLIVLLGWQYFVAAPQLERQQAELQAQQEAAQQTATDSANPSKPQPT 61

Query: 43  VKQPNQVDNSYAA--VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLD 100
             Q        A   +   +R  AL+ S RV +  PSL GS+NLKG + DD+ L+ YH  
Sbjct: 62  GSQGANTAAPAAGQQMAFANREAALAASQRVTIDTPSLEGSVNLKGGRLDDIRLKDYHET 121

Query: 101 VSSNSPIVTLLSPSNTKNAYFAELDYVST-ANNIELPNSNTVWNLISGKILTPTTPIKLV 159
           V+ +SP + L SPS +   Y+A+  +V     N+ LP  +TVW++     LTP+TP+ L 
Sbjct: 122 VNKSSPTIVLFSPSGSPKPYYADYGWVGDPGTNLALPGPDTVWSVDGEATLTPSTPLTLS 181

Query: 160 FKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEG 219
           + N   ++F+RT S+D++Y+F +  +V N   D +   P G I R         + + EG
Sbjct: 182 WDNGAGLIFKRTFSVDDNYMFTVNQSVENTGSDAVTLYPYGLIARKGMPETNGIYILHEG 241

Query: 220 FIAVLGDKSLVEQKYSD-IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYL 278
            + V G + L E  Y D +E+SSI        WLGI+DKYWA+  IP+    F   F + 
Sbjct: 242 LLGVFGAEGLKEVDYDDLVEESSIRPSKVDQGWLGITDKYWAATLIPTPGQEFQPGFSH- 300

Query: 279 SDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGW 338
           S     +QA +  N +T+  G +  T+++LFAGAKE   +  YE+ L+I RFE+LIDWGW
Sbjct: 301 SATTDVFQADYLGNGVTVAGGSTGETSSYLFAGAKETKLLDGYEEALSIERFELLIDWGW 360

Query: 339 FYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDE 398
           FYF+ KPMF  + YF++L GNFG+AI++ TV VKL+FFPLA K YVS + MK +QP++ E
Sbjct: 361 FYFLTKPMFFAIDYFFHLFGNFGVAILVVTVIVKLIFFPLANKSYVSMSKMKLVQPQMTE 420

Query: 399 LREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF 458
           +REK+     Q  Q+A+++LYK   INPLAGC PI++QIPVFF++YKV+ +++EMRHAPF
Sbjct: 421 IREKYSDDR-QKQQQALMELYKKEKINPLAGCLPIVVQIPVFFSLYKVLYVTIEMRHAPF 479

Query: 459 WGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAM 518
           +GWI+DL+A DPT +F LFG++P+  P  + +G+WP+IM ++MFIQMKM+P P D  Q M
Sbjct: 480 FGWIQDLSAPDPTTLFNLFGLIPWDPPQMLMLGVWPLIMGITMFIQMKMNPAPPDPTQQM 539

Query: 519 ILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           I  WMPV+F F L+SFPAGL+IYW+W+N +S+ QQ VIM+  GA++ L D L S F + 
Sbjct: 540 IFTWMPVIFTFMLASFPAGLVIYWAWNNTLSVTQQYVIMRRQGAKVELWDNLGSLFKRK 598


>gi|188581560|ref|YP_001925005.1| 60 kDa inner membrane insertion protein [Methylobacterium populi
           BJ001]
 gi|254773003|sp|B1Z8E7|OXAA_METPB RecName: Full=Inner membrane protein oxaA
 gi|179345058|gb|ACB80470.1| 60 kDa inner membrane insertion protein [Methylobacterium populi
           BJ001]
          Length = 614

 Score =  524 bits (1350), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 259/607 (42%), Positives = 373/607 (61%), Gaps = 36/607 (5%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPRIEEM----------NNERKNIQTVKQPNQVDNS--- 52
           N FVAIALS++++  W  F   P  E            N   ++   +  P+  + S   
Sbjct: 7   NMFVAIALSLVVLLGWHYFVTGPASERQRQAVQSQTAQNTAPQSADGIPSPSPREGSPNA 66

Query: 53  --------YAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
                    AA     R  AL+ S RV +  P+L GSI LKGA+ DD++L+ YH  VS  
Sbjct: 67  PVPGTVPGAAAQGPISREDALARSARVRIDTPALYGSIGLKGARIDDVSLKNYHETVSDE 126

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           SP + LLSP+ + N Y+AE  +V  AN   LPN +T+W    G +L P  P+ L + N  
Sbjct: 127 SPRIVLLSPAGSANPYYAEFGWVG-ANAGPLPNGDTLWK-ADGDLLAPGKPLTLTWDNGQ 184

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR-HKPQTATNTFGVQEGFIAV 223
            +LF+R +++D+ ++F + D V N+S + +   P   + R  KPQT    + + EG I V
Sbjct: 185 GLLFKRIVAVDDKFMFTVRDEVENSSANPVTLYPYSLVSRWGKPQT-QGYYVLHEGLIGV 243

Query: 224 LGDKSLVEQKYSDIEKSSISNFHES---------NSWLGISDKYWASVFIPSKETSFHSQ 274
           LG   L E  Y  + K        +           W+GI+DKYWA+  IP ++  F   
Sbjct: 244 LGSDGLQEYTYDKVGKEPAYGGAATQGKAWSNVTGGWVGITDKYWAAAAIPDQDKPFTGA 303

Query: 275 FKYLSDGHAR-YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEML 333
           F   +DG  + YQ     + +T+ P  S  TT  LFAGAKE   I+ YE+DL I +F+++
Sbjct: 304 FTERTDGATKIYQTSVRGDAVTVAPSASSATTQRLFAGAKEVNQINAYERDLGIKQFDLM 363

Query: 334 IDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQ 393
           IDWGWF+F+ KPMF  + +FY+L+GNFG++I+L T+ +K+ F P+A + YVS A MK +Q
Sbjct: 364 IDWGWFWFLTKPMFRALDFFYHLLGNFGVSILLVTLILKIFFLPIANRSYVSMAKMKAVQ 423

Query: 394 PKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEM 453
           P++  +RE++K    +  Q+AM++LYK   INP+AGCWP+L+QIPVFFA+YKV+ I++EM
Sbjct: 424 PEMTSIRERYKDDRTK-QQQAMMELYKKEKINPVAGCWPVLIQIPVFFALYKVLFITIEM 482

Query: 454 RHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPAD 513
           RHAPF+GWI DLAA DPT+I  LFG+LPF  P F+H+G+WPIIM ++MFIQMKM+P P D
Sbjct: 483 RHAPFFGWIHDLAAPDPTSIMNLFGLLPFAAPDFIHLGVWPIIMGITMFIQMKMNPAPPD 542

Query: 514 KGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRST 573
             QA +  +MP+VF F L SFPAGL+IYW+W+N +S++QQ +IM+ +G ++ L D LR  
Sbjct: 543 PVQAQVFAFMPIVFTFMLGSFPAGLVIYWAWNNTLSVIQQYIIMRRNGVKVELWDNLRGM 602

Query: 574 FSKNYNS 580
           F +   S
Sbjct: 603 FKRGNKS 609


>gi|170749903|ref|YP_001756163.1| 60 kDa inner membrane insertion protein [Methylobacterium
           radiotolerans JCM 2831]
 gi|254773004|sp|B1LTW1|OXAA_METRJ RecName: Full=Inner membrane protein oxaA
 gi|170656425|gb|ACB25480.1| 60 kDa inner membrane insertion protein [Methylobacterium
           radiotolerans JCM 2831]
          Length = 617

 Score =  519 bits (1336), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 262/609 (43%), Positives = 374/609 (61%), Gaps = 37/609 (6%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPRIEEMNN-ERKNIQTVKQPNQV-----------DNSY 53
           N FVAI LS++++  WQ F   PR+E+    E +N    +QP  V           +   
Sbjct: 7   NMFVAIGLSLLVLLGWQYFVAGPRMEQQRQIEAQNKAAQQQPPGVTPDGVPSPSPKEGGP 66

Query: 54  AAVLID----------DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSS 103
           AA               R  AL+ SPRV ++ P+L GSI LKG + DD++L+ YH  +  
Sbjct: 67  AAPAPGTLPTAQGGPVSREAALARSPRVRIETPALSGSIALKGGRVDDVSLKNYHETIDP 126

Query: 104 NSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNA 163
            SP + L SP+ T+  Y+AE  +V  AN   LP ++T+W    GK L+P  P+ L + N 
Sbjct: 127 KSPEIVLFSPAGTETPYYAEFGWVG-ANAGPLPTNDTLWT-SDGKTLSPGMPVTLTWDNG 184

Query: 164 NNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR-HKPQTATNTFGVQEGFIA 222
             ++F+R I++D+ Y+F I D V N     I   P   + R  KP T    + + EG I 
Sbjct: 185 AGLVFKRIIAVDDKYMFTIRDEVENKGSGAITLYPYSLVSRWGKPHT-QGYYVLHEGMIG 243

Query: 223 VLGDKSLVEQKYSDIEKSSISNFHES---------NSWLGISDKYWASVFIPSKETSFHS 273
            LG+  L E  Y  + K        +           ++GI+DKYWA+  IP ++T +  
Sbjct: 244 YLGNDGLQEFTYDKLAKEGAYGGANTKGKAWTGVTGGFVGITDKYWAAAAIPDQDTPYTG 303

Query: 274 QFKYLSDGHAR-YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEM 332
            F   +DG    YQA    + + +  G S T T  LFAGAKE   I++YEKDL I  F++
Sbjct: 304 AFTDRTDGATNVYQASVRGDAVNLAAGASATATQRLFAGAKEVNVINNYEKDLGIKHFDL 363

Query: 333 LIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNI 392
           +IDWGWF+FI KPMF  + +FY+L GNFG++I++ T  +KLLF P+A + YVS A MK +
Sbjct: 364 MIDWGWFFFITKPMFRALDFFYHLFGNFGVSILVVTFCLKLLFLPIANRSYVSMAKMKAV 423

Query: 393 QPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLE 452
           QP++  +RE++K    +  Q+A ++LYK   INP+AGCWP+L+QIPVFFA+YKV+ I++E
Sbjct: 424 QPEMAAIRERYKDDRMK-QQQATMELYKKEKINPVAGCWPVLIQIPVFFALYKVLFITIE 482

Query: 453 MRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPA 512
           MRHAPF+GWI+DLAA DPT+I  LFG+LPF  P F+H+G+WPIIM ++MF+QMKM+P P 
Sbjct: 483 MRHAPFFGWIRDLAAPDPTSIVNLFGLLPFPAPDFVHLGVWPIIMGITMFVQMKMNPAPP 542

Query: 513 DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRS 572
           D  QA I  +MP+VF F L SFPAGL+IYW+W+N +S++QQ VIM+ +G ++ L D LRS
Sbjct: 543 DPVQAQIFTFMPIVFTFMLGSFPAGLVIYWAWNNTLSVIQQYVIMRRNGVKVELWDNLRS 602

Query: 573 TFSKNYNSQ 581
           TF +   ++
Sbjct: 603 TFRRGNGTK 611


>gi|163868925|ref|YP_001610152.1| putative inner membrane protein translocase component YidC
           [Bartonella tribocorum CIP 105476]
 gi|161018599|emb|CAK02157.1| translocase precursor subunit [Bartonella tribocorum CIP 105476]
          Length = 620

 Score =  519 bits (1336), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 263/609 (43%), Positives = 381/609 (62%), Gaps = 34/609 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERK--------------NIQTVKQP 46
           ME N N+F+AI LS +++ AWQ  +V P+  ++ N++               +  TV   
Sbjct: 1   MEYNRNFFIAIGLSFLVLIAWQFLHVAPKQAKLQNQQAITQQQQLSKQQSPLSSATVNFS 60

Query: 47  NQVDNSYAAVLIDD------RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLD 100
           +      +  +I+       R   L+ + R+ +K   L GSINL GAQFDDL+L+ Y + 
Sbjct: 61  DDTSTHPSTSIIEQPMTPEVRKAVLAKTERIAIKTNELEGSINLVGAQFDDLHLKKYRVT 120

Query: 101 VSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIE-LPNSNTVWNLISGKI-LTPTTPIKL 158
           V   SP + LL+P   K  Y AE  + S +   + LP  +T W +      LTP+TPI L
Sbjct: 121 VDKKSPEIDLLNPKGFKTTYLAEFGFASASLPAKALPQPDTQWQIEGNNTTLTPSTPITL 180

Query: 159 VFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQ 217
           ++ N    +F RT+ +D++Y+F I D+++N S   I  S   R+ R  P   TN T+ + 
Sbjct: 181 IYNNGQGQIFRRTLFVDDYYMFTIEDSISNESDQPIYLSSYARVARAAPPEHTNATYLLH 240

Query: 218 EGFIAVLGDKSLVEQKYS---------DIEKSSISNFHESNSWLGISDKYWASVFIPSKE 268
           EG I + GD SL  +KY          D  + S++    +  W+GI+DKYWA   IP ++
Sbjct: 241 EGMIGIAGD-SLKTEKYKTLAELDPNPDNGQKSMTFSKVTGGWIGITDKYWAVAVIPQQD 299

Query: 269 TSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIP 328
             + S+F Y       YQ+    + +TI P ++ T TN LFAGAK+   I+HY+ +L I 
Sbjct: 300 KEYTSRFIYFDRLQTHYQSDLLGSLLTIAPNETKTVTNHLFAGAKQVEIINHYQNNLKIN 359

Query: 329 RFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTAN 388
           +F +LIDWGWF FI KPMF L+   Y   GNFGIAI+L TV +K+L FPLA K Y S A 
Sbjct: 360 KFALLIDWGWFDFITKPMFALIDILYKQTGNFGIAILLVTVLLKILLFPLANKSYQSMAR 419

Query: 389 MKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVIS 448
           MK +QP++ E++EK+     +  Q+A+I+LYKT  INPLAGCWP+L+Q P+FFA+YKV+ 
Sbjct: 420 MKLLQPRLLEIKEKYPDDKNKQ-QQAIIELYKTEKINPLAGCWPMLVQFPIFFALYKVLY 478

Query: 449 ISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMS 508
           I++EMRHAPF+GWI+DLAA DPT++F LFG+LP+  P F+ +G WP+IM ++MF+QM+M+
Sbjct: 479 ITIEMRHAPFFGWIQDLAAPDPTSLFNLFGLLPYTTPAFLMIGAWPLIMGITMFLQMRMN 538

Query: 509 PPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLID 568
           P P D+ QAMI  WMPVVF F L+SFP GL+IYW+W+N++SI+QQ ++MK  GA+I L D
Sbjct: 539 PAPQDQTQAMIFTWMPVVFTFMLASFPVGLVIYWAWNNILSIIQQGIMMKRQGAKIELFD 598

Query: 569 RLRSTFSKN 577
            L++ + K+
Sbjct: 599 NLKTMWKKS 607


>gi|319408960|emb|CBI82617.1| translocase precursor subunit [Bartonella schoenbuchensis R1]
          Length = 611

 Score =  518 bits (1334), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 271/606 (44%), Positives = 385/606 (63%), Gaps = 33/606 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDN--------- 51
           ME N N+F+AI LS+II  AW  FYV P+  ++   +   Q  KQ +++ +         
Sbjct: 1   MEYNRNFFIAIGLSLIIFVAWHFFYVAPQQAKLQEMQMAQQLSKQSSEIPSTDMHFSDSA 60

Query: 52  --------SYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSS 103
                   S   +  ++R+  L+ + R+ +K   L GSINL GAQFDDL L+ Y L V  
Sbjct: 61  QISGSGSISDRPMTPENRSAELAKTNRIAIKTDELEGSINLVGAQFDDLFLKKYRLTVDK 120

Query: 104 NSPIVTLLSPSNTKNAYFAELDYVSTA-NNIELPNSNTVWNLISGK--ILTPTTPIKLVF 160
            SP + LL+P+     Y AE  + S++     LP S+T W  I GK   LTP+TP+ L++
Sbjct: 121 GSPEIALLNPNGFNTTYLAEFGFTSSSLPATALPQSHTQWQ-IEGKNTTLTPSTPVTLIY 179

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEG 219
            N    +F RT+S+D HY+F I D++ N S + I  SP  R+ R  P   TN T+ + EG
Sbjct: 180 NNGQGQIFRRTLSIDNHYMFTIEDSIKNESDNPIYLSPYARVARAAPPEYTNATYLLHEG 239

Query: 220 FIAVLGDKSLVEQKYSDIE---------KSSISNFHESNSWLGISDKYWASVFIPSKETS 270
            I + GD SL  + Y ++E         + S+     +  W+GI+DKYWA V IP ++  
Sbjct: 240 MIGIAGD-SLKTETYKNLEELNPNPENGQKSMIFSKVTGGWIGITDKYWAVVVIPPQDQE 298

Query: 271 FHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRF 330
           + S+F Y +  +  YQ+   ++ +T+ P ++ T TN LFAGAK+   I+ Y+  L I +F
Sbjct: 299 YTSRFIYFNQLNTHYQSDLQSSLLTVAPNETKTITNHLFAGAKQVEIINRYQNQLKIRKF 358

Query: 331 EMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMK 390
            +LIDWGWF FI KPMF L+  FY   GNFGIAI+L TV +K+L FPLA K Y S A MK
Sbjct: 359 GLLIDWGWFDFITKPMFALIDIFYKQTGNFGIAILLVTVLLKVLLFPLANKSYKSMARMK 418

Query: 391 NIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISIS 450
            +QP + E++EK+     +  Q+A+I LYKT  INPLAGCWP+L+Q P+FFA+YKV+ I+
Sbjct: 419 LVQPMMQEIKEKYADDRVKQ-QQAVIALYKTQKINPLAGCWPMLVQFPIFFALYKVLYIT 477

Query: 451 LEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPP 510
           +EMRHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G WP+IM ++MF+QM+M+P 
Sbjct: 478 IEMRHAPFFGWIQDLAAPDPTSIFNLFGLLPYEVPTFLILGAWPLIMGITMFLQMQMNPT 537

Query: 511 PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL 570
           P D  QAMI  WMPV+F F L+SFPAGL+IYW+W+N +SI+QQ ++MK  G +I L + L
Sbjct: 538 PPDPTQAMIFTWMPVIFTFMLASFPAGLVIYWAWNNTLSIIQQGIMMKRQGVKIELFNNL 597

Query: 571 RSTFSK 576
           ++ F K
Sbjct: 598 KAMFHK 603


>gi|307943178|ref|ZP_07658523.1| inner membrane protein OxaA [Roseibium sp. TrichSKD4]
 gi|307773974|gb|EFO33190.1| inner membrane protein OxaA [Roseibium sp. TrichSKD4]
          Length = 603

 Score =  518 bits (1334), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 250/594 (42%), Positives = 367/594 (61%), Gaps = 21/594 (3%)

Query: 3   RNWNYFVAIALSVIIVYAWQNFYVYPRIEEM---------------NNERKNIQTVKQPN 47
            N N  +AIALS+ ++ AWQ F   P++E+                + +R + Q      
Sbjct: 4   ENRNTLLAIALSLAVLLAWQYFVAQPQLEKQQAALQAQQAAEQAQSDPQRPSAQNAPGAA 63

Query: 48  QVDNSYAA--VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNS 105
                 A+       R QA++ S RV L  P L GS+NL G + DD+ L+ YH  V  +S
Sbjct: 64  TTGAPSASGQEQFQTREQAIAASERVTLDTPRLSGSVNLVGGRIDDIRLKDYHETVDKSS 123

Query: 106 PIVTLLSPSNTKNAYFAELDYVST-ANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           P V L SP  +   ++A+  +VS    ++ LP ++TVW+  +G  LTP TP+ L F N  
Sbjct: 124 PTVVLFSPKGSPEPFYADYGWVSDPGADVALPGADTVWSAPAGAQLTPNTPLTLTFDNGG 183

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVL 224
            + F+RT S+DE+Y+F +  +V N+  + +   P G + R      TN + + EG + V 
Sbjct: 184 GLTFKRTFSIDENYMFSVTQSVENSGSEAVTLYPYGLLARTGQPETTNFYILHEGLLGVF 243

Query: 225 GDKSLVEQKYSDIEKSSISNFHE-SNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
           G++ L E  Y D+ ++ +    +    WLGI+DKYWA+  +P    +F   F + S+   
Sbjct: 244 GEEGLKEVDYDDLAETGVDRPGKVDRGWLGITDKYWAATLVPEPGQTFQPSFTH-SNVTD 302

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
            YQA F  + + I  G +    ++LFAGAKE   +  YE  L I +FE+LIDWGWFYF+ 
Sbjct: 303 NYQADFLGSAVVIAAGSTSEANSYLFAGAKETKLLDSYEATLNIEQFELLIDWGWFYFLT 362

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           KPMF  + + + + GNFG+AI+L TV +KL+FFPLA K YVS + MK +QP++ E+R+++
Sbjct: 363 KPMFFAIDWLFMMFGNFGVAILLVTVAIKLVFFPLANKSYVSMSKMKLVQPQMQEIRDRY 422

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
                +  Q+A+++LYK   INPLAGC PIL+QIPVFFA+YKV+ +++EMRHAPF+GWI+
Sbjct: 423 GDDKAKQ-QQALMELYKKEKINPLAGCLPILIQIPVFFALYKVLFVTIEMRHAPFFGWIQ 481

Query: 464 DLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWM 523
           DL+A DPT IF LFG++P+  P  + VGIWP++M ++MF+QMKM+P P D  Q MI  WM
Sbjct: 482 DLSAPDPTTIFNLFGMIPWDPPQLLTVGIWPLLMGITMFVQMKMNPAPPDPTQQMIFTWM 541

Query: 524 PVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           P++F F L+SFPAGL+IYW+W+N +SI QQ VIM   G ++ L D L+STF + 
Sbjct: 542 PIIFTFMLASFPAGLVIYWAWNNFLSIAQQWVIMSRQGVKVELFDNLKSTFKRK 595


>gi|209886640|ref|YP_002290497.1| inner membrane protein OxaA [Oligotropha carboxidovorans OM5]
 gi|209874836|gb|ACI94632.1| inner membrane protein OxaA [Oligotropha carboxidovorans OM5]
          Length = 610

 Score =  514 bits (1323), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 259/606 (42%), Positives = 367/606 (60%), Gaps = 32/606 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQ-------------TVKQPN 47
           M  N N  +A+ LS +++  WQ FY  P +      ++                T + P 
Sbjct: 1   MTDNRNTILAVLLSGVVLLGWQYFYNEPEMARQRAAQQAQTQAANPANSAAPNATTQTPA 60

Query: 48  QVDNS----------YAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGY 97
               +               + DRA+ ++ SPR++++ P+LIGSI LKGA+FDD++L  Y
Sbjct: 61  AGSTAPTPGSPTIQQQQGAQVKDRAEVIAASPRIKIETPNLIGSIALKGARFDDVSLVKY 120

Query: 98  HLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWNLISGKILTPTTPI 156
              V   SP   L SPS TK  Y+AE  +V  A   I++P  +TVW       LT TTP+
Sbjct: 121 RETVDPKSPAEVLFSPSGTKAPYYAEFGFVPAAGATIKMPTLDTVWTQEGSNALTSTTPV 180

Query: 157 KLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGV 216
            L + N   + F RTIS+D+ Y+F + D V N+        P G I RH     +  + +
Sbjct: 181 VLKYDNGEGLTFTRTISVDDKYVFTVKDDVANSGTAPTTVYPFGLISRHGVPETSGYYIL 240

Query: 217 QEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFK 276
            EG I VLGD+ L E  Y ++++   S F  +N WLGI+DKYWA+  +P    +  ++F 
Sbjct: 241 HEGPIGVLGDQGLQEFSYKNMDEKKTSEFKVTNGWLGITDKYWAATLLPDPAAALTARFS 300

Query: 277 YLSDGHAR-YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLID 335
               G  R YQ  +  + + +  G S TTT  LFAGAKE  T+  Y+K L + RFE+LID
Sbjct: 301 SNLVGPTRIYQTDYLLDPVAVPAGGSATTTTRLFAGAKEVATVDAYDKQLKLNRFELLID 360

Query: 336 WGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPK 395
           WGWFYFI KPMF  +   Y L GNFG+AI+L TV +K +FFPLA K Y S A MK +QP+
Sbjct: 361 WGWFYFITKPMFWAIDQLYRLFGNFGVAILLVTVAIKAVFFPLANKSYASMAKMKAVQPQ 420

Query: 396 IDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRH 455
           +  L+EK+     +  Q+ M+++YK   INP+AGC PI +QIPVFFA+YKV+ I++EMRH
Sbjct: 421 LTALKEKYPDDRVK-QQQEMMEIYKKEKINPIAGCLPIAIQIPVFFALYKVLFITIEMRH 479

Query: 456 APFWGWIKDLAAADPTNIFTLFGILPF------YLPGFMHVGIWPIIMSLSMFIQMKMSP 509
           APF+GWI+DL+A DPT+IF LFG+LPF       +  ++ +G WP+IM ++M+ QMK++P
Sbjct: 480 APFFGWIRDLSAPDPTHIFNLFGLLPFDPSAVPLIGTYLAIGAWPVIMGITMWFQMKLNP 539

Query: 510 PPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDR 569
            P D  Q MI +WMPVVF F L+SFPAGL+IYW+W+N++S++QQ+ IMK +G +I L D 
Sbjct: 540 QPPDPTQKMIFDWMPVVFTFMLASFPAGLVIYWAWNNLLSVLQQSAIMKKNGVKIELFDN 599

Query: 570 LRSTFS 575
           L+S F+
Sbjct: 600 LKSMFA 605


>gi|240850503|ref|YP_002971902.1| preprotein translocase subunit YidC [Bartonella grahamii as4aup]
 gi|240267626|gb|ACS51214.1| preprotein translocase subunit YidC [Bartonella grahamii as4aup]
          Length = 612

 Score =  514 bits (1323), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 265/607 (43%), Positives = 378/607 (62%), Gaps = 32/607 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           ME N N+F+AI LS +++ AWQ  +V P+  ++  ++   Q + +     ++      DD
Sbjct: 1   MEYNRNFFIAIGLSFVVLIAWQFLHVAPKQAKLQKQQVITQQLSKQQSTLSTTTTNFSDD 60

Query: 61  ------------------RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVS 102
                             R   L+ + R+ +K   L GSINL GAQFDDL+L+ Y L V 
Sbjct: 61  TSTHQATSIIEQPMTPEIRKAVLAKTKRIAIKTNELEGSINLVGAQFDDLHLKKYRLTVD 120

Query: 103 SNSPIVTLLSPSNTKNAYFAELDYVSTANNIE-LPNSNTVWNLISGK-ILTPTTPIKLVF 160
             SP + LL+P   K  Y AE  + S +   + LP S+T W +     ILTP+TPI L++
Sbjct: 121 KKSPEIDLLNPKGFKTTYLAEFGFASASLPAKALPQSDTQWQIEGNNTILTPSTPITLIY 180

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEG 219
            N    +F R +S+D+H++F I D+++N S   I  S   R+ R  P   TN T+ + EG
Sbjct: 181 NNGQGQIFRRILSVDDHFMFTIEDSISNESDQPIYLSSYARVARAAPPEHTNATYLLHEG 240

Query: 220 FIAVLGDKSLVEQKYS---------DIEKSSISNFHESNSWLGISDKYWASVFIPSKETS 270
            I + GD SL  +KY          D  + S++    +  W+GI+DKYWA   IP +   
Sbjct: 241 MIGIAGD-SLKTEKYKTLAELDPNPDNGQKSMTFSKVTGGWIGITDKYWAVAVIPPQNKE 299

Query: 271 FHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRF 330
           + S+F Y       YQ+    + +TI P ++ T TN LFAGAK+   I++Y+ DL I +F
Sbjct: 300 YTSRFIYFDRLQTHYQSDLLGSLLTIAPNETKTITNRLFAGAKQVEIINNYQNDLKIKKF 359

Query: 331 EMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMK 390
            +LIDWGWF FI KPMF L+   Y   GNFGIAI+L TV +K L FPLA K Y S A MK
Sbjct: 360 ALLIDWGWFDFITKPMFSLIDVLYKQTGNFGIAILLVTVLLKTLLFPLANKSYKSMARMK 419

Query: 391 NIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISIS 450
            +QP++ E++EK+     +  Q+A+I+LYKT  INPLAGCWP+L+Q P+FFA+YKV+ I+
Sbjct: 420 LLQPRLLEIKEKYPDDKTKQ-QQAIIELYKTEKINPLAGCWPMLVQFPIFFALYKVLYIT 478

Query: 451 LEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPP 510
           +EMRHAPF+GWIKDLAA DPT++F LFG+LP+  P F+ +G WP+IM ++MF+QM+M+P 
Sbjct: 479 IEMRHAPFFGWIKDLAAPDPTSLFNLFGLLPYTTPTFLMIGAWPLIMGITMFLQMRMNPA 538

Query: 511 PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL 570
           P D+ QAMI  WMPVVF F L+SFP GL+IYW+W+N++SI+QQ ++MK  G +I L D L
Sbjct: 539 PQDQSQAMIFTWMPVVFTFMLASFPVGLVIYWAWNNILSIIQQGIMMKRQGVKIELFDNL 598

Query: 571 RSTFSKN 577
           ++ + K+
Sbjct: 599 KTMWRKS 605


>gi|220925223|ref|YP_002500525.1| YidC translocase/secretase [Methylobacterium nodulans ORS 2060]
 gi|254773002|sp|B8IMM9|OXAA_METNO RecName: Full=Inner membrane protein oxaA
 gi|219949830|gb|ACL60222.1| YidC translocase/secretase [Methylobacterium nodulans ORS 2060]
          Length = 605

 Score =  513 bits (1321), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 248/598 (41%), Positives = 366/598 (61%), Gaps = 33/598 (5%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVD--------------- 50
           N  +AIALS+ ++  W  F   P++E    ++        P +                 
Sbjct: 7   NMIIAIALSLAVLLGWNYFVAAPQVERQRQQQAQTSASPSPKEGGPSAPVPGTLPGASGG 66

Query: 51  NSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTL 110
           N  AA+    R +AL+ SPRV +   +L GS+ LKG + DD+ L+GYH  V   SP + L
Sbjct: 67  NPQAAL---TREEALARSPRVRIDTEALKGSVALKGGRIDDVALKGYHETVDPKSPEIVL 123

Query: 111 LSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFER 170
           LSP+ + N Y+AE  +V       LPN +TVW    G +LT   P+ L + N   ++F R
Sbjct: 124 LSPAGSANPYYAEFGWVGQGAG-PLPNGDTVWT-ADGDLLTAKKPLTLTWDNGAGLVFRR 181

Query: 171 TISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR-HKPQTATNTFGVQEGFIAVLGDKSL 229
           T+S+D+ Y+F + D+V N     +   P G + R  KP T    + + EG I VLGDK L
Sbjct: 182 TLSVDDKYMFTVEDSVENKGQSAVTLYPYGLVSRWGKPHT-QGYYVLHEGLIGVLGDKGL 240

Query: 230 VEQKYSDIEKS---------SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
            E  Y  + K           +S    +  +LGI+DKYWA+  IP ++T +   F    +
Sbjct: 241 QEYTYDKMAKENPLGSPGTRGLSWPGVTGGFLGITDKYWAAATIPDQKTPYTGSFTERDE 300

Query: 281 GHAR-YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWF 339
           G  + YQ        T+ PG  +  +  LFAGAKE  TI  Y + L I +F+++IDWGWF
Sbjct: 301 GATKVYQTSSLGEARTLAPGAGVQASQHLFAGAKEVSTIDAYRQKLDIKQFDLMIDWGWF 360

Query: 340 YFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDEL 399
           YFI KPMF  + +FY L GNFG++I++ T+ +KL F P+A + YVS A MK +QP++  +
Sbjct: 361 YFITKPMFKALDFFYKLFGNFGVSILVVTLILKLFFLPIANRSYVSMAKMKAVQPEMTAI 420

Query: 400 REKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFW 459
           RE++     +  Q+AM++LY+   INP+AGCWP+++QIPVFFA+YKV+ +++EMRHAPF+
Sbjct: 421 RERYADDKVK-QQQAMMELYRKEKINPVAGCWPVVIQIPVFFALYKVLFVTIEMRHAPFF 479

Query: 460 GWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMI 519
           GWI+DLAA DPT++  LFG+LPF  P  +H+G+WPI+M ++MF+QMKM+P P D  QA +
Sbjct: 480 GWIRDLAAPDPTSVLNLFGLLPFAAPDLVHLGVWPIVMGITMFLQMKMNPAPPDPVQAQV 539

Query: 520 LNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
             +MP++F F L SFPAGL+IYW+W+N++SI+QQ  IM+ +G ++ L D LR+TFS++
Sbjct: 540 FTFMPIIFTFMLGSFPAGLVIYWAWNNLLSILQQYWIMRRNGVKVELWDNLRTTFSRS 597


>gi|163851774|ref|YP_001639817.1| 60 kDa inner membrane insertion protein [Methylobacterium
           extorquens PA1]
 gi|254773001|sp|A9W590|OXAA_METEP RecName: Full=Inner membrane protein oxaA
 gi|163663379|gb|ABY30746.1| 60 kDa inner membrane insertion protein [Methylobacterium
           extorquens PA1]
          Length = 616

 Score =  513 bits (1320), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 258/610 (42%), Positives = 372/610 (60%), Gaps = 40/610 (6%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVK--QPNQVDN------------ 51
           N FVAIALS++++  W  F   P  E      ++ QT +   P   D             
Sbjct: 7   NMFVAIALSLVVLLGWHYFVTGPASERQRQAAQS-QTAQTGAPQTADGIPSPSPREGGPN 65

Query: 52  --------SYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSS 103
                     AA     R  AL+ S RV +  P+L GSI LKGA+ DD++L+ YH  VS 
Sbjct: 66  APAPGTLPGAAAQGPVSREDALARSARVRIDTPALYGSIGLKGARIDDVSLKNYHETVSD 125

Query: 104 NSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNA 163
            SP + LLSP+ T N Y+AE  +V  AN   LPN++T+W    G +L P  P+ L + N 
Sbjct: 126 ESPRIVLLSPTGTANPYYAEFGWVG-ANAGPLPNADTLWK-ADGDLLAPGRPLTLTWDNG 183

Query: 164 NNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR-HKPQTATNTFGVQEGFIA 222
             ++F+R +++D+ ++F + D V N S + +   P   + R  KPQT    + + EG I 
Sbjct: 184 QGLVFKRIVAVDDKFMFTVRDEVENTSANPVTLYPYSLVSRWGKPQT-QGYYVLHEGLIG 242

Query: 223 VLGDKSLVEQKYSDIEKSSISNFHE---------SNSWLGISDKYWASVFIPSKETSFHS 273
           VLG   L E  Y  + K                 +  W+GI+DKYWA+  IP ++  F  
Sbjct: 243 VLGGDGLQEYTYDKVGKEPAYGGAATQGKAWTNVTGGWVGITDKYWAAAAIPEQDKPFTG 302

Query: 274 QFKYLSDGHAR-YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEM 332
            F   +DG  + YQ     + +T+ P  S  TT  LFAGAKE   I+ YE++  I +F++
Sbjct: 303 AFTERTDGATKIYQTSVRGDAVTLAPNASSVTTQRLFAGAKEVNQINAYEREFGIKQFDL 362

Query: 333 LIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNI 392
           +IDWGWF+F+ KPMF  + +F++L+GNFG++I+L T+ +KL F P+A + YVS A MK +
Sbjct: 363 MIDWGWFWFLTKPMFRALDFFFHLLGNFGVSILLVTLILKLFFLPIANRSYVSMAKMKAV 422

Query: 393 QPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLE 452
           QP++  +RE++K    +  Q+AM++LYK   INP+AGCWP+L+QIPVFFA+YKV+ I++E
Sbjct: 423 QPEMTSIRERYKDDRVK-QQQAMMELYKKEKINPVAGCWPVLIQIPVFFALYKVLFITIE 481

Query: 453 MRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGF--MHVGIWPIIMSLSMFIQMKMSPP 510
           MRHAPF+GWI+DLAA DPT+I  LFG+LPF  P +  +H+G+WPIIM ++MFIQMKM+P 
Sbjct: 482 MRHAPFFGWIQDLAAPDPTSIVNLFGLLPFTPPEYIPIHLGVWPIIMGITMFIQMKMNPA 541

Query: 511 PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL 570
           P D  QA +  +MP+VF F L SFPAGL+IYW+W+N +S++QQ VIM+ +G ++ L D L
Sbjct: 542 PPDPVQAQVFAFMPIVFTFMLGSFPAGLVIYWAWNNTLSVIQQYVIMRRNGVKVELWDNL 601

Query: 571 RSTFSKNYNS 580
           R  F +   S
Sbjct: 602 RGMFKRGNKS 611


>gi|121602508|ref|YP_989323.1| putative inner membrane protein translocase component YidC
           [Bartonella bacilliformis KC583]
 gi|120614685|gb|ABM45286.1| inner membrane protein, 60Kd [Bartonella bacilliformis KC583]
          Length = 612

 Score =  512 bits (1318), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 268/606 (44%), Positives = 382/606 (63%), Gaps = 32/606 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAA----- 55
           ME N N+F+AI LS+II  AW   Y+ P+ E + N +   Q   + N    +Y A     
Sbjct: 1   MEYNRNFFIAIGLSLIIFVAWHFLYIVPQHENLKNAQTIEQQALKQNPASPTYDADFSNN 60

Query: 56  ------VLIDDRAQA-------LSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVS 102
                  L  DR+         L+ + R+ +K   L GSINL GAQFDDL L+ YHL V 
Sbjct: 61  AQTNQSRLTADRSMTPEIRRAELAKTDRITIKTDELEGSINLVGAQFDDLFLKKYHLTVD 120

Query: 103 SNSPIVTLLSPSNTKNAYFAELDYVSTA-NNIELPNSNTVWNLIS-GKILTPTTPIKLVF 160
             SP ++LL+P+  K +Y AE  + S++     LP SNT W + S   ILTP+TP+ LV+
Sbjct: 121 KTSPQISLLNPNGFKTSYLAEFGFTSSSLPEKALPQSNTQWQIESENTILTPSTPVTLVY 180

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKP-QTATNTFGVQEG 219
            N    +F RTIS+D+HY+F I D++ N S + +  S   R+ R  P + A  T+ + EG
Sbjct: 181 NNGQGQIFRRTISIDDHYMFTIEDSINNESDNPVHLSSYARVARAAPPEHAQATYLLHEG 240

Query: 220 FIAVLGDKSLVEQKYSDIEKSSIS--------NFHE-SNSWLGISDKYWASVFIPSKETS 270
            I + G+ SL  + Y  + + +++         F + +  W+GI+DKYWA   IPS+   
Sbjct: 241 MIGIAGN-SLKTETYEALSELTLNPEDGQKSLTFQKVTGGWIGITDKYWAVAVIPSQNQE 299

Query: 271 FHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRF 330
           + S+F Y    +  YQ+   +  ++I P ++ T  N+LFAGAK    I+ Y+  L I +F
Sbjct: 300 YTSRFVYFDRLNTHYQSDLQSALLSIAPRETKTIINYLFAGAKRVEIINQYQNQLQIKKF 359

Query: 331 EMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMK 390
            +LIDWGWF FI KPMF L+   Y   GNFGIAI+LTTV +K L FPLA K Y+S A MK
Sbjct: 360 GLLIDWGWFDFITKPMFSLIHILYEQTGNFGIAILLTTVLLKTLLFPLANKSYISMARMK 419

Query: 391 NIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISIS 450
            IQP + E++EK+ +   +  Q A+IQLYKT  INPLAGC P+L+Q P+FFA+YKV+ I+
Sbjct: 420 IIQPMMQEIKEKYAEDRVKQ-QHAIIQLYKTQKINPLAGCLPMLIQFPIFFALYKVLYIT 478

Query: 451 LEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPP 510
           LEMRHAPF+GWI+DLAA DPT+IF LFG LP+ +P F  +G WP++M ++MF+QM+M+PP
Sbjct: 479 LEMRHAPFFGWIQDLAAPDPTSIFNLFGFLPYAVPAFFVIGAWPLVMGITMFLQMQMNPP 538

Query: 511 PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL 570
           P D  QA +  W+P++F F L+SFPAGL+IYW+W+N +SI+QQ++IMK  G +I L + +
Sbjct: 539 PVDPIQATLFAWLPIIFTFMLASFPAGLVIYWAWNNTLSIIQQSIIMKRQGVKIELFNNI 598

Query: 571 RSTFSK 576
           ++ + K
Sbjct: 599 KTIWQK 604


>gi|49475954|ref|YP_033995.1| putative inner membrane protein translocase component YidC
           [Bartonella henselae str. Houston-1]
 gi|49238762|emb|CAF28023.1| hypothetical protein BH12410 [Bartonella henselae str. Houston-1]
          Length = 612

 Score =  511 bits (1317), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 269/607 (44%), Positives = 382/607 (62%), Gaps = 32/607 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTV-KQPNQVDNSYA----- 54
           ME N N+F+AI LS  ++ AW  FYV P+  E+  ++   Q + KQ + V +  A     
Sbjct: 1   MEYNRNFFIAIGLSFGVLIAWHFFYVAPKQTELQQKQLIAQQLLKQQSAVSSPTANFSDS 60

Query: 55  ------AVLIDD------RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVS 102
                 A++I+       R   L+ + RV +K   L GSINL GAQFDDL L+ Y L V 
Sbjct: 61  ASTHESALIINHPMSPEIRDAELAKTNRVAIKTNELEGSINLVGAQFDDLLLKKYRLTVD 120

Query: 103 SNSPIVTLLSPSNTKNAYFAELDYVSTA-NNIELPNSNTVWNLISGKI-LTPTTPIKLVF 160
             S  + LL+P   K  Y AE  + S++ +   LP S+T W++      LTP+TP+ L++
Sbjct: 121 KKSSEIALLNPKGFKETYLAEFGFTSSSLSKDALPQSDTRWHIEGNNTTLTPSTPVTLIY 180

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEG 219
            N     F R +S+D+HY+F I D++TN S   I  S   R+ R  P   TN T+ + EG
Sbjct: 181 NNGQGQTFRRILSIDDHYMFTIEDSITNESDKPIYLSSYARVARAAPPEHTNATYLLHEG 240

Query: 220 FIAVLGDKSLVEQKYS---------DIEKSSISNFHESNSWLGISDKYWASVFIPSKETS 270
            I + GD SL  +KY          D  + S++       W+GI+DKYWA   IP ++  
Sbjct: 241 MIGIAGD-SLKTEKYKTLAELNPNPDNGQKSMTFSKVIGGWVGITDKYWAVAVIPPQDKE 299

Query: 271 FHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRF 330
           + S+F Y       YQ+    + +T+ P ++ T TN LFAGAK+   I+HY+ DL I +F
Sbjct: 300 YTSRFIYFDRLQTHYQSDLLGSLLTVAPNETKTITNRLFAGAKQVEIINHYQNDLKIKKF 359

Query: 331 EMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMK 390
            +LIDWGWF FI KPMF L+   Y   GNFGIAI+L TV +K L FPLA K Y S A MK
Sbjct: 360 ALLIDWGWFDFITKPMFSLIDILYKQTGNFGIAILLVTVLLKTLLFPLANKSYKSMARMK 419

Query: 391 NIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISIS 450
            IQP + E++EK+ +   +  Q+A+I+LYKT  INPLAGCWP+L+Q P+FFA+YKV+ I+
Sbjct: 420 LIQPMLLEIKEKYPEDRTKQ-QQAIIELYKTQKINPLAGCWPMLVQFPIFFALYKVLYIT 478

Query: 451 LEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPP 510
           +EMRHAPF+GWI+DLAA DPT++F LFG+LP+ +P F+ +G WP+IM ++MF+QM+M+P 
Sbjct: 479 IEMRHAPFFGWIQDLAAPDPTSLFNLFGLLPYTVPAFLMLGAWPLIMGITMFLQMRMNPA 538

Query: 511 PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL 570
           P D+ QAMI  WMP+VF F L+SFP GL+IYW+W+N++S++QQ ++MK  G +I L D L
Sbjct: 539 PQDQTQAMIFAWMPIVFTFMLASFPVGLVIYWAWNNILSMIQQGIMMKRQGVKIELFDNL 598

Query: 571 RSTFSKN 577
           ++ + K+
Sbjct: 599 KAMWRKS 605


>gi|240138939|ref|YP_002963414.1| transmembrane protein, OxaA-like, preprotein translocase component
           [Methylobacterium extorquens AM1]
 gi|240008911|gb|ACS40137.1| transmembrane protein, OxaA-like, preprotein translocase component
           [Methylobacterium extorquens AM1]
          Length = 637

 Score =  511 bits (1316), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 256/609 (42%), Positives = 374/609 (61%), Gaps = 38/609 (6%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPRIEEMNN--ERKNIQT--------VKQPNQVDNS--- 52
           N FVAIALS++++  W  F   P  E      + +  QT        +  P+  + S   
Sbjct: 28  NMFVAIALSLVVLLGWHYFVTGPASERQRQAAQSQTAQTGAPQTADGIPSPSPREGSPNA 87

Query: 53  --------YAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
                     A+    R  AL+ S RV +  P+L GSI LKGA+ DD++L+ YH  VS  
Sbjct: 88  PAPGTLPGAGALGPVSREDALARSARVRIDTPALYGSIGLKGARIDDVSLKNYHETVSDE 147

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           SP + LLSP+ + N Y+AE  +V  AN   LPN++T+W    G +L P  P+ L + N  
Sbjct: 148 SPRIVLLSPTGSANPYYAEFGWVG-ANAGPLPNADTLWK-ADGDLLAPGRPLTLTWDNGQ 205

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR-HKPQTATNTFGVQEGFIAV 223
            ++F+R +++D+ ++F + D V N S + +   P   + R  KPQT    + + EG I V
Sbjct: 206 GLVFKRIVAVDDKFMFTVRDEVENTSANPVTLYPYSLVSRWGKPQT-QGYYVLHEGLIGV 264

Query: 224 LGDKSLVEQKYSDIEKSSISNFHES---------NSWLGISDKYWASVFIPSKETSFHSQ 274
           LG   L E  Y  + K        +           W+GI+DKYWA+  IP ++  F   
Sbjct: 265 LGGDGLQEYTYDKVGKEPAYGGAATQGKAWTNVTGGWVGITDKYWAAAAIPEQDKPFTGA 324

Query: 275 FKYLSDGHAR-YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEML 333
           F   +DG  + YQ     + +T+ P  S  TT  LFAGAKE   I+ YE++  I +F+++
Sbjct: 325 FTERTDGATKIYQTSVRGDAVTLAPNASSVTTQRLFAGAKEVNQINAYEREFGIKQFDLM 384

Query: 334 IDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQ 393
           IDWGWF+F+ KPMF  + +F++L+GNFG++I+L T+ +KL F P+A + YVS A MK +Q
Sbjct: 385 IDWGWFWFLTKPMFRALDFFFHLLGNFGVSILLVTLILKLFFLPIANRSYVSMAKMKAVQ 444

Query: 394 PKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEM 453
           P++  +RE++K    +  Q+AM++LYK   INP+AGCWP+L+QIPVFFA+YKV+ I++EM
Sbjct: 445 PEMTSIRERYKDDRVK-QQQAMMELYKKEKINPVAGCWPVLIQIPVFFALYKVLFITIEM 503

Query: 454 RHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGF--MHVGIWPIIMSLSMFIQMKMSPPP 511
           RHAPF+GWI+DLAA DPT+I  LFG+LPF  P +  +H+G+WPIIM ++MFIQMKM+P P
Sbjct: 504 RHAPFFGWIQDLAAPDPTSIVNLFGLLPFTPPEYIPIHLGVWPIIMGITMFIQMKMNPAP 563

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLR 571
            D  QA +  +MP+VF F L SFPAGL+IYW+W+N +S++QQ VIM+ +G ++ L D LR
Sbjct: 564 PDPVQAQVFAFMPIVFTFMLGSFPAGLVIYWAWNNTLSVIQQYVIMRRNGVKVELWDNLR 623

Query: 572 STFSKNYNS 580
             F +   S
Sbjct: 624 GMFKRGNKS 632


>gi|254561547|ref|YP_003068642.1| transmembrane protein, OxaA-like, preprotein translocase component
           [Methylobacterium extorquens DM4]
 gi|254268825|emb|CAX24786.1| transmembrane protein, OxaA-like, preprotein translocase component
           [Methylobacterium extorquens DM4]
          Length = 637

 Score =  511 bits (1315), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 257/609 (42%), Positives = 374/609 (61%), Gaps = 38/609 (6%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPRIEEMNN--ERKNIQT--------VKQPNQVDNS--- 52
           N FVAIALS++++  W  F   P  E      + +  QT        +  P+  + S   
Sbjct: 28  NMFVAIALSLVVLLGWHYFVTGPASERQRQAAQSQTAQTGAPQTADGIPSPSPREGSPNA 87

Query: 53  --------YAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
                    AA     R  AL+ S RV +  P+L GSI LKGA+ DD++L+ YH  VS  
Sbjct: 88  PAPGTLPGAAAQGPVSREDALARSARVRIDTPALYGSIGLKGARIDDVSLKNYHETVSDE 147

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           SP + LLSP+ + N Y+AE  +V  AN   LPN++T+W    G +L P  P+ L + N  
Sbjct: 148 SPRIVLLSPTGSANPYYAEFGWVG-ANAGPLPNADTLWK-ADGDLLAPGRPLTLTWDNGQ 205

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR-HKPQTATNTFGVQEGFIAV 223
            ++F+R +++D+ ++F + D V N S + +   P   + R  KPQT    + + EG I V
Sbjct: 206 GLVFKRIVAVDDKFMFTVRDEVENTSANPVTLYPYSLVSRWGKPQT-QGYYVLHEGLIGV 264

Query: 224 LGDKSLVEQKYSDIEKSSISNFHES---------NSWLGISDKYWASVFIPSKETSFHSQ 274
           LG   L E  Y  + K        +           W+GI+DKYWA+  IP ++  F   
Sbjct: 265 LGGDGLQEYTYDKVGKEPAYGGAATQGKAWTNVTGGWVGITDKYWAAAAIPEQDKPFTGA 324

Query: 275 FKYLSDGHAR-YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEML 333
           F   +DG  + YQ     + +T+ P  S  TT  LFAGAKE   I+ YE++  I +F+++
Sbjct: 325 FTERTDGATKIYQTSVRGDAVTLAPNASSVTTQRLFAGAKEVNQINAYEREFGIKQFDLM 384

Query: 334 IDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQ 393
           IDWGWF+F+ KPMF  + +F++L+GNFG++I+L T+ +KL F P+A + YVS A MK +Q
Sbjct: 385 IDWGWFWFLTKPMFRALDFFFHLLGNFGVSILLVTLILKLFFLPIANRSYVSMAKMKAVQ 444

Query: 394 PKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEM 453
           P++  +RE++K    +  Q+AM++LYK   INP+AGCWP+L+QIPVFFA+YKV+ I++EM
Sbjct: 445 PEMTSIRERYKDDRVK-QQQAMMELYKKEKINPVAGCWPVLIQIPVFFALYKVLFITIEM 503

Query: 454 RHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGF--MHVGIWPIIMSLSMFIQMKMSPPP 511
           RHAPF+GWI+DLAA DPT+I  LFG+LPF  P +  +H+G+WPIIM ++MFIQMKM+P P
Sbjct: 504 RHAPFFGWIQDLAAPDPTSIVNLFGLLPFTPPEYIPIHLGVWPIIMGITMFIQMKMNPAP 563

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLR 571
            D  QA +  +MP+VF F L SFPAGL+IYW+W+N +S++QQ VIM+ +G ++ L D LR
Sbjct: 564 PDPVQAQVFAFMPIVFTFMLGSFPAGLVIYWAWNNTLSVIQQYVIMRRNGVKVELWDNLR 623

Query: 572 STFSKNYNS 580
             F +   S
Sbjct: 624 GMFKRGNKS 632


>gi|218530582|ref|YP_002421398.1| YidC translocase/secretase [Methylobacterium chloromethanicum CM4]
 gi|254773000|sp|B7L2I5|OXAA_METC4 RecName: Full=Inner membrane protein oxaA
 gi|218522885|gb|ACK83470.1| YidC translocase/secretase [Methylobacterium chloromethanicum CM4]
          Length = 616

 Score =  509 bits (1311), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 254/610 (41%), Positives = 371/610 (60%), Gaps = 40/610 (6%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPRIEEMN----------------------NERKNIQTV 43
           N FVAIALS++++  W  F   P  E                         + R+     
Sbjct: 7   NMFVAIALSLVVLLGWHYFVTGPASERQRQAAQSQAAQTGAPQTADGIPSPSPREGSPNA 66

Query: 44  KQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSS 103
             P  +  + A   +  R  AL+ S RV +  P+L GSI LKGA+ DD++L+ YH  VS 
Sbjct: 67  PAPGTLPGAAAQGPV-SREDALARSARVRIDTPALYGSIGLKGARIDDVSLKNYHETVSD 125

Query: 104 NSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNA 163
            SP + LLSP+ + N Y+AE  +V  AN   LPN++T+W    G +L P  P+ L + N 
Sbjct: 126 ESPRIVLLSPTGSANPYYAEFGWVG-ANAGPLPNADTLWK-ADGDLLAPGRPLTLTWDNG 183

Query: 164 NNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR-HKPQTATNTFGVQEGFIA 222
             ++F+R +++D+ ++F + D V N S + +   P   + R  KPQT    + + EG I 
Sbjct: 184 QGLVFKRIVAVDDKFMFTVRDEVENTSANPVTLYPYSLVSRWGKPQT-QGYYVLHEGLIG 242

Query: 223 VLGDKSLVEQKYSDIEKSSISNFHE---------SNSWLGISDKYWASVFIPSKETSFHS 273
           VLG   L E  Y  + K                 +  W+GI+DKYWA+  IP ++  F  
Sbjct: 243 VLGGDGLQEYTYDKVGKEPAYGGAATQGKAWTNVTGGWVGITDKYWAAAAIPEQDKPFTG 302

Query: 274 QFKYLSDGHAR-YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEM 332
            F   +DG  + YQ     + +T+ P  S  TT  LFAGAKE   I+ YE++  I +F++
Sbjct: 303 AFTERTDGATKIYQTSVRGDAVTLAPNASSVTTQRLFAGAKEVNRINAYEREFGIKQFDL 362

Query: 333 LIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNI 392
           +IDWGWF+F+ KPMF  + +F++L+GNFG++I+L T+ +KL F P+A + YVS A MK +
Sbjct: 363 MIDWGWFWFLTKPMFRALDFFFHLLGNFGVSILLVTLILKLFFLPIANRSYVSMAKMKAV 422

Query: 393 QPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLE 452
           QP++  +RE++K    +  Q+AM++LYK   INP+AGCWP+L+QIPVFFA+YKV+ I++E
Sbjct: 423 QPEMTSIRERYKDDRVK-QQQAMMELYKKEKINPVAGCWPVLIQIPVFFALYKVLFITIE 481

Query: 453 MRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGF--MHVGIWPIIMSLSMFIQMKMSPP 510
           MRHAPF+GWI+DLAA DPT+I  LFG+LPF  P +  +H+G+WPIIM ++MFIQMKM+P 
Sbjct: 482 MRHAPFFGWIQDLAAPDPTSIVNLFGLLPFTPPEYIPIHLGVWPIIMGITMFIQMKMNPA 541

Query: 511 PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL 570
           P D  QA +  +MP+VF F L SFPAGL+IYW+W+N +S++QQ VIM+ +G ++ L D L
Sbjct: 542 PPDPVQAQVFAFMPIVFTFMLGSFPAGLVIYWAWNNTLSVIQQYVIMRRNGVKVELWDNL 601

Query: 571 RSTFSKNYNS 580
           R  F +   S
Sbjct: 602 RGMFKRGNKS 611


>gi|49474531|ref|YP_032573.1| putative inner membrane protein translocase component YidC
           [Bartonella quintana str. Toulouse]
 gi|49240035|emb|CAF26454.1| hypothetical protein BQ09780 [Bartonella quintana str. Toulouse]
          Length = 613

 Score =  509 bits (1311), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 264/608 (43%), Positives = 377/608 (62%), Gaps = 33/608 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           ME N N+F+AI LS  ++ AW  FYV P+  ++  +R   Q + +     ++      D+
Sbjct: 1   MEYNRNFFIAIGLSFGVLIAWHFFYVAPKQAQLQQKRLIAQQLSKQQSTLSTSTPYFSDN 60

Query: 61  -------------------RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDV 101
                              R +AL+ + R+ +K   L GSINL GAQFDDL L+ Y L V
Sbjct: 61  ASITHESASIITHPITPEIRNEALAKTNRIAIKTDELEGSINLVGAQFDDLLLKKYRLTV 120

Query: 102 SSNSPIVTLLSPSNTKNAYFAELDYVSTANNIE-LPNSNTVWNLISGKI-LTPTTPIKLV 159
              SP + LL+P      Y AE  + S++ + + LP S+T W +      LTP+TP+ L+
Sbjct: 121 DKKSPEIALLNPKGFTTTYLAEFGFTSSSLSAKALPQSDTQWQIEGNNTTLTPSTPVTLI 180

Query: 160 FKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQE 218
           + N    +F RT+S+D HY+F I D++ N S   I  S   R+ R  P   TN T+ + E
Sbjct: 181 YNNGQGQIFRRTLSVDNHYMFTIEDSIKNESDKPIYLSSYARVARAAPPEHTNATYLLHE 240

Query: 219 GFIAVLGDKSLVEQKYS---------DIEKSSISNFHESNSWLGISDKYWASVFIPSKET 269
           G I +  D SL  +KY          D  + SI+       W+GI+DKYWA   IP ++ 
Sbjct: 241 GMIGIASD-SLKTEKYKTLAELNPNPDNSQKSITFSKNIGGWIGITDKYWAVAVIPPQDK 299

Query: 270 SFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPR 329
            + S+F Y    +  YQ+    + +T+ P ++   TN LFAGAK+   I+HY+ DL I +
Sbjct: 300 EYTSRFIYFDRLNTHYQSDLLGSLLTVAPNETKIVTNRLFAGAKQVEIINHYQNDLKIKK 359

Query: 330 FEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANM 389
           F +LIDWGWF FI KPMF L+   Y   GNFGIAI+L TV +K L FPLA K Y S A M
Sbjct: 360 FALLIDWGWFDFITKPMFSLIDTLYKQTGNFGIAILLVTVLLKTLLFPLANKSYKSMARM 419

Query: 390 KNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISI 449
           K IQP + E++EK+     +  Q+A+I+LYKT  INPLAGCWP+L+Q P+FFA+YKV+ I
Sbjct: 420 KLIQPMLLEIKEKYPDDRTKQ-QQAIIELYKTQKINPLAGCWPMLIQFPIFFALYKVLYI 478

Query: 450 SLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSP 509
           ++EMRHAPF+GWI+DLAA DPT++F LFG+LP+ +P F+ +G WP+IM ++MF+QM+M+P
Sbjct: 479 TIEMRHAPFFGWIQDLAAPDPTSLFNLFGLLPYTVPTFLMLGAWPLIMGITMFLQMRMNP 538

Query: 510 PPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDR 569
            P D+ QAMI  WMPV+F F L+SFP GL+IYW+W+N++SI+QQ+++MK  G +I L D 
Sbjct: 539 APQDQTQAMIFAWMPVIFTFMLASFPVGLVIYWAWNNILSILQQSILMKRQGVKIELFDN 598

Query: 570 LRSTFSKN 577
           L++ + K+
Sbjct: 599 LKAMWWKS 606


>gi|217977385|ref|YP_002361532.1| 60 kDa inner membrane insertion protein [Methylocella silvestris
           BL2]
 gi|254773006|sp|B8EPG5|OXAA_METSB RecName: Full=Inner membrane protein oxaA
 gi|217502761|gb|ACK50170.1| 60 kDa inner membrane insertion protein [Methylocella silvestris
           BL2]
          Length = 600

 Score =  508 bits (1309), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 253/596 (42%), Positives = 357/596 (59%), Gaps = 23/596 (3%)

Query: 6   NYFVAIALSVIIVYAWQNFYV---YPRIEEMNNERKNIQTVKQPNQVDNSYAAV------ 56
           N ++AI LS +++  W   +      R      + +N     QP        A       
Sbjct: 7   NLYLAIGLSCLVIVGWSYIFAPKQADRARLAQTQSQNAPAGTQPQSAATPQDAANFSPLD 66

Query: 57  -LIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSN 115
            L   RA+AL+ SPR+++  P++ GS++LKGA+ DD++L+GY   V  NSP + LLSP  
Sbjct: 67  ALPKTRAEALAASPRLKIDTPAIFGSLSLKGARLDDVSLKGYRETVDPNSPNIVLLSPQG 126

Query: 116 TKNAYFAELDYV-STANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISL 174
             +AY+AE  +V +    + +P S+TVW       LTP  P+ L + N   ++F R I++
Sbjct: 127 APDAYYAEAGFVPAPGEAVAVPRSDTVWT-ADRDALTPEAPVTLTYDNGQGLVFHRQIAV 185

Query: 175 DEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKY 234
           D+ ++F I D+V N S   +  +    + RH      N   + EGF+ V+GD  + E  Y
Sbjct: 186 DDRFMFTIKDSVENKSAKPVTLASYALVARHGLPKTVNYAVLHEGFVGVIGDAGVQEFHY 245

Query: 235 SDIEKS--SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLS--DGHARYQAKFS 290
             IEK       F  +  WLG +DKYWA+  IP +     ++F   S   G   Y+A F 
Sbjct: 246 DKIEKEDHGYKTFSGAGGWLGFTDKYWAATVIPDQAAPIEARFSANSTPSGIKTYRADFV 305

Query: 291 ANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLM 350
               TI PG +    + +FAGAKE  T+  Y+ DL I +FE+LIDWGWFYFI +PMF L+
Sbjct: 306 GPVQTIAPGATTEAMSRVFAGAKEVHTLDAYQADLGIKKFELLIDWGWFYFITRPMFRLL 365

Query: 351 SYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQV 410
            + Y+L GNFG+AI+L TV VK LFFPLA K Y+S A MK + P+I  LREK+ +   + 
Sbjct: 366 HFLYSLTGNFGVAILLATVIVKGLFFPLANKSYLSMAKMKAVAPEIAALREKYPEDKMKQ 425

Query: 411 LQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADP 470
            Q+ M  LYK   INP++GC P+L+QIPVFFA+YKV+ +++EMRHAPF+GWI DL+A DP
Sbjct: 426 QQETM-ALYKREKINPVSGCLPMLIQIPVFFALYKVLFVTIEMRHAPFFGWIHDLSAPDP 484

Query: 471 TNIFTLFGILPF---YLP---GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMP 524
           TN+F LFG+LPF    LP    F+ +G+WP++M +SMF+QMK +P PAD  Q  I  WMP
Sbjct: 485 TNLFNLFGLLPFDPTQLPLIGHFLAIGVWPLLMGVSMFVQMKANPEPADPMQKQIFTWMP 544

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNS 580
           V+F F L  FP GL+IYW+W+N++S+ QQ +IMK  G ++ L D L S F K   S
Sbjct: 545 VIFTFTLGGFPVGLVIYWTWNNILSVSQQTLIMKRAGVKVELFDNLASLFRKKVTS 600


>gi|328545250|ref|YP_004305359.1| transmembrane protein, OxaA-like, preprotein translocase component
           [polymorphum gilvum SL003B-26A1]
 gi|326414992|gb|ADZ72055.1| Transmembrane protein, OxaA-like, preprotein translocase component
           [Polymorphum gilvum SL003B-26A1]
          Length = 607

 Score =  508 bits (1307), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 265/602 (44%), Positives = 375/602 (62%), Gaps = 28/602 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQ------------------- 41
           M  N N F+AIALS++++  WQ F   P++E    E                        
Sbjct: 1   MADNRNTFLAIALSLVVLLGWQYFVARPQLERQQAELAQQDAQQQAAGQDAQAPTPGATA 60

Query: 42  --TVKQPNQVDNSYAAVLID-DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYH 98
             ++  P     +  A  +   R  AL  S RV ++ P + GSINL GA+ DDL L+ Y 
Sbjct: 61  PGSLPAPGSTAPAAGAQPVALTREAALGTSARVTIETPRVSGSINLAGARIDDLRLKDYR 120

Query: 99  LDVSSNSPIVTLLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWNLISGKILTPTTPIK 157
             V   SP + L SP      Y+A+  +V+     + LP  +++W++     LTP TP+ 
Sbjct: 121 ETVDPKSPTIVLFSPKGGPKPYYADFGWVTDGTKTVALPGPDSLWSVEGSDRLTPQTPVT 180

Query: 158 LVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGV 216
           L F N   ++F+RT ++DE+Y+F +   V N + + IR  P G I+R  KP+TA   + +
Sbjct: 181 LTFDNGEGLVFKRTFTIDENYMFSVSQEVVNGTQEAIRLFPYGLIVRRGKPETA-GFYIL 239

Query: 217 QEGFIAVLGDKSLVEQKYSDIEKSS-ISNFHESNSWLGISDKYWASVFIPSKETSFHSQF 275
            EG I V G+K L E  YSD+E+   I      + WLGI+DKYWA+  IP   +SF   F
Sbjct: 240 HEGLIGVFGEKGLQEVDYSDVEEDGQIRPGQVDSGWLGITDKYWAATLIPMPGSSFQPSF 299

Query: 276 KYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLID 335
            Y +     +QA F    + +  G S + +++LFAGAKE   I  YE+ L I RFE+LID
Sbjct: 300 GYTATTD-NFQADFLGAAVDVASGASGSASSYLFAGAKETKVIDAYEEALNIARFELLID 358

Query: 336 WGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPK 395
           WGWFYF+ KPMF ++ + ++LVGNFGIAI+L TV VKL+FFPLA K YVS + MK +QP+
Sbjct: 359 WGWFYFLTKPMFFVIDWLFHLVGNFGIAILLVTVLVKLVFFPLANKSYVSMSKMKLVQPQ 418

Query: 396 IDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRH 455
           + E+R+++K    +  Q+A+++LYK   INPLAGC PIL+QIPVFFA+YKV+ +++EMRH
Sbjct: 419 MTEIRDRYKDDKAK-QQQALMELYKKEKINPLAGCLPILIQIPVFFALYKVLFVTIEMRH 477

Query: 456 APFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKG 515
           APF+GWI+DL+A DPT IF LFG++P+  P  + +GIWP+IM ++MF+QMKM+P P D  
Sbjct: 478 APFFGWIQDLSAPDPTTIFNLFGLIPWDPPQMLMLGIWPLIMGVTMFVQMKMNPAPPDPT 537

Query: 516 QAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFS 575
           Q MI  WMPV+F F L+SFPAGL+IYW+W+N +SI QQ VIM+  GA++ L D L+ TF 
Sbjct: 538 QQMIFTWMPVIFTFMLASFPAGLVIYWAWNNSLSIAQQYVIMRRQGAKVELWDNLKITFK 597

Query: 576 KN 577
           + 
Sbjct: 598 RK 599


>gi|182680230|ref|YP_001834376.1| 60 kDa inner membrane insertion protein [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|254772748|sp|B2IDV5|OXAA_BEII9 RecName: Full=Inner membrane protein oxaA
 gi|182636113|gb|ACB96887.1| 60 kDa inner membrane insertion protein [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 604

 Score =  507 bits (1306), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 251/598 (41%), Positives = 374/598 (62%), Gaps = 29/598 (4%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLID------ 59
           N ++AI LS++++  W  F+  P++E+    +   +   Q     ++ A   ++      
Sbjct: 7   NLYLAIGLSLLVLIGWNYFFAGPQVEKARQAQIVREQQAQTQTTSDTTARSDLNVPGQRS 66

Query: 60  ----------DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVT 109
                      R +AL+ SPRV+L  P+L GSINL+GA+ DD++L+ Y   V+ +SP + 
Sbjct: 67  LPGESPQTQLSRPEALAASPRVKLDTPNLFGSINLRGARIDDVSLKAYRETVAKDSPNIV 126

Query: 110 LLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILF 168
           LLSPS T   Y+A+  +V+ A   + LP S+T+W+    ++LTP  P+ L + N   ++F
Sbjct: 127 LLSPSGTPAPYYADAGFVAPAEAGLLLPKSDTLWS-ADREVLTPEAPVTLTYDNGQGLIF 185

Query: 169 ERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVLGDK 227
            RTIS+D+ ++F + D V N +   +   P   + RH +P TA     + EG + V+GD 
Sbjct: 186 HRTISVDDRFMFTLTDKVENKTDKPVTLYPYSLVSRHGRPVTAGYAV-LHEGMVGVIGDN 244

Query: 228 SLVEQKYSDI--EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARY 285
            L E  Y  I  E+++  +F  +  WLG +DKYWA+V  P + T F  +F         Y
Sbjct: 245 GLQEITYDKIHKEENATKSFKGTGGWLGFTDKYWAAVIAPDQATPFEGRFSERGTTTPLY 304

Query: 286 QAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKP 345
           Q       +TI PG +    + LFAGAKE  T+  Y  +L I +F++LIDWG+FYFI +P
Sbjct: 305 QTDALGPALTIAPGGTGGDMSRLFAGAKETQTLDDYRNELGIKKFDLLIDWGYFYFITRP 364

Query: 346 MFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQ 405
           MF ++   Y +VGNFG+AI+  TV VK +FFPLA + Y+S A MK IQP++  LRE++  
Sbjct: 365 MFWILHTIYQVVGNFGVAILCITVLVKAVFFPLANRSYLSMAKMKAIQPQMLALRERYAD 424

Query: 406 SPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDL 465
              +  Q+ +++LYK   INP+AGC P+L+QIPVFFA+YKV+ +++EMR APF+GWI+DL
Sbjct: 425 DKVKQ-QQELMELYKREKINPVAGCLPMLIQIPVFFALYKVLFVTIEMRQAPFFGWIRDL 483

Query: 466 AAADPTNIFTLFGILPF---YLP---GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMI 519
           +A DPTNIF LFG+LPF   +LP    F+ +GIWP+IM +SMF QMKM+P PAD  Q  +
Sbjct: 484 SAPDPTNIFNLFGLLPFDPTHLPMIGHFLAIGIWPLIMGVSMFFQMKMNPEPADPVQKQM 543

Query: 520 LNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
            +WMPV+F F L +FP+GL+IYW+W+N +S++QQ++IMK  G ++ L D L STF K 
Sbjct: 544 FSWMPVIFTFMLGTFPSGLVIYWTWNNTLSVLQQSLIMKRAGVKVELWDNLMSTFRKK 601


>gi|75677253|ref|YP_319674.1| putative inner membrane protein translocase component YidC
           [Nitrobacter winogradskyi Nb-255]
 gi|74422123|gb|ABA06322.1| protein translocase subunit yidC [Nitrobacter winogradskyi Nb-255]
          Length = 614

 Score =  507 bits (1306), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 250/610 (40%), Positives = 372/610 (60%), Gaps = 30/610 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIE----------EMNNERKNIQTVKQPNQV- 49
           M  N N  +AI LS +++ AWQ FY  P++E          E+   +   Q    PN   
Sbjct: 1   MSENRNTIIAIVLSALVLIAWQYFYNIPQMEKDRAAHQAQSELAKSQSKSQGEAAPNTAA 60

Query: 50  -DNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIV 108
              S A   +  R  A++  PRV++  P L GSI+L GA+ DDL L  Y   V+  SP +
Sbjct: 61  PGQSAAGSAVVARDVAIASKPRVQINTPRLSGSISLTGARIDDLLLTKYRETVNPASPAI 120

Query: 109 TLLSPSNTKNAYFAELDYV-STANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNIL 167
            L SPS T + Y+AE  +V  T + + +P+ +T+W       LTP+TP+ L + N   + 
Sbjct: 121 ELFSPSGTASPYYAEFGWVPGTGSTVRVPDRSTLWQQEGAGALTPSTPVTLKYDNGEGLT 180

Query: 168 FERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDK 227
           F RT+S+D+ YLF I D VTN     +   P   I RH     +  + + EG I  LGD+
Sbjct: 181 FRRTVSVDDQYLFTIKDEVTNTGSAPVTLYPFALISRHGTPEISGYYILHEGLIGYLGDQ 240

Query: 228 SLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR-YQ 286
            L E  Y +I+++    F+ +N WLGI+DKYWA+  +P       ++F     G  R YQ
Sbjct: 241 KLQEYSYKNIDEAGSVTFNVTNGWLGITDKYWAAALLPDTSARLQARFSSDQAGAVRTYQ 300

Query: 287 AKFSANEITILPGKSITTTNFLFAGAKE-------FP--TIHHYEKDLAIPRFEMLIDWG 337
             +  +  TI  G +   +  LFAGAKE       FP   +  Y K L +  F++LIDWG
Sbjct: 301 TDYLEDARTIPAGGTGAVSTRLFAGAKEAGVVGLNFPLAELGGYNKQLGLNHFDLLIDWG 360

Query: 338 WFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKID 397
           WFYFI KPMF+ + +F+++ GNFG++I++ TV +KL+FFPLA + Y S A MK IQP+I+
Sbjct: 361 WFYFITKPMFLALDFFFHVFGNFGVSILVVTVLIKLVFFPLANRSYASMAKMKAIQPQIN 420

Query: 398 ELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAP 457
            LRE +     + LQ+ M+++YK   INP++GC P+LLQIPVFF++YKV+ +++EMRHAP
Sbjct: 421 ALRELYPDDRMK-LQQEMMEIYKKEKINPISGCLPVLLQIPVFFSLYKVLFVTIEMRHAP 479

Query: 458 FWGWIKDLAAADPTNIFTLFGILPF------YLPGFMHVGIWPIIMSLSMFIQMKMSPPP 511
           F+ WIKDL+A DPT+IF LFG+LP+       +  ++ +G WPIIM ++M+ QMK++P P
Sbjct: 480 FFAWIKDLSAPDPTHIFNLFGLLPYDPSVVPLIGPYLAIGAWPIIMGVTMWFQMKLNPTP 539

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLR 571
            D  Q +I +WMPV+F F L++FPAGL+IYW+W+N +S++QQ+ IM+ +G ++ L D ++
Sbjct: 540 PDPTQKIIFDWMPVIFTFMLAAFPAGLVIYWAWNNTLSVIQQSYIMRRNGVKVELFDNVK 599

Query: 572 STFSKNYNSQ 581
           STF +  + +
Sbjct: 600 STFRRKSSDK 609


>gi|146337896|ref|YP_001202944.1| putative inner membrane protein translocase component YidC
           [Bradyrhizobium sp. ORS278]
 gi|146190702|emb|CAL74706.1| Inner membrane protein oxaA [Bradyrhizobium sp. ORS278]
          Length = 622

 Score =  503 bits (1295), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 264/620 (42%), Positives = 374/620 (60%), Gaps = 45/620 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIE------EMNNERKNIQ------------T 42
           M  N N  +A+ LS +++  WQ FY  P++E      ++ +E    Q             
Sbjct: 1   MTDNRNTILAVILSGLVLILWQVFYNGPQMEKQRAQAQLQSELAKKQGPATQPDGTAPSA 60

Query: 43  VKQPNQVDN---------SYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLN 93
             QPN   +         +  A  +  R  A++ +PRV++  P L GSI+LKGA+ DDL 
Sbjct: 61  TPQPNAAASGSPSAPGGAATTATGVVPRETAIAANPRVKIDTPRLSGSISLKGARIDDLA 120

Query: 94  LRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWNLISGKILTP 152
              Y   V  NSP + L SPSNT   Y+AE  +V+ A   +++P+ NTVW       LTP
Sbjct: 121 FVQYRETVDPNSPAIVLFSPSNTAEPYYAEFGWVNAAGAKVQVPDQNTVWQQDGANALTP 180

Query: 153 TTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN 212
            TP+KL + N + + F+RTIS+D+HYLF I D VTN     +   P G I RH     + 
Sbjct: 181 ATPVKLTYTNGDGLTFQRTISVDDHYLFTIKDDVTNAGSAPVTLYPYGLISRHGTPHVSG 240

Query: 213 TFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFH 272
            + + EG I  LG+K L E  Y  ++    + F  +N WLGI+DKYWA+  +P  +    
Sbjct: 241 YYILHEGLIGYLGEKGLQEFTYKKMDDEKAAKFDITNGWLGITDKYWAAALLPMTDARLQ 300

Query: 273 SQF-KYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKE-------FP--TIHHYE 322
           + +   L D   RYQ  +  N  T+  G S T +  LFAGAKE       FP   +  Y 
Sbjct: 301 ANYSSKLVDNQHRYQTDYVENPQTVPAGGSATVSTRLFAGAKEAGVVGINFPLGGLGGYN 360

Query: 323 KDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQ 382
           + L +  F++LIDWGWFYF+ KPMF+ + +F+   GNFG++I+L TV VKL F PLA K 
Sbjct: 361 QQLGLNHFDLLIDWGWFYFLTKPMFLALDFFFRFFGNFGVSILLVTVLVKLAFLPLANKS 420

Query: 383 YVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFA 442
           Y S A MK IQP++  L+E++     +  Q+ M+++YK   INP+AGC P++LQIPVFF+
Sbjct: 421 YASMAKMKAIQPQLQALKERYPDDRMKQ-QQEMMEIYKKEKINPVAGCLPVVLQIPVFFS 479

Query: 443 IYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPF---YLPGFMH---VGIWPII 496
           +YKV+ +++EMRHAPF GWIKDL+A DPTN+FTLFG++PF    LP F H   +GIWPII
Sbjct: 480 LYKVLFVTIEMRHAPFIGWIKDLSAPDPTNLFTLFGLIPFDPTQLPLFGHYLALGIWPII 539

Query: 497 MSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVI 556
           M ++M+ QMK++P P D  QAMI NWMP++F F L+ FPAGL+IYW+W+N +S++QQ+ I
Sbjct: 540 MGITMWFQMKLNPAPPDPTQAMIFNWMPLIFTFMLAGFPAGLVIYWAWNNTLSVLQQSFI 599

Query: 557 MKMHGAEIGLIDRLRSTFSK 576
           M+ +G ++ L D +R TF K
Sbjct: 600 MRRNGVKVELFDNIRGTFRK 619


>gi|170743186|ref|YP_001771841.1| 60 kDa inner membrane insertion protein [Methylobacterium sp. 4-46]
 gi|254773005|sp|B0UHI1|OXAA_METS4 RecName: Full=Inner membrane protein oxaA
 gi|168197460|gb|ACA19407.1| 60 kDa inner membrane insertion protein [Methylobacterium sp. 4-46]
          Length = 624

 Score =  501 bits (1289), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 252/616 (40%), Positives = 365/616 (59%), Gaps = 50/616 (8%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPRIEEMN-------------NERKNIQTVKQ------- 45
           N  +AIALS+ ++  W  F   P++E                N  + +   +        
Sbjct: 7   NMIIAIALSLAVLLGWNYFVTAPQVERQRQQQAAQVNPSQGVNPSQGVDPSQGVNASPSP 66

Query: 46  -------------PNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDL 92
                        P     S  A L  D  +AL+ +PRV +   +L GS+ LKG + DD+
Sbjct: 67  KEGGPSAPVPGTLPGAAGGSPQAALARD--EALARAPRVRIDTEALRGSVALKGGRIDDV 124

Query: 93  NLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTP 152
            L+GYH  V   SP + LLSP+ + N Y+AE  +V   N   LP S+TVW    G +LT 
Sbjct: 125 ALKGYHETVDPKSPEIVLLSPAGSANPYYAEFGWVGQ-NAGPLPGSDTVWT-ADGDVLTA 182

Query: 153 TTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR-HKPQTAT 211
             P+ L F N   ++F RT+S+D+ Y+F I D+V N   + +   P G + R  KP T  
Sbjct: 183 KKPLVLTFDNGAGLVFRRTLSVDDKYMFTIEDSVENKGPNPVTLYPYGLVSRWGKPHT-Q 241

Query: 212 NTFGVQEGFIAVLGDKSLVEQKYSDIEKS---------SISNFHESNSWLGISDKYWASV 262
             + + EG I V+GDK L E  Y  + K           +S    +  +LGI+DKYWA+ 
Sbjct: 242 GYYVLHEGMIGVVGDKGLQEYTYDKMAKENPLGAPGTRGVSWPGATGGFLGITDKYWAAA 301

Query: 263 FIPSKETSFHSQFKYLSDGHAR-YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHY 321
            IP ++  +   F    +G  + YQA        + PG S+  +  LFAGAKE  T+  Y
Sbjct: 302 TIPDQQAPYTGSFTERDEGATKVYQASSLGEARAVAPGASVQASQRLFAGAKEVSTVDAY 361

Query: 322 EKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKK 381
            + L I +F++LIDWGWFYFI KPMF  +  FY L GNFG++I++ T+ +KL F P+A +
Sbjct: 362 REKLNIKQFDLLIDWGWFYFITKPMFKALDLFYKLFGNFGVSILVVTLILKLFFLPIANR 421

Query: 382 QYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFF 441
            YVS A MK +QP++  +RE++     +  Q+AM++LYK   INP+AGCWP+L+QIPVFF
Sbjct: 422 SYVSMAKMKAVQPEMTAIRERYADDKVK-QQQAMMELYKKEKINPVAGCWPVLIQIPVFF 480

Query: 442 AIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSM 501
           ++YKV+ +++EMRHAPF+GWI+DLAA DPT+I  LFG+LPF  P  +H+G+WPI+M ++M
Sbjct: 481 SLYKVLFVTIEMRHAPFFGWIRDLAAPDPTSIVNLFGLLPFTPPDLLHLGVWPIVMGITM 540

Query: 502 FIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHG 561
           F+QMKM+P P D  QA +  +MP++F F L SFPAGL+IYW+W+N++SI+QQ  IM+ +G
Sbjct: 541 FLQMKMNPAPPDPVQAQVFTFMPIIFTFMLGSFPAGLVIYWAWNNLLSILQQYWIMRRNG 600

Query: 562 AEIGLIDRLRSTFSKN 577
            ++ L D LRSTF + 
Sbjct: 601 VKVELWDNLRSTFQRR 616


>gi|92119160|ref|YP_578889.1| putative inner membrane protein translocase component YidC
           [Nitrobacter hamburgensis X14]
 gi|122416784|sp|Q1QH68|OXAA_NITHX RecName: Full=Inner membrane protein oxaA
 gi|91802054|gb|ABE64429.1| protein translocase subunit yidC [Nitrobacter hamburgensis X14]
          Length = 609

 Score =  500 bits (1287), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 249/605 (41%), Positives = 370/605 (61%), Gaps = 25/605 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEE------MNNERKNIQTVKQPNQVDNSY- 53
           M  N N  +AI LS +I+ AWQ FY  P++E+        ++     T   PN     + 
Sbjct: 2   MSENRNTIIAIVLSGLILIAWQYFYNIPQMEKDRAAQQAQSQTAKSPTEPTPNSPKPDHP 61

Query: 54  AAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSP 113
           AA  +  R  A++ +PRV++  P L GSI+LKGA+ DDL L  +   V   SP + L SP
Sbjct: 62  AAESVVARGVAIATTPRVKIDTPRLSGSISLKGARIDDLLLTKFRETVDPASPAIELFSP 121

Query: 114 SNTKNAYFAELDYVS-TANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTI 172
           S T   Y+AE  +V+ T +   +P+ NTVW       LT +TP+ L + N   + F RTI
Sbjct: 122 SGTTTPYYAEFGWVAATGSTARVPDQNTVWQQEGSGALTQSTPVTLKYDNGEGLTFRRTI 181

Query: 173 SLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ 232
           ++D+HYLF I D VTN     +   P   I RH     +  + + EG I  LGD+ L E 
Sbjct: 182 AVDDHYLFTIKDEVTNAGGAPVTLYPFALISRHGTPAVSGYYILHEGLIGYLGDQKLQEY 241

Query: 233 KYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR-YQAKFSA 291
            Y  I+++   +F  +N WLGI+DKYWA+  +P       ++F     G  + YQA +  
Sbjct: 242 SYKKIDEAKSVSFKVTNGWLGITDKYWAAALLPDTSAQLQARFSSNESGSVKTYQADYLE 301

Query: 292 NEITILPGKSITTTNFLFAGAKE---------FPTIHHYEKDLAIPRFEMLIDWGWFYFI 342
           +  TI  G + +    LFAGAKE         F  +  Y K L +  F++LIDWGWFYFI
Sbjct: 302 DAQTIPVGGTGSVNTRLFAGAKEAGVVGINFPFVELGGYNKQLGLNHFDLLIDWGWFYFI 361

Query: 343 AKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREK 402
            KPMF+ + +F+++ GNFGIAI+  TV +K +FFPLA + Y S A MK +QP+I  L+E+
Sbjct: 362 TKPMFLALDFFFHVFGNFGIAILFVTVLIKAIFFPLANRSYASMAKMKAVQPQIAALKER 421

Query: 403 FKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWI 462
           F     + LQ+ M+++YK   INP++GC P++LQIPVFF++YKV+ +++EMRHAPF+ WI
Sbjct: 422 FPDDKMK-LQQEMMEIYKKEKINPISGCLPMVLQIPVFFSLYKVLFVTIEMRHAPFFAWI 480

Query: 463 KDLAAADPTNIFTLFGILPF------YLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQ 516
           KDL+A DPT+IF LFG+LP+       L  ++ +G WPIIM ++M+ QMK++P P D  Q
Sbjct: 481 KDLSAPDPTHIFNLFGLLPYDPSAVPLLGPYLAIGAWPIIMGITMWFQMKLNPTPPDPTQ 540

Query: 517 AMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSK 576
            +I +WMPV+F F L++FPAGL+IYW+W+N +S++QQ+ IM+ +G ++ L++ ++S F +
Sbjct: 541 KLIFDWMPVIFTFMLAAFPAGLVIYWAWNNTLSVIQQSYIMRRNGVKVELLNNVKSVFRR 600

Query: 577 NYNSQ 581
             + +
Sbjct: 601 KSSDK 605


>gi|85717142|ref|ZP_01048101.1| putative inner membrane protein translocase component YidC
           [Nitrobacter sp. Nb-311A]
 gi|85696033|gb|EAQ33932.1| putative inner membrane protein translocase component YidC
           [Nitrobacter sp. Nb-311A]
          Length = 614

 Score =  499 bits (1285), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 247/606 (40%), Positives = 372/606 (61%), Gaps = 31/606 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAA----- 55
           M  N N  +AI LS +++ AWQ FY  P++E+ +   +  Q+    +Q ++S AA     
Sbjct: 1   MSENRNTIIAIVLSALVLIAWQYFYNIPQMEK-DRAAQQAQSELAKSQKESSEAAPNSPT 59

Query: 56  -------VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIV 108
                    +  R  A++  PRV++  P L GS++L GA+ DDL L  Y   V   SP +
Sbjct: 60  PGQPAAKSAVVARDVAIASKPRVKIHTPRLSGSLSLTGARIDDLLLTKYRETVDPASPAI 119

Query: 109 TLLSPSNTKNAYFAELDYV-STANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNIL 167
            L SPS T N Y+AE  +V +T + + +P+ +T W       LT +TP+ L + N   + 
Sbjct: 120 ELFSPSGTANPYYAEFGWVPATGSTVRVPDRDTPWQQEGSGALTESTPVTLKYDNGEGLT 179

Query: 168 FERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDK 227
           F RTIS+D+ YLF I D V+N     +   P   I RH     +  + + EG I  LGD+
Sbjct: 180 FRRTISVDDQYLFTIKDEVSNTGSAPVTLYPFALISRHGTPQVSGYYILHEGLIGYLGDQ 239

Query: 228 SLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR-YQ 286
            L E  Y  I+++   +F  +N WLGI+DKYWA+  +P       ++F     G  + YQ
Sbjct: 240 KLQEYSYKKIDEAKSVSFDVTNGWLGITDKYWAAALLPDTSARLQARFSSDQAGSVKTYQ 299

Query: 287 AKFSANEITILPGKSITTTNFLFAGAKE-------FPTIH--HYEKDLAIPRFEMLIDWG 337
             +  +  TI  G + + +  LFAGAKE       FP +    Y K L +  F++LIDWG
Sbjct: 300 TDYLEDARTIPAGGTGSLSTRLFAGAKEAGVVGLNFPLVELGGYNKQLGLNHFDLLIDWG 359

Query: 338 WFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKID 397
           WFYFI KPMF+ + +F+++ GNFG+AI++ TV +KL+FFPLA + Y S A MK +QP+I 
Sbjct: 360 WFYFITKPMFLALDFFFHVFGNFGVAILVVTVLIKLVFFPLANRSYASMAKMKAVQPQIT 419

Query: 398 ELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAP 457
            L+E++     + LQ+ M+++YK   INP++GC P+LLQIPVFF++YKV+ +++EMRHAP
Sbjct: 420 ALKEQYPDDRMK-LQQEMMEIYKKEKINPISGCLPMLLQIPVFFSLYKVLFVTIEMRHAP 478

Query: 458 FWGWIKDLAAADPTNIFTLFGILPF------YLPGFMHVGIWPIIMSLSMFIQMKMSPPP 511
           F+ WIKDL+A DPT+IF LFG+LP+       L  ++ +G WPIIM ++M+ QMK++P P
Sbjct: 479 FFAWIKDLSAPDPTHIFNLFGLLPYDPSVVPLLGPYLAIGAWPIIMGITMWFQMKLNPTP 538

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLR 571
            D  Q +I +WMPV+F F L++FPAGL+IYW+W+N +S++QQ+ IM+ +G ++ L D ++
Sbjct: 539 PDPTQKIIFDWMPVIFTFMLAAFPAGLVIYWAWNNTLSVIQQSYIMRRNGVKVELFDNVK 598

Query: 572 STFSKN 577
           STF + 
Sbjct: 599 STFRRK 604


>gi|298290371|ref|YP_003692310.1| membrane protein insertase, YidC/Oxa1 family domain containing
           protein [Starkeya novella DSM 506]
 gi|296926882|gb|ADH87691.1| membrane protein insertase, YidC/Oxa1 family domain containing
           protein [Starkeya novella DSM 506]
          Length = 609

 Score =  498 bits (1283), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 244/602 (40%), Positives = 362/602 (60%), Gaps = 29/602 (4%)

Query: 3   RNWNYFVAIALSVIIVYAWQNFYVYPRIEEM------------------NNERKNIQTVK 44
            N N  +AI LS+ ++ AWQ F   P++E+                   + E        
Sbjct: 4   ENRNMIIAIVLSMAVLIAWQYFSGIPQMEQQRQQHAAQQQAAQQQAAQPSGEAGTAAPAP 63

Query: 45  QPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
             +    +  A     RA+AL+ SPR  +  P +IGS+ LKG + DDL+L+ Y   V  N
Sbjct: 64  GTSAPAPAGTAPKALTRAEALARSPRAVIDTPRVIGSVALKGGRIDDLSLKDYRETVDPN 123

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWNLISGKILTPTTPIKLVFKNA 163
           SPI+ LLSPS   N ++AE  +V  A  ++++PN+ T+W    G  LT   P+ L + N 
Sbjct: 124 SPIIVLLSPSGGPNPFYAEFGWVPGAGASVQVPNAETLWTAPEGAKLTHEAPLVLSWDNG 183

Query: 164 NNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAV 223
             ++F RT+S+D +Y+F +VD V N +   +   P G + RH        + + EG I V
Sbjct: 184 AGLIFRRTLSIDANYMFHVVDEVENTTAAPVALHPYGLVSRHGTPHVLGYYILHEGLIGV 243

Query: 224 LGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
             +  L E KY DI +     F     WLGI+DKYWA+  IP  +    ++F     G+ 
Sbjct: 244 TSEAGLHEIKYKDIAERKTETFPSVGGWLGITDKYWAATVIPGIQEKVQARFSAAQAGND 303

Query: 284 -RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFI 342
             YQ  F  + +++ PG   +T   LFAGAKE   +  Y+    I RF++LIDWGWFYFI
Sbjct: 304 FSYQTDFLGDAVSVAPGAKASTEGRLFAGAKEVRVVDGYQSTYNIDRFDLLIDWGWFYFI 363

Query: 343 AKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREK 402
            KP+F+++ + Y  VGNFG+AI++ TV +K++FFPLA K Y S A MK +QP+I  LRE+
Sbjct: 364 TKPLFLVIDWIYKGVGNFGVAILIVTVMLKIVFFPLANKSYASMAKMKAVQPEITALRER 423

Query: 403 FKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWI 462
           +     + LQ+ M+++YK   INP+AGC PI++QIPVFFA+YKV+ +++EMRHAPF+GWI
Sbjct: 424 YGDDRVK-LQQEMMEIYKKEKINPVAGCLPIVIQIPVFFALYKVLFVTIEMRHAPFFGWI 482

Query: 463 KDLAAADPTNIFTLFGILPFYLPG-------FMHVGIWPIIMSLSMFIQMKMSPPPADKG 515
           KDL+A DPT IF LFG++P + PG       F+ +G+WPIIM ++M+ QMK++P P D  
Sbjct: 483 KDLSAPDPTTIFNLFGLIP-WDPGQVPVIGHFLLLGVWPIIMGITMWAQMKLNPAPPDPT 541

Query: 516 QAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFS 575
           Q  I +WMP++F F L SF +GL+IYW+W+N +S++QQ++IM+ +G +I L D ++  F 
Sbjct: 542 QKAIFDWMPLIFTFMLGSFASGLVIYWAWNNTLSVIQQSIIMRRNGVKIELWDNVKELFG 601

Query: 576 KN 577
           + 
Sbjct: 602 RK 603


>gi|158425677|ref|YP_001526969.1| putative inner membrane protein translocase component YidC
           [Azorhizobium caulinodans ORS 571]
 gi|158332566|dbj|BAF90051.1| 60 kDa inner membrane protein [Azorhizobium caulinodans ORS 571]
          Length = 607

 Score =  498 bits (1282), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 247/607 (40%), Positives = 367/607 (60%), Gaps = 27/607 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQT-----VKQPNQV------ 49
           M  N N F+AI LS++I+  WQ F   P+ E+    +   Q         P+        
Sbjct: 1   MTDNRNMFIAIGLSLVILIGWQYFIALPQAEKQRQIQAQQQAAQATQTPSPSAEAAQGGG 60

Query: 50  -------DNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVS 102
                      A   +  RAQAL+ +PRV ++ PSL GSI+L+GA+ DDL L  +   V 
Sbjct: 61  AAPTAPGSTGVAGSRVMTRAQALAATPRVAIETPSLRGSISLRGARADDLTLSQFRETVD 120

Query: 103 SNSPIVTLLSPSNTKNAYFAELDY-VSTANNIELPNSNTVWNLISGKILTPTTPIKLVFK 161
             SP + LLSPS +   ++AE  + V+   N+ +P  +T+W   +G  LTP TP+ L + 
Sbjct: 121 PKSPNIVLLSPSGSPEPFYAEFGWTVAPGANLPVPGPDTLWTAEAGAKLTPATPLVLTWD 180

Query: 162 NANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFI 221
           N   +LF RT ++D+ Y+F + D V N           G + RH        + + EG I
Sbjct: 181 NGQGLLFRRTFTVDDRYMFTVKDEVENKGAAAATLYSYGLVSRHGMPHTQGYYILHEGLI 240

Query: 222 AVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDG 281
            V+GD  L E  Y+ ++ +       +  WLGI+DKYWA+  IP ++    S+F   +  
Sbjct: 241 GVMGDHGLQEVTYAKMDDAKPLAMKATGGWLGITDKYWAATVIPDQKAQVDSRFSSSTVA 300

Query: 282 HAR-YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
             R +QA +  +  +I PG SI + + LFAGAKE   +  YE+   I RF++LIDWGWFY
Sbjct: 301 GTRTFQADYLGSAQSIAPGASIASQSRLFAGAKEVAVVDGYERQYGIDRFDLLIDWGWFY 360

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           FI KP+F+++ + Y LVGNFG+AI++ TV +K +FFPLA K Y S A MK +QP++  +R
Sbjct: 361 FITKPLFLVIDWIYKLVGNFGVAILIVTVLLKGIFFPLANKSYASMAKMKALQPEMMAIR 420

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E++     +  Q+A ++LYK   INP+AGC PIL+QIPVFFA+YKV+ +++EMR APF+G
Sbjct: 421 ERYADDKVK-QQQATMELYKKEKINPVAGCLPILIQIPVFFALYKVLFVTIEMRQAPFFG 479

Query: 461 WIKDLAAADPTNIFTLFGILPF------YLPGFMHVGIWPIIMSLSMFIQMKMSPPPADK 514
           WI DL+A DPT +F LFG++P+       L  ++ +G WP+IM ++M++QMK++P P D 
Sbjct: 480 WIHDLSAPDPTTVFNLFGLIPWDPSVVPVLGPYLMLGAWPLIMGVTMWVQMKLNPAPPDP 539

Query: 515 GQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTF 574
            QAMI N+MP++F F L+ F AGL+IYW+W+N +S++QQAVIM+ +G +I L D +  TF
Sbjct: 540 TQAMIFNYMPIIFTFMLAHFAAGLVIYWAWNNTLSVLQQAVIMRRNGVKIELWDNITRTF 599

Query: 575 SKNYNSQ 581
           SK   ++
Sbjct: 600 SKKKTAK 606


>gi|154250755|ref|YP_001411579.1| 60 kDa inner membrane insertion protein [Parvibaculum
           lavamentivorans DS-1]
 gi|154154705|gb|ABS61922.1| 60 kDa inner membrane insertion protein [Parvibaculum
           lavamentivorans DS-1]
          Length = 609

 Score =  494 bits (1272), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 253/610 (41%), Positives = 369/610 (60%), Gaps = 38/610 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQ------------------- 41
           M  N N+ +AI LSV++   WQ F++ P++E     ++ +                    
Sbjct: 1   MGDNRNFIIAIFLSVLVFIGWQYFFIEPQMEAERARQEQLAADNGTAEPAPGAAPSAPGD 60

Query: 42  ----TVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGY 97
               +V  P       AA     R +AL+ S RV + +  L GS++L+GA+FDDL L  Y
Sbjct: 61  ARLPSVDAPATRAPGVAASGAVARDEALAQSARVPILSEELQGSVSLRGARFDDLKLLKY 120

Query: 98  HLDVSSNSPIVTLLSPSNTKNAYFAELDYVST-ANNIELPNSNTVWNLISGKILTPTTPI 156
           ++ V   SP V L SP  T+  YF+E  +++    NI LP S T W L +G  LTP TP+
Sbjct: 121 NVTVDPESPEVELFSPVRTERPYFSEFGFIAAPGANINLPTSATEWELEAGDRLTPQTPV 180

Query: 157 KLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGV 216
            L + N   ++F R I+LDEH+LF + D + N S +++   P G I R      ++ F +
Sbjct: 181 TLRWDNGQGLVFHREIALDEHFLFTVTDRIENLSANEVTLYPYGLISRTGRPAGSSFFIL 240

Query: 217 QEGFIA---VLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHS 273
            EGFI     +G+K++    Y D E+       ++  WLGI+DKYWA+  +P    +F +
Sbjct: 241 HEGFIGEFPSVGEKAIT---YDDAEEDDPVQVTDTEGWLGITDKYWAAALVPQSGLNFVA 297

Query: 274 QFKYLSD-GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEM 332
            F    D     YQA F     T+  G SIT  N LFAGAK    I  Y +D  I +F +
Sbjct: 298 NFSEHPDPAIVNYQADFRYGAQTVPAGGSITLNNRLFAGAKVSTVIDSY-RDAGIYKFSL 356

Query: 333 LIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNI 392
           LIDWGWF+F+ +PMF  + +    VGNFGIAI++ TV +KL+F+PLA K YV+ + MK +
Sbjct: 357 LIDWGWFWFLTQPMFDALHFIALHVGNFGIAILVITVLIKLVFYPLANKSYVAMSKMKKL 416

Query: 393 QPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLE 452
           QP++++LRE++K    +  Q+ +++LYK   +NPLAGC P+L+QIPVFFA+YKV+ +++E
Sbjct: 417 QPEMEKLRERYKDDKLK-QQQEIMELYKKEKVNPLAGCLPVLIQIPVFFALYKVLFVTIE 475

Query: 453 MRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPA 512
           MRHAPF+GWI DL+A DPT+IF LFG++P+  P  + +GIWP+IM  +MF+Q +M+P PA
Sbjct: 476 MRHAPFFGWINDLSAPDPTSIFNLFGLIPWDPPSMLMIGIWPLIMGFTMFVQQRMNPLPA 535

Query: 513 DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGL-----I 567
           D  QA I  WMPV+F F L+SFPAGL+IYW+W+N +S++QQ VIMK  G +I +     +
Sbjct: 536 DPIQAQIFTWMPVIFTFMLASFPAGLVIYWAWNNTLSVIQQGVIMKRQGVKIEIFSNLGL 595

Query: 568 DRLRSTFSKN 577
           ++L   FS N
Sbjct: 596 EKLAGVFSGN 605


>gi|319406774|emb|CBI80407.1| translocase precursor subunit [Bartonella sp. 1-1C]
          Length = 612

 Score =  493 bits (1270), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 264/607 (43%), Positives = 375/607 (61%), Gaps = 32/607 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQ---VDNSYAA-- 55
           ME N N+F+AI LS ++  AW   Y+ P+  ++   +   Q +   N     ++ Y +  
Sbjct: 1   MEYNRNFFIAIGLSFVVFVAWHFLYIVPQQAKLQESKITTQKLSNHNAALPTNDPYFSHN 60

Query: 56  VLIDD-------------RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVS 102
              DD             R   L+ + RV +K   L GSINL G +FDDL L+ Y L V 
Sbjct: 61  ASTDDTVPVANRPITPEVRKAELAKTNRVLIKTNELEGSINLVGGKFDDLLLKKYRLKVD 120

Query: 103 SNSPIVTLLSPSNTKNAYFAELDYVSTANNIE-LPNSNTVWNLIS-GKILTPTTPIKLVF 160
             SP + LL+P+     YFAE  + S++   + LP SNT W L      LTP+TPI LV+
Sbjct: 121 KKSPEIILLNPNGLPTTYFAEFGFTSSSLPAQALPQSNTKWQLEGDNTTLTPSTPITLVY 180

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEG 219
            N    +F RT S+DEHY+F I D+++N S   +  S   RI R  P   TN T+ + EG
Sbjct: 181 NNGQGQIFHRTFSVDEHYMFTIKDSISNESSSPVYLSSYARIARAAPPEDTNATYLLHEG 240

Query: 220 FIAVLGDKSLVEQKYSDIEKSSIS--NFHES-------NSWLGISDKYWASVFIPSKETS 270
            I + GD SL  +KY+ + + S +  N  +S         W+GI+DKYWA   IP ++T 
Sbjct: 241 MIGIAGD-SLKTEKYTALAELSPNPQNGQKSVIFPNITRGWIGITDKYWAVAVIPPQDTE 299

Query: 271 FHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRF 330
           + S+F Y    +  YQ+   +  +T+ P ++ T TN LFAGAK    I+HY+  L I +F
Sbjct: 300 YTSRFVYFDRLNTHYQSDLQSALLTVPPHETKTITNRLFAGAKRVEIINHYQNQLKINKF 359

Query: 331 EMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMK 390
            +LIDWGWF FI KPMF L+   Y    NFG+AI+L TV +K+L FPLA K Y S A +K
Sbjct: 360 SLLIDWGWFDFITKPMFALIDILYKYTENFGVAILLITVLLKILLFPLAHKSYKSIARLK 419

Query: 391 NIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISIS 450
            IQP + E++EK+     +  Q+A+I+LYKT  INP AGCWPIL+Q P+FFA+YKV+ I+
Sbjct: 420 VIQPMMLEIKEKYADDRNKQ-QQAIIELYKTKKINPFAGCWPILIQFPIFFALYKVLYIT 478

Query: 451 LEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPP 510
           +EMRHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G WP+IM ++MF+QM+M+P 
Sbjct: 479 IEMRHAPFFGWIQDLAAPDPTSIFNLFGLLPYAVPTFLILGAWPLIMGITMFLQMQMNPL 538

Query: 511 PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL 570
           P D  Q ++  WMP++F   L+SFPAGL+IYW+W+N++SI+QQ++IMK  G +I   D L
Sbjct: 539 PQDPTQVVVFRWMPIIFTIMLASFPAGLVIYWAWNNILSIIQQSIIMKCQGVKIEFFDNL 598

Query: 571 RSTFSKN 577
           ++   K+
Sbjct: 599 KAIVQKD 605


>gi|319403768|emb|CBI77352.1| translocase precursor subunit [Bartonella rochalimae ATCC BAA-1498]
          Length = 612

 Score =  493 bits (1268), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 264/613 (43%), Positives = 375/613 (61%), Gaps = 44/613 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           ME N N+F+AI LS ++  AW   Y+ P+  ++   +   Q      ++ N  AA+  +D
Sbjct: 1   MEYNRNFFIAIGLSFVVFVAWHFLYIVPQQAKLQESKITTQ------KLSNHNAALPTND 54

Query: 61  ------------------------RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRG 96
                                   R   L+ + RV +K   L GSINL G +FDDL L+ 
Sbjct: 55  PYFSHNASTNDTVPVANRPITPEIRKAELAKTNRVLIKTNELEGSINLVGGKFDDLLLKK 114

Query: 97  YHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIE-LPNSNTVWNLIS-GKILTPTT 154
           Y L V   SP + LL+P+     YFAE  + S++   + LP SNT W L      LTP+T
Sbjct: 115 YRLKVDKKSPEIILLNPNGLPTTYFAEFGFTSSSLPAQALPQSNTKWQLEGDNTTLTPST 174

Query: 155 PIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-T 213
           PI LV+ N    +F RT S+DEHY+F I D+++N S   +  S   RI R  P   TN T
Sbjct: 175 PITLVYNNGQGQIFHRTFSVDEHYMFTIKDSISNESNSPVYLSSYARIARAAPPEDTNAT 234

Query: 214 FGVQEGFIAVLGDKSLVEQKYSDIEKSSIS--NFHES-------NSWLGISDKYWASVFI 264
           + + EG I + GD SL  +KY+ + + S +  N  +S         W+GI+DKYWA   I
Sbjct: 235 YLLHEGMIGIAGD-SLKTEKYTALAELSPNPQNGQKSVIFPNITRGWIGITDKYWAVAVI 293

Query: 265 PSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKD 324
           P ++T + S+F Y    +  YQ+   +  +T+ P ++ T TN LFAGAK    I+HY+  
Sbjct: 294 PPQDTEYTSRFVYFDRLNTHYQSDLQSALLTVPPHETKTITNRLFAGAKRVEIINHYQNQ 353

Query: 325 LAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYV 384
           L I +F +LIDWGWF FI KPMF L+   Y    NFG+AI+L TV +K+L FPLA K Y 
Sbjct: 354 LKINKFSLLIDWGWFDFITKPMFALIDILYKYTENFGVAILLITVLLKILLFPLAHKSYK 413

Query: 385 STANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIY 444
           S A +K IQP + E++EK+     +  Q+A+I+LYKT  INP AGCWPIL+Q P+FFA+Y
Sbjct: 414 SIARLKLIQPMMLEIKEKYADDRNKQ-QQAIIELYKTKKINPFAGCWPILIQFPIFFALY 472

Query: 445 KVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQ 504
           KV+ I++EMRHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G WP+IM ++MF+Q
Sbjct: 473 KVLYITIEMRHAPFFGWIQDLAAPDPTSIFNLFGLLPYAVPTFLILGAWPLIMGITMFLQ 532

Query: 505 MKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEI 564
           M+M+P P D  Q ++  WMP++F   L+SFPAGL+IYW+W+N++SI+QQ++IMK  G +I
Sbjct: 533 MQMNPLPQDPTQVIVFRWMPIIFTIMLASFPAGLVIYWAWNNILSIIQQSIIMKCQGVKI 592

Query: 565 GLIDRLRSTFSKN 577
              D L++   K+
Sbjct: 593 EFFDNLKAIVQKD 605


>gi|90422337|ref|YP_530707.1| putative inner membrane protein translocase component YidC
           [Rhodopseudomonas palustris BisB18]
 gi|90104351|gb|ABD86388.1| protein translocase subunit yidC [Rhodopseudomonas palustris
           BisB18]
          Length = 632

 Score =  491 bits (1264), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 252/626 (40%), Positives = 371/626 (59%), Gaps = 52/626 (8%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIE-----EMNNERKNIQTVK----------- 44
           M  N N  +A+ LS +++  WQ F+  P++E     E+ ++ + +   +           
Sbjct: 1   MTDNRNTILAVILSGLVLLGWQYFFNIPQMEKQRAAELASKSQAVNPAQPQGAQPATPAA 60

Query: 45  -----------------QPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGA 87
                             PN +    A   +  R  AL+ SPRV++  P L GSI LKGA
Sbjct: 61  PGAAIPQPNAATAPAGSAPNAI-QPQANTPVVSREAALAASPRVKIDTPRLSGSIALKGA 119

Query: 88  QFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWNLIS 146
           + DD+ L  +   V   SP + L SPS + N Y+AE  +V+ A  ++++P+ NT W    
Sbjct: 120 RIDDIALVQFRETVDPKSPAIELFSPSGSANPYYAEFGWVAAAGTSVKIPDQNTQWEQDG 179

Query: 147 GKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHK 206
              LTP  P+ L + N   + F RTI++DE YLF + D VTN     +   P   I RH 
Sbjct: 180 TGSLTPNHPVTLKYDNGEGLTFRRTITIDERYLFTMKDEVTNVGNAPVTLYPFALISRHG 239

Query: 207 PQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPS 266
                  + + EG +  LG++ L E  YS I+++   NF  +N WLGI+DKYWA+  +P 
Sbjct: 240 TPHVAGYYILHEGLVGYLGEQGLQEYGYSKIDEAKAVNFKVTNGWLGITDKYWAAALLPD 299

Query: 267 KETSFHSQFKY-LSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKE-------FPTI 318
                 ++F   L++    YQ  +  +  TI  G + T    LFAGAKE       FP +
Sbjct: 300 TSAQLQARFSSNLANNVRTYQTDYLQDAQTIAIGGTGTANARLFAGAKEAGTVGINFPAL 359

Query: 319 H--HYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFF 376
               Y KDL +  F++LIDWGWFYFI KPMF+ + +F++LVGNFGIAI+L TV +KLLF 
Sbjct: 360 GLGGYNKDLGLNHFDLLIDWGWFYFITKPMFVALDFFFHLVGNFGIAILLVTVIIKLLFL 419

Query: 377 PLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQ 436
           PLA K Y S A MK IQP++  L+E+      +  Q+ M+++Y+   INP+AGC P+LLQ
Sbjct: 420 PLANKSYASMAKMKAIQPQLAALKERHPDDKAK-QQQEMMEIYRKEKINPVAGCLPVLLQ 478

Query: 437 IPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL---PFYLPGFMH---V 490
           IPVFF++YKV+ +++EMRHAPF+GWI DL+A DPTN+F LFG+L   P ++P   H   +
Sbjct: 479 IPVFFSLYKVLFVTIEMRHAPFYGWIHDLSAPDPTNLFNLFGLLAFDPTHVPVIGHYLVL 538

Query: 491 GIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISI 550
           G WPI+M ++M++QMK++P P D  Q MI  WMP++F F L+SFPAGL+IYW+W+N++S+
Sbjct: 539 GAWPIVMGITMWVQMKLNPTPPDPTQQMIFAWMPLIFTFMLASFPAGLVIYWAWNNLLSV 598

Query: 551 VQQAVIMKMHGAEIGLIDRLRSTFSK 576
           VQQ  IM+ +G ++ L D L+++F++
Sbjct: 599 VQQGYIMRRNGVKVELFDNLKASFAR 624


>gi|154245865|ref|YP_001416823.1| putative inner membrane protein translocase component YidC
           [Xanthobacter autotrophicus Py2]
 gi|154159950|gb|ABS67166.1| 60 kDa inner membrane insertion protein [Xanthobacter autotrophicus
           Py2]
          Length = 616

 Score =  490 bits (1262), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 244/614 (39%), Positives = 355/614 (57%), Gaps = 40/614 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMN---------------------NERKN 39
           M  N N F+AI LS+ I+  WQ F+  P+ E                             
Sbjct: 1   MSDNRNMFIAIGLSLAILIGWQFFFGIPQAERQRQAAEQQRIAQQAQQPAPGATPGATPG 60

Query: 40  IQTVKQPNQVDNSYAAVLIDD--------RAQALSMSPRVELKNPSLIGSINLKGAQFDD 91
                 P     S                R +AL+++PR  ++   L GSI LKG + DD
Sbjct: 61  TTAGAAPGATPGSAGVPQAGSPVPARPLTREEALALTPRAAIETQRLKGSIALKGGRVDD 120

Query: 92  LNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWNLISGKIL 150
           L L  YH  V   SP + LLSPS   N ++AE  + + A   +++P  +TVW   +   L
Sbjct: 121 LLLTEYHETVDPKSPNIVLLSPSGAPNPFYAEFGWTAAAGTGVKVPGPDTVWT--TSGTL 178

Query: 151 TPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTA 210
           T  TP+ L + N   ++F RT ++D+HY+F + D V N +   +   P   + RH     
Sbjct: 179 TEKTPLTLSWDNGAGLIFHRTYTIDDHYMFAVKDEVENKTGAAVTLYPYALVSRHGIPHV 238

Query: 211 TNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETS 270
              + + EG I VLGD  L E  Y+ ++K     F  +  WLGI+DKYWA+  IP +   
Sbjct: 239 AGFYILHEGLIGVLGDSGLQEITYAKMDKEKPHTFAATGGWLGITDKYWAATVIPDQSVK 298

Query: 271 FHSQFKYLS-DGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPR 329
             ++F   +  G   +QA + A  +T+ PG ++     LFAGAK    +  Y+    I R
Sbjct: 299 VDAKFSTSTFAGTQTFQADYLAAPLTVEPGATVAAKGQLFAGAKVVQVVDGYKTKYGIDR 358

Query: 330 FEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANM 389
           F++LIDWGWFYFI KP+F+ + + Y LVGNFG+AI++ TV +K LFFPLA K Y S A M
Sbjct: 359 FDLLIDWGWFYFITKPLFLAIDWLYRLVGNFGVAILIITVALKGLFFPLANKSYASMAKM 418

Query: 390 KNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISI 449
           K +QP++  +RE++     +  Q+A+++LYK   INP+AGC PI++QIPVFFA+YKV+ +
Sbjct: 419 KAVQPEVTAIRERYADDKVK-QQQALMELYKKEKINPVAGCLPIVIQIPVFFALYKVLFV 477

Query: 450 SLEMRHAPFWGWIKDLAAADPTNIFTLFGILPF------YLPGFMHVGIWPIIMSLSMFI 503
           ++EMRHAPF+GWI+DL+A DPT IF LFG++P+       L G++ +G WPIIM ++M++
Sbjct: 478 TIEMRHAPFFGWIRDLSAPDPTTIFNLFGLIPWDPSSVPVLGGYLMLGAWPIIMGITMWV 537

Query: 504 QMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           QMK++P P D  Q MI NWMP++F F L+ F AGL+IYW+W+N +S+ QQA+IMK +G +
Sbjct: 538 QMKLNPAPPDPTQQMIFNWMPIIFTFMLAHFAAGLVIYWAWNNTLSVSQQAMIMKRNGVK 597

Query: 564 IGLIDRLRSTFSKN 577
           I L D ++S F K 
Sbjct: 598 IELWDNIKSAFKKK 611


>gi|27383209|ref|NP_774738.1| inner membrane protein translocase component YidC [Bradyrhizobium
           japonicum USDA 110]
 gi|38502983|sp|Q89BQ0|OXAA_BRAJA RecName: Full=Inner membrane protein oxaA
 gi|27356383|dbj|BAC53363.1| blr8098 [Bradyrhizobium japonicum USDA 110]
          Length = 616

 Score =  490 bits (1262), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 253/615 (41%), Positives = 367/615 (59%), Gaps = 42/615 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVK---------------- 44
           M  N N  +A+ LS +++ AWQ FY  P +E+   +++    ++                
Sbjct: 2   MTDNRNTILAVILSGLVLIAWQYFYNVPAMEKQRAQQQAQAELQKTTPQPTASATPGATP 61

Query: 45  ------QPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYH 98
                 QP+       A  +  R  A++ SPRV++  P + GSI+LKG + DD+ L  Y 
Sbjct: 62  QSGGAAQPSTPAAGQQAQPVVARDAAIAASPRVKIDTPRIAGSISLKGGRIDDVALVQYR 121

Query: 99  LDVSSNSPIVTLLSPSNTKNAYFAELDYV-STANNIELPNSNTVWNLISGKILTPTTPIK 157
             V   SP + L SPS T   Y+AE  +V +T    +LP++ T+W       LTPTTP  
Sbjct: 122 ETVDPKSPPIVLYSPSGTAEPYYAEFGWVPATGVTAKLPDAQTLWQQDGSGSLTPTTPAV 181

Query: 158 LVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQ 217
           L + N   + F RTIS+D+HYLF I D V+N     +   P   I RH     +  + + 
Sbjct: 182 LKWDNGEGLTFRRTISVDDHYLFTIKDEVSNVGNAPVTLYPFALISRHGTPQVSGYYILH 241

Query: 218 EGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKY 277
           EG I  L    L E  Y  I+++   NF  +N WLG++DKYWAS  +P       ++F  
Sbjct: 242 EGLIGYL--DGLQEYAYKKIDEAKSVNFKATNGWLGMTDKYWASALLPDTSAQLQARFSS 299

Query: 278 LSDGHAR-YQAKFSANEITILPGKSITTTNFLFAGAKE-------FPTIHH--YEKDLAI 327
              G+   YQ  +  + +T+  G S T    LFAGAKE       FP   H  Y K+L +
Sbjct: 300 NPVGNVHTYQTDYLLDPVTVAIGGSATANARLFAGAKEAGVVGINFPLAGHGGYNKELNL 359

Query: 328 PRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTA 387
             F++LIDWGWFYFI KPMF+ + +FY   GNFGI+I+L TV VKLLFFPLA K Y S A
Sbjct: 360 NHFDLLIDWGWFYFITKPMFLGLDFFYRFFGNFGISILLVTVIVKLLFFPLANKSYASMA 419

Query: 388 NMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVI 447
            MK+IQP++  L+E++     +  Q+ M+++Y+   INP+AGC P+++QIPVFF++YKV+
Sbjct: 420 KMKSIQPQLQALKERYPDDKVK-QQQEMMEIYRKEKINPVAGCLPVVIQIPVFFSLYKVL 478

Query: 448 SISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPF---YLPGFMH---VGIWPIIMSLSM 501
            +++EMR APF+GWIKDL+A DPTN+F LFG++P     +P F H   +GIWPIIM ++M
Sbjct: 479 FVTIEMRQAPFYGWIKDLSAPDPTNLFNLFGLIPLDPTTIPVFGHYLALGIWPIIMGITM 538

Query: 502 FIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHG 561
           + QMK++P P D  Q MI NWMP++F F L+ FPAGL+IYW+W+N +S++QQ+ IM+ +G
Sbjct: 539 WFQMKLNPTPPDPTQQMIFNWMPLIFTFMLAGFPAGLVIYWAWNNTLSVLQQSFIMRRNG 598

Query: 562 AEIGLIDRLRSTFSK 576
            ++ L D L++TF++
Sbjct: 599 VKVELFDNLKATFAR 613


>gi|323137577|ref|ZP_08072654.1| membrane protein insertase, YidC/Oxa1 family [Methylocystis sp.
           ATCC 49242]
 gi|322397203|gb|EFX99727.1| membrane protein insertase, YidC/Oxa1 family [Methylocystis sp.
           ATCC 49242]
          Length = 591

 Score =  490 bits (1261), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 249/595 (41%), Positives = 364/595 (61%), Gaps = 27/595 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDN--------SY 53
           E   N  +A ALS+I +  W  FY +P   EM+ ++K +   ++  ++          + 
Sbjct: 3   ENTKNMLLAAALSLIFIGLWDYFYAFP---EMDKQKKALSEQERMAKIPKLGAPEKAAAA 59

Query: 54  AAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSP 113
           A  ++  R  AL++SPRV +   S+ GSI LKGA+ DD++L+ YH  V   SPI+TLLSP
Sbjct: 60  AKPVVRSREAALALSPRVAIDTKSISGSIALKGARVDDVSLKNYHQTVDPRSPIITLLSP 119

Query: 114 SNTKNAYFAELDYVS--TANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERT 171
                 Y+AEL Y+S  T N   LPN+ T+W   + K LT + P+ L + N   ++F+R 
Sbjct: 120 EEGPEPYYAELGYLSAETENAPVLPNTETLWTADADK-LTTSQPVTLSWDNGQGLVFKRV 178

Query: 172 ISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVE 231
           IS+D+ YL  + D+V N     +      R+ R     +     + EGF+ V+GD    E
Sbjct: 179 ISIDDEYLLTVKDSVENKGGKPVTLYSYSRVSRVGHPPSAGYAALHEGFVGVIGDTGQ-E 237

Query: 232 QKYSDIEK--SSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR-YQAK 288
             Y  IEK  ++   F     W+G +DKYW +V  P +     +++  +  G  + YQA 
Sbjct: 238 LTYDKIEKEPNATKTFKGVGGWVGFTDKYWGAVVAPDQNAPMEARYMLMGGGPVKTYQAD 297

Query: 289 FSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFM 348
             +   T+ P  S  TT ++FAGAKE  T+  Y+ +  + RF++LIDWGWFYFI +PMF 
Sbjct: 298 TVSEPKTLEPNASTATTTYVFAGAKEVDTLDAYKANPGLKRFDLLIDWGWFYFITRPMFR 357

Query: 349 LMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPP 408
           L+ + Y ++GNFG+AI+  TV VK  F PLA K Y S A MK IQPKI EL+EK+     
Sbjct: 358 LIDFLYRVLGNFGLAILAVTVIVKAAFLPLANKSYKSIAKMKEIQPKIKELKEKYGDDKH 417

Query: 409 QVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAA 468
           +   + M +LYK   +NP +GC P+LLQIPVFF++YKV+ +++EMRHAPF+GWIKDL+A 
Sbjct: 418 KFNMEQM-ELYKREKVNPASGCLPVLLQIPVFFSLYKVLVVTIEMRHAPFFGWIKDLSAP 476

Query: 469 DPTNIFTLFGILPF-------YLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILN 521
           DPTN+F LFG++P+       + P ++ +G+WP++M ++M++QMKM+P P D+ Q  +  
Sbjct: 477 DPTNVFNLFGLIPWDPTHVAIFGP-YLALGVWPLVMGVTMWLQMKMNPEPTDEIQKTMFA 535

Query: 522 WMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSK 576
           WMPV+F F + SF +GLIIYWSW+N++SIVQQ VIMK  G +  L D LR TFS+
Sbjct: 536 WMPVMFTFTMGSFASGLIIYWSWNNLLSIVQQGVIMKRAGVKFELWDNLRKTFSR 590


>gi|319898441|ref|YP_004158534.1| translocase precursor subunit [Bartonella clarridgeiae 73]
 gi|319402405|emb|CBI75946.1| translocase precursor subunit [Bartonella clarridgeiae 73]
          Length = 612

 Score =  489 bits (1260), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 257/611 (42%), Positives = 373/611 (61%), Gaps = 32/611 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQV----DNSYAAV 56
           ME N N+F+AI LS ++  AW   Y+ P+  ++   +     +   N      D  ++  
Sbjct: 1   MEYNRNFFIAIGLSFVVFVAWHFLYIVPQQAKLQESKIIAHKLSNHNSTFPANDMHFSNH 60

Query: 57  LIDD--------------RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVS 102
            + D              R   L+ + RV +K   L GSINL G +FDDL L+ Y L V 
Sbjct: 61  GLKDEIVSITNHHVTPEIRKAELAKTNRVLIKTNELEGSINLVGGKFDDLLLKKYRLTVD 120

Query: 103 SNSPIVTLLSPSNTKNAYFAELDYVSTANNIE-LPNSNTVWNLISGK-ILTPTTPIKLVF 160
             SP + LL+P+     YFAE  ++S++   + LP SNT W +     ILTP+TPI L++
Sbjct: 121 KTSPEIILLNPNGLTTTYFAEFSFISSSLPAKALPQSNTKWQIEGNNTILTPSTPITLIY 180

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEG 219
            N    +F R  S+D HY+F I D+++N S   I  S   RI R  P   TN T+ + EG
Sbjct: 181 NNGQGQIFRRIFSVDNHYMFTIKDSISNESSSPIHLSSYARIARAAPPEDTNATYFLHEG 240

Query: 220 FIAVLGDKSLVEQKYSDIE---------KSSISNFHESNSWLGISDKYWASVFIPSKETS 270
            I + GD SL  +KY+ +          + S+   + +  W+GI+DKYWA   IP ++  
Sbjct: 241 MIGIAGD-SLKTEKYTALAELNPNPKNGQKSVIFSNVTGGWVGITDKYWAVAVIPPQDKE 299

Query: 271 FHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRF 330
           + S+F Y    +  YQ+   +  +T+ P ++ T TN LFAGAK    I+HY+  L I +F
Sbjct: 300 YTSRFVYFDQLNTHYQSDLQSALLTVSPHETKTITNRLFAGAKRVEIINHYQNQLKINKF 359

Query: 331 EMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMK 390
            +LIDWGWF FI KPMF  +   Y   GNFG+ I+L TV +K+L FPLA K Y S A++K
Sbjct: 360 SLLIDWGWFDFITKPMFAFIDILYKYTGNFGVTILLITVLLKILLFPLAHKSYKSMAHIK 419

Query: 391 NIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISIS 450
            IQP + E++EK+     +  Q+A+I+LYKT  INPLAGCWP+L+Q P+FFA+YKV+ I+
Sbjct: 420 LIQPMMLEIKEKYAHDRNKQ-QQAIIELYKTKKINPLAGCWPVLIQFPIFFALYKVLYIT 478

Query: 451 LEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPP 510
           +EMRHAPF+GWIKDLAA DPT+IF LFG+LP+ +P F+ +G WP+IM ++MF+QM+M+P 
Sbjct: 479 IEMRHAPFFGWIKDLAAPDPTSIFNLFGLLPYTVPVFLTLGAWPLIMGITMFLQMQMNPL 538

Query: 511 PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL 570
           P D  Q ++  W+PV+F   L+SFPAGL+IYW+W+N++SI+QQ++IMK  G +I   D L
Sbjct: 539 PQDPTQVIVFRWIPVIFTVMLASFPAGLVIYWAWNNILSIIQQSIIMKCQGVKIEFFDNL 598

Query: 571 RSTFSKNYNSQ 581
           ++   K+   +
Sbjct: 599 KAIVQKDTKKE 609


>gi|148258511|ref|YP_001243096.1| putative inner membrane protein translocase component YidC
           [Bradyrhizobium sp. BTAi1]
 gi|146410684|gb|ABQ39190.1| protein translocase subunit yidC [Bradyrhizobium sp. BTAi1]
          Length = 621

 Score =  489 bits (1260), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 265/620 (42%), Positives = 375/620 (60%), Gaps = 44/620 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNE--------RKNIQTVK-------- 44
           M  N N  +A+ LS +++  WQ FY  P++E+   +        +K    V+        
Sbjct: 1   MTDNRNTILAVILSGLVLILWQVFYNGPQMEKQRAQAQMQAELAKKQAPAVQPEATPSAT 60

Query: 45  -QPNQVDN---------SYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNL 94
            QPN   +         +  A  +  R  A++ +PRV++  P L GSI+LKGA+ DDL  
Sbjct: 61  PQPNAAASGSPSAPGGAATTATGVVARDAAIAATPRVKIDTPRLSGSISLKGARIDDLAF 120

Query: 95  RGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWNLISGKILTPT 153
             Y   V   SP + L SPSNT   Y+AE  +V      +++P+ NTVW       LTPT
Sbjct: 121 VQYRETVDPKSPAIVLFSPSNTAEPYYAEFGWVGAPGAKVQVPDQNTVWQQDGTNALTPT 180

Query: 154 TPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNT 213
           TP+KL   NA+ + F+RTIS+DEHYLF I D VTN     +   P G I RH     +  
Sbjct: 181 TPVKLSTTNADGLTFKRTISVDEHYLFTIKDEVTNAGSAPVTLYPFGLISRHGTPHVSGY 240

Query: 214 FGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHS 273
           + + EG I  LG+K L E  Y  ++    + F  +N WLGI+DKYWA+  +P  +    +
Sbjct: 241 YILHEGLIGYLGEKGLQEYTYKKMDDDKAAKFDVTNGWLGITDKYWATALLPMTDARLTA 300

Query: 274 QF-KYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKE-------FP--TIHHYEK 323
            +   L D   RYQ  +     T+  G + + +  LFAGAKE       FP   +  Y +
Sbjct: 301 NYSSKLVDNQHRYQTDYVETPQTVPAGGAASVSTRLFAGAKEAGVVGINFPIGGLGGYNQ 360

Query: 324 DLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQY 383
            L +  F++LIDWGWFYF+ KPMF+ + +F+   GNFGI+I+L TV VKLLFFPLA K Y
Sbjct: 361 QLGLNHFDLLIDWGWFYFLTKPMFLALDFFFRFFGNFGISILLVTVLVKLLFFPLANKSY 420

Query: 384 VSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAI 443
            S A MK IQP++  L+E++     +  Q+ M+++YK   INP+AGC P++LQIPVFF++
Sbjct: 421 ASMAKMKAIQPQLQALKERYPDDRMK-QQQEMMEIYKKEKINPVAGCLPVVLQIPVFFSL 479

Query: 444 YKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPF---YLPGFMH---VGIWPIIM 497
           YKV+ +++EMRHAPF+GWIKDL+A DPTN+FTLFG++PF    LP F H   +GIWPIIM
Sbjct: 480 YKVLFVTIEMRHAPFYGWIKDLSAPDPTNLFTLFGLIPFDPTQLPLFGHYLALGIWPIIM 539

Query: 498 SLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIM 557
            ++M++QMK++P P D  QAMI NWMP++F F L+ FPAGL+IYW+W+N +S++QQ  IM
Sbjct: 540 GITMWVQMKLNPAPPDPTQAMIFNWMPIIFTFMLAGFPAGLVIYWAWNNTLSVLQQGFIM 599

Query: 558 KMHGAEIGLIDRLRSTFSKN 577
           + +G ++ L D +R TF K 
Sbjct: 600 RRNGVKVELFDNIRGTFKKK 619


>gi|115522671|ref|YP_779582.1| putative inner membrane protein translocase component YidC
           [Rhodopseudomonas palustris BisA53]
 gi|115516618|gb|ABJ04602.1| protein translocase subunit yidC [Rhodopseudomonas palustris
           BisA53]
          Length = 626

 Score =  488 bits (1256), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 247/616 (40%), Positives = 365/616 (59%), Gaps = 47/616 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEM--------NNERKNIQTVKQPNQVDNS 52
           M  N N  +A+ LS +++  WQ F+  P++E+         +     +Q   QPN    +
Sbjct: 1   MTDNRNTILAVILSGLVLLGWQYFFNIPQMEKQRAAEMAARSQATSQVQPTAQPNAQPGA 60

Query: 53  YAA----------------------VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFD 90
             A                           R  AL+ SPRV+++ P L GSI+LKGA+ D
Sbjct: 61  SGAQPGVPAPQAGTPTPNAAAPAAVTPTVSRDAALAASPRVKIETPRLSGSISLKGARLD 120

Query: 91  DLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVST-ANNIELPNSNTVWNLISGKI 149
           D+ L  +   V   SP + L SPS +K+ Y+AE  +V+    N+++P+ NTVW       
Sbjct: 121 DIALVQFRETVDPKSPAIELFSPSGSKHPYYAESGWVAAVGTNVKVPDQNTVWTQEGSNS 180

Query: 150 LTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT 209
           LTPT+P+ L + N   + F RTI++DE YLF + D V+N     +   P   I RH    
Sbjct: 181 LTPTSPVVLRYDNGEGLTFRRTIAVDERYLFTMKDEVSNIGNAPVTLYPFALISRHGAPQ 240

Query: 210 ATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKET 269
               + + EG +  LG++ L E  Y+ I+++   NF  +N WLGI+DKYWAS  +P    
Sbjct: 241 VAGYYILHEGLVGYLGEQGLQEYGYAKIDEAKAVNFKVTNGWLGITDKYWASALLPDTTA 300

Query: 270 SFHSQFKY-LSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKE-------FP-TIHH 320
              ++F   L++    YQ  +  +   +  G + +    LFAGAKE       FP     
Sbjct: 301 QLQARFSSNLANNVRTYQTDYLLDPQVVPIGGTGSANTRLFAGAKEAGVVGIGFPLGFGG 360

Query: 321 YEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAK 380
           Y K L +  F++LIDWGWFYFI KPMF+ + +FY+LVGNFG++I+  TV +KLLF PLA 
Sbjct: 361 YNKQLDLNHFDLLIDWGWFYFITKPMFVALDFFYHLVGNFGLSILFVTVIIKLLFLPLAN 420

Query: 381 KQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVF 440
           K Y S A MK IQP++  L+++      +  Q+ M+++Y+   INP+AGC P+LLQIPVF
Sbjct: 421 KSYASMAKMKAIQPQLQALKDRHPDDKAKQ-QQEMMEIYRKEKINPVAGCLPVLLQIPVF 479

Query: 441 FAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPF------YLPGFMHVGIWP 494
           F++YKV+ +++EMRHAPF+GWI DL+AADPTNIF LFG++P+       L  ++ +GIWP
Sbjct: 480 FSLYKVLFVTIEMRHAPFYGWIHDLSAADPTNIFNLFGLIPYDPTQIPVLGYYLVLGIWP 539

Query: 495 IIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQA 554
           IIM ++M++QMK++P P D  Q MI  WMP++F F L+SFPAGL+IYW+W+N++S++QQ 
Sbjct: 540 IIMGITMWVQMKLNPAPPDPTQQMIFAWMPLLFTFMLASFPAGLVIYWAWNNLLSVIQQG 599

Query: 555 VIMKMHGAEIGLIDRL 570
            IM+ +G ++ L D L
Sbjct: 600 YIMRKNGVKVELFDNL 615


>gi|300024925|ref|YP_003757536.1| membrane protein insertase, YidC/Oxa1 family [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526746|gb|ADJ25215.1| membrane protein insertase, YidC/Oxa1 family [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 624

 Score =  487 bits (1253), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 247/599 (41%), Positives = 362/599 (60%), Gaps = 31/599 (5%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPRIE----------EMNNERKNIQTVKQPNQVDNSYAA 55
           N   A+ALS++++  WQ F+  P ++          ++  + K+  +   PN      A 
Sbjct: 12  NLMFAVALSILVLMGWQYFFARPELQNEHARQEFNKKIEAQNKDGSSETPPNVASTPVAP 71

Query: 56  VLID-------------DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVS 102
              D              R  AL  S R++++ PSL GSI+LKG + DDL L  Y   V 
Sbjct: 72  PSTDAPTGAQAPATAPVSREAALQGSQRLKIETPSLEGSIDLKGGRLDDLVLMKYRETVD 131

Query: 103 SNSPIVTLLSPSNTKNAYFAELDYV-STANNIELPNSNTVWNLISGKILTPTTPIKLVFK 161
            NS  V LLSPS +   YFAE  +V  + + +++P  +++W + SG  LTP TP+ L++ 
Sbjct: 132 PNSARVILLSPSGSPEPYFAEYGWVPQSGSAVKVPTRDSLWTVESGTRLTPETPVTLMWD 191

Query: 162 NANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFI 221
           N   ++F RT+S+D  Y+FKI D + N +  ++   P  R+ R     +   + + EG +
Sbjct: 192 NGGGLVFHRTVSVDNDYMFKIKDEIENKTQAEVTLLPYARVHRSGHPPSQAFYVLHEGLV 251

Query: 222 AVLGDKSLVEQKYSDIEKSSISNFHE--SNSWLGISDKYWASVFIPSKETSFHSQFKYLS 279
            V GD  L E  ++D  KS +    +  +  WLGI+DKYWA+  +P +   + + +  L 
Sbjct: 252 GVSGDHGLQEFTFADALKSGVPTTFDNVTGGWLGITDKYWATALVPEQSEPYRAMYSALK 311

Query: 280 D----GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLID 335
                G   +Q  +    +++  G        LFAGAK+   I  YE  L I RF+ +ID
Sbjct: 312 ARDPAGKDAFQTDYLRGALSVPAGLRKGVEGHLFAGAKQASLIDGYENALGILRFDRMID 371

Query: 336 WGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPK 395
           WGWFYFI +P+F LM +   LV NFGI I++ TV VK  F+PLA KQY S A MK +QP+
Sbjct: 372 WGWFYFITRPLFRLMEFINGLVHNFGITILILTVLVKAAFYPLANKQYESMARMKKLQPE 431

Query: 396 IDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRH 455
           +  ++E++K    Q  QK + +LY+T  INPLAGCWPILLQIPVFFA+YKV+ ++++MRH
Sbjct: 432 MQRIKEQYKDDT-QRQQKEIFELYRTQKINPLAGCWPILLQIPVFFALYKVLFVTIDMRH 490

Query: 456 APFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKG 515
           APF+GWI DL+A DPT++F LFG+LPF  P F+H+G+WP+IM ++M++QM+++PP  D  
Sbjct: 491 APFFGWIHDLSAPDPTSLFNLFGLLPFDSPTFLHIGVWPLIMGVTMWMQMQLNPPQPDPI 550

Query: 516 QAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTF 574
           Q  I  WMPVVF F L+SFPAGL+IYW+WSN +SI+QQ  I K +GAE+ L+D ++ TF
Sbjct: 551 QQQIFQWMPVVFTFMLASFPAGLVIYWAWSNTLSILQQVRINKKNGAEVHLLDNIKRTF 609


>gi|319405206|emb|CBI78811.1| translocase precursor subunit [Bartonella sp. AR 15-3]
          Length = 612

 Score =  484 bits (1245), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 264/606 (43%), Positives = 372/606 (61%), Gaps = 32/606 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQV----DNSYAA- 55
           ME N N+F+AI LS ++  AW   YV P+  ++   +   Q +   N      D  ++  
Sbjct: 1   MEYNRNFFIAIGLSFVVFVAWHFLYVIPQQAKLQESKIIAQKLSNHNAALPTNDMHFSNN 60

Query: 56  VLIDD-------------RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVS 102
            L DD             R   L+ + R+ +K   L GSINL G +FDDL L+ Y L V 
Sbjct: 61  ALTDDTVPVTNRPITPEMRKAELAKTDRILIKTNELEGSINLVGGKFDDLLLKKYRLKVD 120

Query: 103 SNSPIVTLLSPSNTKNAYFAELDYVSTANNIE-LPNSNTVWNLIS-GKILTPTTPIKLVF 160
             SP + LL+PS    AYFAE  + S++   + LP SNT W L     ILTP+TPI LV+
Sbjct: 121 KKSPEIILLNPSGLPTAYFAEFGFTSSSLPAKALPQSNTKWQLEGYNTILTPSTPITLVY 180

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEG 219
            N    +F RT S+D+HY+F I D+++N S   I  S   R+ R  P   TN T+ + EG
Sbjct: 181 NNGQGQIFHRTFSVDDHYMFTIKDSISNESSSPIYISSYARVARTAPPEDTNATYLLHEG 240

Query: 220 FIAVLGDKSLVEQKYSDIE---------KSSISNFHESNSWLGISDKYWASVFIPSKETS 270
            I + G+ SL  +KY+ +          + SI   + +  W+GI+DKYWA   IP ++  
Sbjct: 241 MIGIAGN-SLKTEKYTALAELSPNPQNGQKSIIFPNITGGWIGITDKYWAVAVIPPQDKE 299

Query: 271 FHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRF 330
           + S+F Y    +  YQ+   +  +T+ P ++ T  N  FAGAK    I+HY+  L I +F
Sbjct: 300 YTSRFVYFDRLNTHYQSDLQSALLTVSPHETKTIINRFFAGAKRVEIINHYQNQLKINKF 359

Query: 331 EMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMK 390
            +LIDWGWF FI KPMF L+   Y    NFGIAI+L TV +K+L FPLA K Y S A +K
Sbjct: 360 SLLIDWGWFDFITKPMFTLIDILYKYTENFGIAILLITVLLKILLFPLAHKSYKSMARIK 419

Query: 391 NIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISIS 450
            IQP + E++EK+     +  Q+A+I+LYKT  INP AGCWPIL+Q P+FFA+YKV+ I+
Sbjct: 420 LIQPMMLEIKEKYANDRNKQ-QQAIIELYKTKKINPFAGCWPILVQFPIFFALYKVLYIT 478

Query: 451 LEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPP 510
           +EMRHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G WP+IM ++MF+QM+M+P 
Sbjct: 479 IEMRHAPFFGWIQDLAAPDPTSIFNLFGLLPYAVPTFLILGAWPLIMGITMFLQMQMNPL 538

Query: 511 PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL 570
           P D  Q ++  WMPV+F   L+SFPAGL+IYW+W+N++SI+QQ++IMK  G +I   D L
Sbjct: 539 PQDPTQVIVFRWMPVIFTVMLASFPAGLVIYWAWNNILSIIQQSIIMKCQGVKIEFFDNL 598

Query: 571 RSTFSK 576
           ++   K
Sbjct: 599 KAIVQK 604


>gi|86747809|ref|YP_484305.1| putative inner membrane protein translocase component YidC
           [Rhodopseudomonas palustris HaA2]
 gi|86570837|gb|ABD05394.1| protein translocase subunit yidC [Rhodopseudomonas palustris HaA2]
          Length = 629

 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 230/528 (43%), Positives = 335/528 (63%), Gaps = 18/528 (3%)

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           R  A++ SPR++++ P L G+I+LKGA+ DDL+L      V   SP + L SPS   N Y
Sbjct: 93  REAAIAASPRIKVETPRLDGTISLKGARIDDLSLTQLRETVDPKSPPIHLFSPSGGANPY 152

Query: 121 FAELDYVSTA-NNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYL 179
           +AE  +V  A +N++LP+ NT+W       LTP++PI L + N   + F R I++D+ YL
Sbjct: 153 YAEFGWVGAAGSNVKLPDQNTMWQQQGSGALTPSSPITLTWDNGEGLTFRRQIAVDDRYL 212

Query: 180 FKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEK 239
           F + D VTN     +   P   I RH        + + EG I  LG+  L E  Y+ I++
Sbjct: 213 FTVKDDVTNVGSSPVTLYPYALISRHGTPHVEGYYILHEGLIGYLGEHGLQEYGYAKIDE 272

Query: 240 SSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR-YQAKFSANEITILP 298
           +    F  +N+W+GI+DKYWAS  +P       ++F     G  R YQ  +  +  T+  
Sbjct: 273 AKTVGFKATNAWMGITDKYWASALLPDTNAQLQARFSSNQVGATRTYQTDYLEDAKTVPI 332

Query: 299 GKSITTTNFLFAGAKE---------FPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFML 349
           G ++T    LFAGAKE         F  +  Y + L +  F++LIDWGWFYFI KPMF+ 
Sbjct: 333 GGTVTANARLFAGAKEARVVGINFPFAGLGGYNQQLGLNHFDLLIDWGWFYFITKPMFLA 392

Query: 350 MSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQ 409
           + +F++LVGNFG+AI+L TV +K+LF PLA K Y S A MK IQP++  L+E+      +
Sbjct: 393 LDFFFHLVGNFGVAILLVTVLIKVLFLPLANKSYASMAKMKAIQPQLLALKERHPDDKAK 452

Query: 410 VLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAAD 469
             Q+ M+++Y+   INP+AGC P+LLQIPVFF++YKV+ +++EMRHAPF+GWI DL+AAD
Sbjct: 453 Q-QQEMMEIYRKEKINPVAGCLPVLLQIPVFFSLYKVLFVTIEMRHAPFFGWIHDLSAAD 511

Query: 470 PTNIFTLFGILPF------YLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWM 523
           PTN+F LFG+LPF       L  ++ +G+WP++M  +M+ QMK++P P D  Q MI  WM
Sbjct: 512 PTNLFNLFGLLPFDPTAIPVLGHYLVLGVWPLVMGFTMWFQMKLNPQPPDPTQQMIFAWM 571

Query: 524 PVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLR 571
           PV+F F L+ FPAGL+IYW+W+N++S++QQA IM+ +G ++ L D LR
Sbjct: 572 PVIFTFMLAHFPAGLVIYWAWNNLLSVIQQAYIMRRNGVKVELFDNLR 619


>gi|91974551|ref|YP_567210.1| putative inner membrane protein translocase component YidC
           [Rhodopseudomonas palustris BisB5]
 gi|91681007|gb|ABE37309.1| protein translocase subunit yidC [Rhodopseudomonas palustris BisB5]
          Length = 621

 Score =  482 bits (1240), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 232/533 (43%), Positives = 338/533 (63%), Gaps = 18/533 (3%)

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           R  A++ SPR++++ P L G+++LKGA+ DDL+L  YH  V   S  + L SPS + N Y
Sbjct: 85  RDAAIAASPRIKVETPRLDGTLSLKGARIDDLSLSQYHETVDPKSAPIHLFSPSGSANPY 144

Query: 121 FAELDYVSTA-NNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYL 179
           +AE  +V  A +N++LP+ NT+W       LTP  P+ L + N   + F R I++D+ YL
Sbjct: 145 YAEFGWVGAAGSNVKLPDQNTLWEQEGSGALTPANPVTLKWDNGEGLTFRRQIAVDDRYL 204

Query: 180 FKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEK 239
           F I D VTN     +   P   I RH        + + EG I  LG++ L E  Y+ I++
Sbjct: 205 FTIKDDVTNVGGGPVTLYPFALISRHGTPHVEGFYILHEGLIGYLGEQGLQEYGYAKIDE 264

Query: 240 SSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR-YQAKFSANEITILP 298
           +    F  +N+W+GI+DKYWAS  +P       ++F     G  R YQ  +  +  T+  
Sbjct: 265 AKTVGFKATNAWMGITDKYWASALLPDTNAQLQARFSSNQVGATRTYQTDYLEDAKTVPI 324

Query: 299 GKSITTTNFLFAGAKE---------FPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFML 349
           G + T T  LFAGAKE         F  +  Y + L +  F++LIDWGWFYFI KPMF+ 
Sbjct: 325 GGTATATARLFAGAKEARVVGINFPFAGLGGYNQQLGLNHFDLLIDWGWFYFITKPMFLA 384

Query: 350 MSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQ 409
           + +F++LVGNFG+AI+L TV VKL+F PLA K Y S A MK IQP++  L+E+      +
Sbjct: 385 LDFFFHLVGNFGVAILLVTVLVKLIFLPLANKSYASMAKMKAIQPQLLALKERHPDDKAK 444

Query: 410 VLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAAD 469
             Q+ M+++Y+   INP+AGC P+LLQIPVFF++YKV+ +++EMRHAPF+GWI DL+AAD
Sbjct: 445 Q-QQEMMEIYRKEKINPVAGCLPVLLQIPVFFSLYKVLFVTIEMRHAPFFGWIHDLSAAD 503

Query: 470 PTNIFTLFGILPF---YLP---GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWM 523
           PTN+F LFG++P+    LP    ++ +G+WP++M  +M+ QMK++P P D  Q MI  WM
Sbjct: 504 PTNLFNLFGLIPYDPSTLPVIGSYLVLGVWPLVMGFTMWFQMKLNPQPPDPTQQMIFAWM 563

Query: 524 PVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSK 576
           PV+F F L+ FPAGL+IYW+W+N +S++QQA IM+ +G ++ L D L+S   K
Sbjct: 564 PVIFTFMLAHFPAGLVIYWAWNNTLSVIQQAYIMRRNGVKVELWDNLKSAVVK 616


>gi|316932100|ref|YP_004107082.1| membrane protein insertase [Rhodopseudomonas palustris DX-1]
 gi|315599814|gb|ADU42349.1| membrane protein insertase, YidC/Oxa1 family [Rhodopseudomonas
           palustris DX-1]
          Length = 625

 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 243/615 (39%), Positives = 355/615 (57%), Gaps = 46/615 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTV----------------- 43
           M  N N  +A+ LS +++  WQ F   P++E+    ++  Q                   
Sbjct: 1   MSDNRNTILAVVLSGLVLLGWQYFINIPQMEKQRAAQQAQQAQQQPQTTSPGTAPSGTPS 60

Query: 44  -----------KQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDL 92
                        P+  +   AA     R  AL+ +PR++++   L GSI LKGA+ DDL
Sbjct: 61  ATPAPGTPSAPGAPSPANPQAAATPTVSREAALAATPRIKVETTQLSGSIALKGARIDDL 120

Query: 93  NLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWNLISGKILT 151
            L  Y   V   SP + L SPS +   Y+AE  +V  A  N++LP+ NTVW       LT
Sbjct: 121 ALTQYRETVDPKSPPIELFSPSGSARPYYAEFGWVGAAGANVKLPDHNTVWTQEGSGALT 180

Query: 152 PTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTAT 211
           P  P+ L + N   + F R I++D+ YLF + D VTN     +   P   I RH      
Sbjct: 181 PANPVTLKWDNGEGLTFRRQIAVDDRYLFTVKDDVTNTGAAPVTLYPFALISRHGTPHVE 240

Query: 212 NTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSF 271
             + + EG I  LG+  L E  YS I+++    F  +N WLGI+DKYWAS  +P      
Sbjct: 241 GYYILHEGLIGYLGEHGLQEYSYSKIDEAKSVGFKATNGWLGITDKYWASALLPDNTAQL 300

Query: 272 HSQFKYLSDGH-ARYQAKFSANEITILPGKSITTTNFLFAGAKE---------FPTIHHY 321
            ++F     G+   YQ  +  +  T+  G +++    LFAGAKE         F  +  Y
Sbjct: 301 QARFSANKAGNVTTYQTDYLEDARTVPIGGTVSANARLFAGAKEARVVGINFPFAGLGGY 360

Query: 322 EKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKK 381
           ++ L +  F++LIDWGWFYFI KPMF+ + +F++LVGNFG+AI+L TV +KL+F PLA K
Sbjct: 361 DRQLGLNHFDLLIDWGWFYFITKPMFLALDFFFHLVGNFGVAILLVTVLIKLIFLPLANK 420

Query: 382 QYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFF 441
            Y S A MK IQP++  L+E+      +  Q+ M+++Y+   INP+AGC PILLQIPVFF
Sbjct: 421 SYASMAKMKAIQPQLLALKERHPDDKVKQ-QQEMMEIYRKEKINPVAGCLPILLQIPVFF 479

Query: 442 AIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPF------YLPGFMHVGIWPI 495
           ++YKV+ +++EMRHAPF+GWI DL+AADPTN+F LFG++P+       L  ++ +G WP+
Sbjct: 480 SLYKVLFVTIEMRHAPFFGWIHDLSAADPTNLFNLFGLIPYDPTAIPVLGHYLVLGAWPL 539

Query: 496 IMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAV 555
           +M  +M+ QMK++P P D  Q MI  WMPV+F F L+ FPAGL+IYW+W+N++S++QQA 
Sbjct: 540 VMGFTMWFQMKLNPQPPDPTQQMIFAWMPVIFTFMLAHFPAGLVIYWAWNNLLSVIQQAY 599

Query: 556 IMKMHGAEIGLIDRL 570
           IM+ +G ++ L D L
Sbjct: 600 IMRRNGVKVELFDNL 614


>gi|15603927|ref|NP_220442.1| putative inner membrane protein translocase component YidC
           [Rickettsia prowazekii str. Madrid E]
 gi|38503265|sp|Q9ZE97|OXAA_RICPR RecName: Full=Inner membrane protein oxaA
 gi|3860618|emb|CAA14519.1| 60 KD INNER-MEMBRANE PROTEIN (yidC) [Rickettsia prowazekii]
 gi|292571645|gb|ADE29560.1| Preprotein translocase subunit YidC [Rickettsia prowazekii Rp22]
          Length = 560

 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 251/560 (44%), Positives = 355/560 (63%), Gaps = 11/560 (1%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPN---QVDNSYAAVLIDDRA 62
           N   A+ LS+ I++ WQ F+V P   E   +++ I   K  N   Q   + A    D   
Sbjct: 7   NLIAAVVLSLSIIFGWQYFFVKP---EQKKQQQRIAMHKSENLNKQKLKALAEPASDIAV 63

Query: 63  QALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFA 122
           Q  S   R+++++ SL GSI LKG +FDDL L+ Y  D+S NSP V L SP+NT+NAYFA
Sbjct: 64  QEASQVQRIKIESESLTGSIALKGLRFDDLILKKYKQDLSQNSPAVRLFSPANTENAYFA 123

Query: 123 ELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKI 182
           E+  VS  N+++LPNSNTVWN  S ++L+P  P+ L + N + I F  TI++D++YLF I
Sbjct: 124 EIGLVSNLNSVKLPNSNTVWNSDS-EVLSPEKPVNLFWINEDGIKFLVTITVDKNYLFTI 182

Query: 183 VDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSI 242
             T+ NNS  ++     G I R           + +G I  + D++L E  Y DI+    
Sbjct: 183 EQTIINNSDKELPVQSYGLINRKYISLEKAVNILHQGPIGCI-DENLKEYSYDDIKDKKS 241

Query: 243 SNFHESN-SWLGISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILPGK 300
           + F  S   W+GI+DKYW S  IP K + + S F Y L  G  RYQ  F +    I PG+
Sbjct: 242 TKFALSKVDWIGITDKYWLSSLIPDKSSRYSSNFNYALKQGTERYQVDFISPVQVIKPGE 301

Query: 301 SITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF 360
           +++  + +FAGAK+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY  VGNF
Sbjct: 302 NLSIKSRIFAGAKKVDLLDEYEKSYDIKLFDRAIDFGWFYIITKPVFYAMNFFYGYVGNF 361

Query: 361 GIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYK 420
           GI+I++ TV +KLL F LA K Y S   MKN+QP+ID ++  +     ++ Q+ M  LYK
Sbjct: 362 GISILIVTVIIKLLMFTLANKSYRSMKKMKNLQPEIDRIKNLYNNDKARLNQEIM-ALYK 420

Query: 421 THNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL 480
              +NP+AGC PIL+QIPVFF+IYKV+ +++EMR APF+GWIKDL++ DPT IF LFG+L
Sbjct: 421 KEKVNPVAGCLPILVQIPVFFSIYKVLYVTIEMRQAPFFGWIKDLSSPDPTTIFNLFGLL 480

Query: 481 PFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLII 540
           PF  P F+ +G WPI+M+++MF+  KMSP  AD  QA ++ +MP++F+F  SSFP GL+I
Sbjct: 481 PFAPPSFLMIGAWPILMAITMFLHQKMSPELADPIQAQVMKFMPLIFLFMFSSFPVGLLI 540

Query: 541 YWSWSNVISIVQQAVIMKMH 560
           YWSW+N++SI+QQ  I K +
Sbjct: 541 YWSWNNILSIIQQYYINKFN 560


>gi|51473293|ref|YP_067050.1| putative inner membrane protein translocase component YidC
           [Rickettsia typhi str. Wilmington]
 gi|81692326|sp|Q68XS4|OXAA_RICTY RecName: Full=Inner membrane protein oxaA
 gi|51459605|gb|AAU03568.1| 60 kDa inner membrane protein [Rickettsia typhi str. Wilmington]
          Length = 558

 Score =  478 bits (1229), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 247/558 (44%), Positives = 355/558 (63%), Gaps = 9/558 (1%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPN-QVDNSYAAVLIDDRAQA 64
           N   AI LS+ I++ WQ F + P   E   +++ +   K  N +   + A    +   Q 
Sbjct: 7   NLIAAIVLSLSIIFGWQYFVIKP---EQKKQQQRMAIYKSENLKKQKALAEHTSNITVQE 63

Query: 65  LSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAEL 124
                R+++++ SL GSI LKG +FDDL L+ Y  D+S NSP V L SP+NT+NAYFAE+
Sbjct: 64  AGQVQRIKIESESLTGSIALKGLRFDDLILKKYKQDLSQNSPAVRLFSPANTENAYFAEI 123

Query: 125 DYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVD 184
             VS  ++++LPNSNTVWN  S ++L+P  P+ L + N + I F  TI++D++YLF I  
Sbjct: 124 GLVSNLSSVKLPNSNTVWNSDS-EVLSPEKPVNLFWVNEDGIKFLVTITVDKNYLFTIEQ 182

Query: 185 TVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISN 244
           T+ NNS  ++     G I R           + +G I  + D++L E  Y DI+    + 
Sbjct: 183 TIINNSDKELPVQAYGLINRKYIAVEKAVNILHQGPIGCI-DENLKEYSYDDIKDQKSAK 241

Query: 245 FHESN-SWLGISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILPGKSI 302
           F  S   W+GI+DKYW S  IP K +S+ + F Y L  G  RYQ  F +    I PGK++
Sbjct: 242 FALSKVDWIGIADKYWLSSLIPDKSSSYSANFNYALKQGAERYQVDFISPVQVIKPGKNL 301

Query: 303 TTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGI 362
           +  + +FAGAK+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY  VGNFG+
Sbjct: 302 SIKSRIFAGAKKVDLLDEYEKSYDIKLFDRAIDFGWFYIITKPVFYAMNFFYGYVGNFGV 361

Query: 363 AIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTH 422
           +I++ TV +KLL F LA K Y S   MKN+QP+ID ++  +     ++ Q+ M  LYK  
Sbjct: 362 SILIVTVIIKLLMFTLANKSYRSMKKMKNLQPEIDRIKNLYNNDKARLNQEIM-ALYKKS 420

Query: 423 NINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPF 482
            +NP+AGC PIL+QIPVFF+IYKV+ +++EMRHAPF+GWIKDL++ DPT IF LFG+LPF
Sbjct: 421 KVNPVAGCLPILVQIPVFFSIYKVLYVTIEMRHAPFYGWIKDLSSPDPTTIFNLFGLLPF 480

Query: 483 YLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYW 542
             P F+ +G WPI+M+++MF+  KMSP  AD  QA ++ +MP++F+F  SSFP GL+IYW
Sbjct: 481 APPSFLMIGAWPILMAITMFLHQKMSPELADPIQAQVMKFMPLIFLFMFSSFPVGLLIYW 540

Query: 543 SWSNVISIVQQAVIMKMH 560
           SW+N++SI+QQ  I K +
Sbjct: 541 SWNNILSIIQQYYINKFN 558


>gi|312113264|ref|YP_004010860.1| membrane protein insertase, YidC/Oxa1 family [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311218393|gb|ADP69761.1| membrane protein insertase, YidC/Oxa1 family [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 711

 Score =  474 bits (1221), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 248/606 (40%), Positives = 352/606 (58%), Gaps = 46/606 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQ-VDNSYAAVLID 59
           M+ N N+ +AIALS+ ++  WQ  Y+ P  ++   +    Q      Q  D +     I 
Sbjct: 1   MDNNRNFIIAIALSLSVLLGWQFLYMKPASDKARQQAIEAQQQTAGEQGTDPTVGGAAIP 60

Query: 60  DRAQ----------------ALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSS 103
            RA                 AL+ + R+     SL GSINLKG   DD+ L+ Y   V  
Sbjct: 61  PRASSVIPVPTTPKFASREAALAATQRIAFDTSSLTGSINLKGGSVDDVTLKEYRQTVDP 120

Query: 104 NSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNA 163
           NSP VTLLSP+ +   Y+A   + S   +I +P  +TVW       L P  P+ L + N 
Sbjct: 121 NSPPVTLLSPAGSPEPYYAYTGWYSDQADISVPGPDTVWKQQGTGALAPGKPVTLTWDNG 180

Query: 164 NNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR-HKPQTATNTFG---VQEG 219
             ++F+R I+LDEHY+F I DTV N +   +   PR  + R ++P   TN FG   + EG
Sbjct: 181 KGLVFKRAITLDEHYMFTITDTVENKTGKPVTLRPRAEVARLYEP---TNLFGYSVLHEG 237

Query: 220 FIAVLGDKSLVEQKYSDIEKSSISNFH---------------ESNSWLGISDKYWASVFI 264
            I +  D  L E  YS    S+I NF                +   WLG +D+YWA+V +
Sbjct: 238 LIGLFKDAGLKELTYS----SAIKNFDPAADNGKGVSKEIISDKGGWLGFTDQYWAAVLV 293

Query: 265 PSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKD 324
           P +     ++          +  +FS N +T+  G S T TN LFAGAK+   I  Y  D
Sbjct: 294 PDQSKPLTARL--FGTPQKDFFVEFSENPVTVATGASETFTNKLFAGAKKVVLIEQYMAD 351

Query: 325 LAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYV 384
             I RF+ L+DWGWF F+ +P++ L+++ Y  VGNFGIAI+LTTV VK+LFFPLA K Y 
Sbjct: 352 DKIDRFDKLVDWGWFPFLTQPLYFLLNWLYLHVGNFGIAILLTTVLVKVLFFPLANKSYS 411

Query: 385 STANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIY 444
           +   +K +QP++ +++E+FK    Q  Q AM+ LYK   +NP AGC PIL+QIPVFFA+Y
Sbjct: 412 AMNKLKMLQPEMKKIQERFKDDK-QRQQHAMMTLYKKEKVNPAAGCLPILVQIPVFFALY 470

Query: 445 KVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQ 504
           KV+ +S+EMRHAPF+GWI DL+A DPTNIFTLFG++P+  P FM +G  P+IM  SM++Q
Sbjct: 471 KVLLVSIEMRHAPFYGWIHDLSAPDPTNIFTLFGLIPWTPPHFMMLGALPLIMGCSMWLQ 530

Query: 505 MKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEI 564
           M+++P P D  Q  I  WMPV+F F L+ F AGLI+YW+W+N+++  QQA+IMK     +
Sbjct: 531 MRLNPTPPDPIQQKIFAWMPVLFTFMLAPFQAGLILYWTWNNILTFAQQALIMKRQDKNM 590

Query: 565 GLIDRL 570
            L++++
Sbjct: 591 NLLEQI 596


>gi|157803235|ref|YP_001491784.1| putative inner membrane protein translocase component YidC
           [Rickettsia canadensis str. McKiel]
 gi|166977408|sp|A8EXB6|OXAA_RICCK RecName: Full=Inner membrane protein oxaA
 gi|157784498|gb|ABV72999.1| putative inner membrane protein translocase component YidC
           [Rickettsia canadensis str. McKiel]
          Length = 560

 Score =  473 bits (1218), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 245/560 (43%), Positives = 354/560 (63%), Gaps = 11/560 (1%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL---IDDRA 62
           N   AI LS+ I++ WQ F V P   E   +++ I   K  N       A++    D   
Sbjct: 7   NLIAAIVLSLSIIFGWQYFVVKP---EHKKQQQQIAMQKAENLKKQKLKALIKPASDLVV 63

Query: 63  QALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFA 122
           Q  +   R+++++ SL GSI+LKG +FDDL L+ Y  D+S NS  V L SP+NT+NAYFA
Sbjct: 64  QEANQVQRIKIESESLTGSISLKGLRFDDLILKKYKQDLSKNSTEVRLFSPANTENAYFA 123

Query: 123 ELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKI 182
           E+  VS  ++++LPN++T+WN   G+IL+P  P+ L + N + + F  TI+LDE+YLF +
Sbjct: 124 EIGLVSNLSSVKLPNNDTIWNS-DGEILSPEKPVNLFWVNEDGVKFLVTITLDENYLFTV 182

Query: 183 VDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSI 242
             T+ NNS  ++     G I R           + +G I  + +++L E  Y DI+    
Sbjct: 183 EQTIVNNSDKELPVQSYGLINRKYIAVEKAVNILHQGPIGCI-NENLKEYSYDDIKDKKS 241

Query: 243 SNFHESN-SWLGISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILPGK 300
             F  S   W+G++DKYW S  IP K +++ S F Y L+ G  RYQ  F +    I  G+
Sbjct: 242 EKFVASKVDWIGMTDKYWLSSLIPDKSSNYSSNFNYALTQGVERYQVDFISPVQIIKSGE 301

Query: 301 SITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF 360
           + + T+ +FAGAK+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY  VGNF
Sbjct: 302 NFSITSRIFAGAKKVDLLDKYEKQYGIKLFDRAIDFGWFYIITKPVFYAMNFFYGYVGNF 361

Query: 361 GIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYK 420
           GI+I++ TV +KLL F LA K Y S   MKN+QP+ID ++  +     ++ Q+ M  LYK
Sbjct: 362 GISILIVTVIIKLLMFTLANKSYCSMKKMKNLQPEIDRIKNLYGDDKARLNQEIM-ALYK 420

Query: 421 THNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL 480
              +NP+AGC PIL+QIPVFF+IYKV+ +++EMR APF+GWIKDL+A DPT IF LFG L
Sbjct: 421 KEKVNPVAGCLPILVQIPVFFSIYKVLYVTIEMRQAPFYGWIKDLSAPDPTTIFNLFGFL 480

Query: 481 PFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLII 540
           PF  P F+ +G WPI+M+++MF+Q +MSP PAD  QA ++ +MP++F+   SSFP GL+I
Sbjct: 481 PFSPPSFLMIGAWPILMAITMFLQQRMSPEPADPVQAQVMKFMPLIFLVMFSSFPVGLLI 540

Query: 541 YWSWSNVISIVQQAVIMKMH 560
           YWSW+N++SI+QQ  I K +
Sbjct: 541 YWSWNNILSIIQQYYINKFN 560


>gi|34580968|ref|ZP_00142448.1| 60 kD inner-membrane protein [Rickettsia sibirica 246]
 gi|28262353|gb|EAA25857.1| 60 kD inner-membrane protein [Rickettsia sibirica 246]
          Length = 560

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 246/553 (44%), Positives = 356/553 (64%), Gaps = 13/553 (2%)

Query: 14  SVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRA----QALSMSP 69
           S+ I++ WQ F V P   E   +++ I TV++   +       L++       QA S   
Sbjct: 15  SLSIIFGWQYFVVKP---EQKKQQQQI-TVQKAENLKKQQLKALVEPATGIVVQAESQVQ 70

Query: 70  RVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVST 129
           R+++++ SL GSI+LKG +FDDL L+ Y  D+S NSP V L SP+NT+NAYFAE+  VS 
Sbjct: 71  RIKIESESLTGSISLKGLRFDDLILKKYKQDLSKNSPEVRLFSPANTENAYFAEVGLVSN 130

Query: 130 ANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNN 189
            ++++LPN++T+WN  S +IL+P  P+ L + N + + F  TI++DE+YLF I  T+ NN
Sbjct: 131 LSSVKLPNNDTIWNSDS-EILSPEKPVHLFWVNEDGVKFLVTIAVDENYLFTIEQTIVNN 189

Query: 190 SIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESN 249
           S  ++     G I R           + +G I  + D++L E  Y DI+      F  S 
Sbjct: 190 SNKELPVQSYGLINRKYIAVEKAVNILHQGPIGCI-DENLKEYSYDDIKDKKSEKFAASK 248

Query: 250 -SWLGISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILPGKSITTTNF 307
             W+GI+DKYW S  IP K +++ S F Y L  G  RYQ  F +    I PG++ +  + 
Sbjct: 249 VDWIGITDKYWLSSLIPDKSSNYSSNFNYALKQGTERYQVDFISPVQIIKPGENFSIKSR 308

Query: 308 LFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLT 367
           +FAGAK+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY  VGNFG++I++ 
Sbjct: 309 IFAGAKKVDLLDKYEKQYDIKLFDRAIDFGWFYIITKPVFYAMNFFYGYVGNFGVSILIV 368

Query: 368 TVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPL 427
           TV +KLL F LA K Y S   MKN+QP+ID ++  +     ++ Q+ M  LYK   +NP+
Sbjct: 369 TVIIKLLMFTLANKSYRSMKKMKNLQPEIDRIKNLYSDDKARLNQEIM-ALYKKEKVNPV 427

Query: 428 AGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGF 487
           AGC PIL+QIPVFF+IYKV+ +++EMR APF+GWIKDL+A+DPT IF LFG+LPF  P F
Sbjct: 428 AGCLPILVQIPVFFSIYKVLYVTIEMRQAPFYGWIKDLSASDPTTIFNLFGLLPFSPPSF 487

Query: 488 MHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNV 547
           + +G WPI+M+++MF+Q KMSP PAD  QA ++ +MP++F+F  SSFP GL+IYWSW+N+
Sbjct: 488 LMIGAWPILMAITMFLQQKMSPEPADPMQAQVMKFMPLIFLFMFSSFPVGLLIYWSWNNI 547

Query: 548 ISIVQQAVIMKMH 560
           +SI+QQ  I K +
Sbjct: 548 LSIIQQYYINKFN 560


>gi|157964113|ref|YP_001498937.1| putative inner membrane protein translocase component YidC
           [Rickettsia massiliae MTU5]
 gi|166977409|sp|A8F0F4|OXAA_RICM5 RecName: Full=Inner membrane protein oxaA
 gi|157843889|gb|ABV84390.1| Preprotein translocase subunit YidC [Rickettsia massiliae MTU5]
          Length = 560

 Score =  471 bits (1212), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 245/566 (43%), Positives = 356/566 (62%), Gaps = 23/566 (4%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPR---------IEEMNNERKNIQTVKQPNQVDNSYAAV 56
           N   AI LS+ I++ WQ F V P          +++  N +K     +Q   +      +
Sbjct: 7   NLVAAIILSLSIIFGWQYFVVKPEQKKQQQQIAVQKAENLKK-----QQLKALVEPATGI 61

Query: 57  LIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNT 116
           ++ + +Q      R+++++ SL GSI+LKG +FDDL L+ Y  D+S NSP V L SPSNT
Sbjct: 62  VVQEESQI----QRIKIESESLTGSISLKGLRFDDLILKKYKQDLSKNSPEVRLFSPSNT 117

Query: 117 KNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE 176
           +NAYFAE+  VS  ++++LPN++T+WN  S +IL+P  P+ L + N + + F  TI++DE
Sbjct: 118 ENAYFAEIGLVSNLSSVKLPNNDTIWNSDS-EILSPEKPVHLFWVNEDGVKFLVTITVDE 176

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
           +YLF I  T+ N S  ++     G I R           + +G I  + D++L E  Y D
Sbjct: 177 NYLFTIEQTIVNYSDKELPVQSYGLINRKYIAVEKAVNILHQGPIGCI-DENLKEYSYDD 235

Query: 237 IEKSSISNFHESN-SWLGISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEI 294
           I+      F  S   W+GI+DKYW S  IP K +++ S F Y L  G  RYQ  F +   
Sbjct: 236 IKDKKSEKFAASKVDWIGITDKYWLSSLIPDKSSNYSSNFNYALKQGTERYQVDFISPVQ 295

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
            I PG++ +  + +FAGAK+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY
Sbjct: 296 IIKPGENFSIKSRIFAGAKKVDLLDKYEKQYDIKLFDRAIDFGWFYIITKPVFYAMNFFY 355

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
             VGNFG++I++ TV +KLL F LA K Y S   MKN+QP+ID ++  +     ++ Q+ 
Sbjct: 356 GYVGNFGVSILIVTVIIKLLMFTLANKSYRSMKKMKNLQPEIDRIKNLYSDDKARLNQEI 415

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           M  LYK   +NP+AGC PIL+QIPVFF+IYKV+ +++EMR  PF+GWIKDL+A DPT IF
Sbjct: 416 M-ALYKKEKVNPVAGCLPILVQIPVFFSIYKVLYVTIEMRQTPFYGWIKDLSAPDPTTIF 474

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSF 534
            LFG+LPF  P F+ +G WPI+M+++MF+Q KMSP PAD  QA ++ +MP++F+F  SSF
Sbjct: 475 NLFGLLPFSPPSFLMIGAWPILMAITMFLQQKMSPEPADPMQAQVMKFMPLIFLFMFSSF 534

Query: 535 PAGLIIYWSWSNVISIVQQAVIMKMH 560
           P GL+IYWSW+N++SI+QQ  I K +
Sbjct: 535 PVGLLIYWSWNNILSIIQQYYINKFN 560


>gi|15891997|ref|NP_359711.1| putative inner membrane protein translocase component YidC
           [Rickettsia conorii str. Malish 7]
 gi|38503126|sp|Q92JJ3|OXAA_RICCN RecName: Full=Inner membrane protein oxaA
 gi|15619112|gb|AAL02612.1| 60 kD inner-membrane protein [Rickettsia conorii str. Malish 7]
          Length = 560

 Score =  471 bits (1212), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 242/558 (43%), Positives = 355/558 (63%), Gaps = 23/558 (4%)

Query: 14  SVIIVYAWQNFYVYPR---------IEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQA 64
           S+ I++ WQ F V P          +++  N +K     +Q   +      +++ + +Q 
Sbjct: 15  SLSIIFGWQYFVVKPEQKKQQQQIAVQKAENLKK-----QQLKALVEPATGIVVQEESQV 69

Query: 65  LSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAEL 124
                R+++++ SL GSI+LKG +FDDL L+ Y  D+S NSP V L SP+NT+NAYFAE+
Sbjct: 70  ----QRIKIESESLTGSISLKGLRFDDLILKKYKQDLSKNSPEVRLFSPANTENAYFAEV 125

Query: 125 DYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVD 184
             VS  ++++LPN++T+WN  S +IL+P  P+ L + N + + F  TI++DE+YLF I  
Sbjct: 126 GLVSNLSSVKLPNNDTIWNSDS-EILSPEKPVHLFWVNEDGVKFLVTITVDENYLFTIEQ 184

Query: 185 TVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISN 244
           T+ NNS  ++     G I R           + +G I  + D++L E  Y DI+      
Sbjct: 185 TIVNNSDKELPVQSYGLINRKYIAVEKAVNILHQGPIGCI-DENLKEYSYDDIKDKKSEK 243

Query: 245 FHESN-SWLGISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILPGKSI 302
           F  S   W+GI+DKYW S  IP K +++ S F Y L  G  RYQ  F +    I PG++ 
Sbjct: 244 FAASKVDWIGITDKYWLSSLIPDKSSNYSSNFNYALKQGTERYQVDFISPVQIIKPGENF 303

Query: 303 TTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGI 362
           +  + +FAGAK+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY  VGNFG+
Sbjct: 304 SIKSRIFAGAKKVDLLDKYEKQYDIKLFDRAIDFGWFYIITKPVFYAMNFFYGYVGNFGV 363

Query: 363 AIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTH 422
           +I++ TV +KLL F LA K Y S   MKN+QP+ID ++  +     ++ Q+ M  LYK  
Sbjct: 364 SILIVTVIIKLLMFTLANKSYRSMKKMKNLQPEIDRIKNLYSDDKARLNQEIM-ALYKKE 422

Query: 423 NINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPF 482
            +NP+AGC PIL+QIPVFF+IYKV+ +++EMR APF+GWIKDL+A+DPT IF LFG+LPF
Sbjct: 423 KVNPVAGCLPILVQIPVFFSIYKVLYVTIEMRQAPFYGWIKDLSASDPTTIFNLFGLLPF 482

Query: 483 YLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYW 542
             P F+ +G WPI+M+++MF+Q KMSP PAD  QA ++ +MP++F+F  SSFP GL+IYW
Sbjct: 483 SPPSFLMIGAWPILMAITMFLQQKMSPEPADPMQAQVMKFMPLIFLFMFSSFPVGLLIYW 542

Query: 543 SWSNVISIVQQAVIMKMH 560
           SW+N++SI+QQ  I K +
Sbjct: 543 SWNNILSIIQQYYINKFN 560


>gi|157827949|ref|YP_001494191.1| putative inner membrane protein translocase component YidC
           [Rickettsia rickettsii str. 'Sheila Smith']
 gi|166977410|sp|A8GQK8|OXAA_RICRS RecName: Full=Inner membrane protein oxaA
 gi|157800430|gb|ABV75683.1| putative inner membrane protein translocase component YidC
           [Rickettsia rickettsii str. 'Sheila Smith']
          Length = 560

 Score =  471 bits (1211), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 243/558 (43%), Positives = 354/558 (63%), Gaps = 23/558 (4%)

Query: 14  SVIIVYAWQNFYVYPR---------IEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQA 64
           S+ I++ WQ F V P          +++  N +K     +Q   +      +++ + +Q 
Sbjct: 15  SLSIIFGWQYFVVKPEQKKQQQQIAVQKAENLKK-----QQLKALVEPATGIVVQEESQV 69

Query: 65  LSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAEL 124
                R+++++ SL GSI+LKG +FDDL L+ Y  D+S NSP V L SP+NT+NAYFAE+
Sbjct: 70  ----QRIKIESESLTGSISLKGLRFDDLILKKYKQDLSKNSPEVRLFSPANTENAYFAEV 125

Query: 125 DYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVD 184
             VS  ++++LPN++T+WN  S +IL+P  P+ L + N + + F  TI++DE+YLF I  
Sbjct: 126 GLVSNLSSVKLPNNDTIWNSDS-EILSPEKPVHLFWVNEDGVKFLVTITVDENYLFTIEQ 184

Query: 185 TVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISN 244
           T+ NNS  ++     G I R           + +G I  + D++L E  Y DI+      
Sbjct: 185 TIVNNSDKELPVQSYGLINRKYIAVEKAVNILHQGPIGCI-DENLKEYSYDDIKDKKSEK 243

Query: 245 FHESN-SWLGISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILPGKSI 302
           F  S   W+GI+DKYW S  IP K +++ S F Y L  G  RYQ  F +    I PGK+ 
Sbjct: 244 FAASKVDWIGITDKYWLSSLIPDKSSNYSSNFNYALKQGIERYQVDFISPVQIIKPGKNF 303

Query: 303 TTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGI 362
           +  + +FAGAK+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY  VGNFG+
Sbjct: 304 SIKSRIFAGAKKVDLLDKYEKQYDIKLFDRAIDFGWFYIITKPVFYAMNFFYGYVGNFGV 363

Query: 363 AIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTH 422
           +I++ TV +KLL F LA K Y S   MKN+QP+ID ++  +     ++ Q+ M  LYK  
Sbjct: 364 SILIVTVIIKLLMFTLANKSYRSMKKMKNLQPEIDRIKNLYSDDKARLNQEIM-ALYKKE 422

Query: 423 NINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPF 482
            +NP+AGC PIL+QIPVFF+IYKV+ +++EMR APF+GWIKDL+A DPT IF LFG+LPF
Sbjct: 423 KVNPVAGCLPILVQIPVFFSIYKVLYVTIEMRQAPFYGWIKDLSAPDPTTIFNLFGLLPF 482

Query: 483 YLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYW 542
             P F+ +G WPI+M+++MF+Q KMSP PAD  QA ++ +MP++F+F  SSFP GL+IYW
Sbjct: 483 APPSFLMIGAWPILMAITMFLQQKMSPEPADPMQAQVMKFMPLIFLFMFSSFPVGLLIYW 542

Query: 543 SWSNVISIVQQAVIMKMH 560
           SW+N++SI+QQ  I K +
Sbjct: 543 SWNNILSIIQQYYINKFN 560


>gi|296444656|ref|ZP_06886620.1| membrane protein insertase, YidC/Oxa1 family [Methylosinus
           trichosporium OB3b]
 gi|296257924|gb|EFH04987.1| membrane protein insertase, YidC/Oxa1 family [Methylosinus
           trichosporium OB3b]
          Length = 610

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 236/606 (38%), Positives = 350/606 (57%), Gaps = 36/606 (5%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIE-EMNNERKNIQTVKQPNQVDNSYAAV---- 56
           E   N  +A  LS++ + AW  FY +P++E E   + + I+   Q         A     
Sbjct: 3   EYTKNVIIAAGLSMLFIGAWDYFYAFPKLEQERQTQAEQIKKTAQAQAPAARKPAAPETK 62

Query: 57  ------------------LIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYH 98
                             +   R  AL+ SPR+ +  PS+ GSI L G + DD++L+ YH
Sbjct: 63  QAQAPTATQQQPAAAQKPVKKTREAALAESPRIAIDTPSIAGSIALVGGRIDDVSLKNYH 122

Query: 99  LDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKL 158
             V   SPI+ LLSP N  + Y+AE  +++ A +  LPN+ T+W       L+   P+ L
Sbjct: 123 ETVDPKSPIIVLLSPENGPDPYYAETGFLA-AGDAALPNAQTLWT-ADRTTLSAAQPVTL 180

Query: 159 VFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQE 218
            + N   ++F+R I++D+ Y+F + D+V N++   +      R+ R           + E
Sbjct: 181 SYDNGQGLVFKRKIAVDDRYMFTVADSVENHADKPVTLYSYMRVARVGIPAGAGYAALHE 240

Query: 219 GFIAVLGDKSLVEQKYSDIEKS--SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFK 276
           GFI V+G+  + E KY  +EK   +      +  WLG ++KYWA+V +P ++  F ++F 
Sbjct: 241 GFIGVIGESGVQEMKYEKVEKEPHATKTLSGTGGWLGFTEKYWAAVAVPQQDKPFEARFS 300

Query: 277 YLSDGHAR-YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLID 335
               G  + YQA      +TI PG S  T+  +FAGAK    +  Y+    I  F++LID
Sbjct: 301 ATGAGTVKAYQADTVGAPLTIQPGASGETSQRIFAGAKVVDMLDAYQAQ-GIEHFDLLID 359

Query: 336 WGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPK 395
           WGWFYF+ +PMF L+   ++++GNFG+AI+  TV VK+ F PLA K Y + A MK +QPK
Sbjct: 360 WGWFYFLTRPMFRLIDNLFHVLGNFGLAILAVTVLVKIAFLPLANKSYQAVAKMKEVQPK 419

Query: 396 IDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRH 455
           I  L+EK+     Q L +  + L+K   INP  GC P+LLQIPVFF++YKV+ I++EMRH
Sbjct: 420 IQALKEKYGDDK-QTLSREQMALFKREKINPAGGCLPMLLQIPVFFSLYKVLVITIEMRH 478

Query: 456 APFWGWIKDLAAADPTNIFTLFGILPF------YLPGFMHVGIWPIIMSLSMFIQMKMSP 509
           APF+GWIKDL+A DPTNIF LFG++PF          F+ +G+WPIIM  +M++QMKM+P
Sbjct: 479 APFYGWIKDLSAPDPTNIFNLFGLIPFDPTQIPLFGSFLWLGVWPIIMGFTMWMQMKMNP 538

Query: 510 PPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDR 569
            P D+ Q +   WMPV+F F+L SF +GL+IYWSW+N++S+ QQ  IM+  G +  L D 
Sbjct: 539 EPTDEIQRIAFAWMPVIFTFSLGSFASGLVIYWSWNNILSVTQQWYIMRRAGVKFELWDN 598

Query: 570 LRSTFS 575
           L+ TF 
Sbjct: 599 LKKTFD 604


>gi|229586285|ref|YP_002844786.1| putative inner membrane protein translocase component YidC
           [Rickettsia africae ESF-5]
 gi|259515719|sp|C3PM83|OXAA_RICAE RecName: Full=Membrane protein oxaA
 gi|228021335|gb|ACP53043.1| Preprotein translocase subunit YidC [Rickettsia africae ESF-5]
          Length = 560

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 243/558 (43%), Positives = 354/558 (63%), Gaps = 23/558 (4%)

Query: 14  SVIIVYAWQNFYVYPR---------IEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQA 64
           S+ I++ WQ F V P          +++  N +K     +Q   V      +++ + +Q 
Sbjct: 15  SLSIIFGWQYFVVKPEQKKQQQQIAVQKAENLKK-----QQLKAVVEPATGIVVQEESQV 69

Query: 65  LSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAEL 124
                R+++++ SL GSI+LKG +FDDL L+ Y  D+S NSP V L SP+NT+NAYFAE+
Sbjct: 70  ----QRIKIESESLTGSISLKGLRFDDLILKKYKQDLSKNSPEVRLFSPANTENAYFAEV 125

Query: 125 DYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVD 184
             VS  ++++LPN++T+WN  S +IL+P  P+ L + N + + F  TI++DE+YLF I  
Sbjct: 126 GLVSNLSSVKLPNNDTIWNSDS-EILSPEKPVHLFWVNEDGVKFLVTITVDENYLFTIEQ 184

Query: 185 TVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISN 244
           T+ NNS  ++     G I R           + +G I  + D++L E  Y DI+      
Sbjct: 185 TIVNNSDKELPVQSYGLINRKYIAVEKAVNILHQGPIGCI-DENLKEYSYDDIKDKKSEK 243

Query: 245 FHESN-SWLGISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILPGKSI 302
           F  S   W+GI+DKYW S  IP K +++ S F Y L  G  RYQ  F +    I PG+  
Sbjct: 244 FVASKVDWIGITDKYWLSSLIPDKSSNYSSNFNYALKQGTERYQVDFISPVQIIKPGEDF 303

Query: 303 TTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGI 362
           +  + +FAGAK+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY  VGNFG+
Sbjct: 304 SIKSRIFAGAKKVDLLDKYEKQYDIKLFDRAIDFGWFYIITKPVFYAMNFFYGYVGNFGV 363

Query: 363 AIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTH 422
           +I++ TV +KLL F LA K Y S   MKN+QP+ID ++  +     ++ Q+ M  LYK  
Sbjct: 364 SILIVTVIIKLLMFTLANKSYRSMKKMKNLQPEIDRIKNLYSDDKARLNQEIM-ALYKKE 422

Query: 423 NINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPF 482
            +NP+AGC PIL+QIPVFF+IYKV+ +++EMR APF+GWIKDL+A+DPT IF LFG+LPF
Sbjct: 423 KVNPVAGCLPILVQIPVFFSIYKVLYVTIEMRQAPFYGWIKDLSASDPTTIFNLFGLLPF 482

Query: 483 YLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYW 542
             P F+ +G WPI+M+++MF+Q KMSP PAD  QA ++ +MP++F+F  SSFP GL+IYW
Sbjct: 483 SPPLFLMIGAWPILMAITMFLQQKMSPEPADPMQAQVMKFMPLIFLFMFSSFPVGLLIYW 542

Query: 543 SWSNVISIVQQAVIMKMH 560
           SW+N++SI+QQ  I K +
Sbjct: 543 SWNNILSIIQQYYINKFN 560


>gi|67458523|ref|YP_246147.1| putative inner membrane protein translocase component YidC
           [Rickettsia felis URRWXCal2]
 gi|75537010|sp|Q4UN76|OXAA_RICFE RecName: Full=Inner membrane protein oxaA
 gi|67004056|gb|AAY60982.1| Preprotein translocase subunit YidC [Rickettsia felis URRWXCal2]
          Length = 560

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 244/552 (44%), Positives = 352/552 (63%), Gaps = 11/552 (1%)

Query: 14  SVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL---IDDRAQALSMSPR 70
           S+ I++ WQ F V P   E   +++ I   K  N       A++    D   Q  S   R
Sbjct: 15  SLSIIFGWQYFVVKP---EQKKQQQQIAVQKAENLKKQQLKALVEPATDIVVQEESGVQR 71

Query: 71  VELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTA 130
           +++++ SL GSI+LKG +FDDL L+ Y  D+S+NSP V L SP+NT+NAYFAE+  VS  
Sbjct: 72  IKIESESLTGSISLKGLRFDDLILKKYKQDLSNNSPEVRLFSPANTENAYFAEIGLVSNL 131

Query: 131 NNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNS 190
           ++++LPN++T+WN  S +IL+P  P+ L + N + + F  TI++DE+YLF I  T+ NNS
Sbjct: 132 SSVKLPNNDTIWNSDS-EILSPEKPVNLFWVNEDGVKFLVTITVDENYLFTIEQTIVNNS 190

Query: 191 IDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESN- 249
             ++     G I R           + +G I  + D++L E  Y DI+      F  S  
Sbjct: 191 DKELPIQSYGLINRKYTAVEKAVNILHQGPIGCI-DENLKEYSYDDIKDKKSEKFAASKV 249

Query: 250 SWLGISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILPGKSITTTNFL 308
            W+GI+DKYW S  IP K +++ S F Y L  G  RYQ  F +    I PG++ +  + +
Sbjct: 250 DWIGITDKYWLSSLIPDKSSNYSSNFNYALKQGTERYQVDFISPVQIIKPGENFSIKSRI 309

Query: 309 FAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTT 368
           FAGAK+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY  VGNFG++I++ T
Sbjct: 310 FAGAKKVDLLDKYEKQYDIKLFDRAIDFGWFYIITKPVFYAMNFFYGYVGNFGVSILIVT 369

Query: 369 VFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLA 428
           V +KLL F LA K Y S   MKN+QP+ID ++  +     ++ Q+ M  LYK   +NP+A
Sbjct: 370 VIIKLLMFTLANKSYRSMKKMKNLQPEIDRIKNLYSDDKARLNQEIM-ALYKKEKVNPVA 428

Query: 429 GCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFM 488
           GC PIL+QIP+FF+IYKV+ +++EMR  PF+GWIKDL+A DPT IF LFG+LPF  P F+
Sbjct: 429 GCLPILVQIPLFFSIYKVLYVTIEMRQVPFYGWIKDLSAPDPTTIFNLFGLLPFSPPSFL 488

Query: 489 HVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVI 548
            +G WPI+M+++MF+Q KMSP PAD  QA ++ +MP++F+F  SSFP GL+IYWSW+N++
Sbjct: 489 MIGAWPILMAITMFLQQKMSPEPADPMQAQVMKFMPLIFLFMFSSFPVGLLIYWSWNNIL 548

Query: 549 SIVQQAVIMKMH 560
           SI+QQ  I K +
Sbjct: 549 SIIQQYYINKFN 560


>gi|238650515|ref|YP_002916367.1| putative inner membrane protein translocase component YidC
           [Rickettsia peacockii str. Rustic]
 gi|259515722|sp|C4K168|OXAA_RICPU RecName: Full=Inner membrane protein oxaA
 gi|238624613|gb|ACR47319.1| putative inner membrane protein translocase component YidC
           [Rickettsia peacockii str. Rustic]
          Length = 560

 Score =  469 bits (1207), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 241/558 (43%), Positives = 354/558 (63%), Gaps = 23/558 (4%)

Query: 14  SVIIVYAWQNFYVYPR---------IEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQA 64
           S+ I++ WQ F V P          +++  N +K     +Q   +      +++ + +Q 
Sbjct: 15  SLSIIFGWQYFVVKPEQKKQQQQIAVQKAENLKK-----QQLKALVEPATGIVVQEESQV 69

Query: 65  LSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAEL 124
                R+++++ SL GS++LKG +FDDL L+ Y  D+S NSP V L SP+NT+NAYFAE+
Sbjct: 70  ----QRIKIESESLTGSVSLKGLRFDDLILKKYKQDLSKNSPEVRLFSPANTENAYFAEV 125

Query: 125 DYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVD 184
             VS  ++++LPN++T+WN  S +IL+P  P+ L + N + + F  TI++DE+YLF I  
Sbjct: 126 GLVSNLSSVKLPNNDTIWNSDS-EILSPEKPVHLFWVNEDGVKFLVTITVDENYLFTIEQ 184

Query: 185 TVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISN 244
           T+ NNS  ++     G I R           + +G I  + D++L E  Y DI+      
Sbjct: 185 TIVNNSDKELPVQSYGLINRKYIAVEKAVNILHQGPIGCI-DENLKEYSYDDIKDKKSEK 243

Query: 245 FHESN-SWLGISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILPGKSI 302
           F  S   W+GI+DKYW S  IP K +++ S F Y L  G  RYQ  F +    I PG++ 
Sbjct: 244 FAASKVDWIGITDKYWLSSLIPDKSSNYSSNFNYALKQGTERYQVDFISPVQIIKPGENF 303

Query: 303 TTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGI 362
           +  + +FAGAK+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY  VGNFG+
Sbjct: 304 SIKSRIFAGAKKVDLLDKYEKQYDIKLFDRAIDFGWFYIITKPVFYAMNFFYGYVGNFGV 363

Query: 363 AIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTH 422
           +I++ TV +KLL F LA K Y S   MKN+QP+ID ++  +     ++ Q+ M  LYK  
Sbjct: 364 SILIVTVIIKLLMFTLANKSYRSMKKMKNLQPEIDRIKNLYSDDKARLNQEIM-ALYKKE 422

Query: 423 NINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPF 482
            +NP+AGC PIL+QIPVFF+IYKV+ +++EMR APF+GWIKDL+A DPT IF LFG+LPF
Sbjct: 423 KVNPVAGCLPILVQIPVFFSIYKVLYVTIEMRQAPFYGWIKDLSAPDPTTIFNLFGLLPF 482

Query: 483 YLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYW 542
             P F+ +G WPI+M+++MF+Q KMSP PAD  QA ++ +MP++F+F  SSFP GL+IYW
Sbjct: 483 SPPSFLMIGAWPILMAITMFLQQKMSPEPADPMQAQVMKFMPLIFLFMFSSFPVGLLIYW 542

Query: 543 SWSNVISIVQQAVIMKMH 560
           SW+N++SI+QQ  I K +
Sbjct: 543 SWNNILSIIQQYYINKFN 560


>gi|91204826|ref|YP_537181.1| putative inner membrane protein translocase component YidC
           [Rickettsia bellii RML369-C]
 gi|157826396|ref|YP_001495460.1| putative inner membrane protein translocase component YidC
           [Rickettsia bellii OSU 85-389]
 gi|122426155|sp|Q1RKM2|OXAA_RICBR RecName: Full=Inner membrane protein oxaA
 gi|166977407|sp|A8GUC7|OXAA_RICB8 RecName: Full=Inner membrane protein oxaA
 gi|91068370|gb|ABE04092.1| Preprotein translocase subunit YidC [Rickettsia bellii RML369-C]
 gi|157801700|gb|ABV78423.1| putative inner membrane protein translocase component YidC
           [Rickettsia bellii OSU 85-389]
          Length = 559

 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 243/559 (43%), Positives = 356/559 (63%), Gaps = 11/559 (1%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPRIEEMNN--ERKNIQTVKQPNQVDNSYAAVLIDDRAQ 63
           N   AI LS+ I++ WQ F V P+ ++       +  + +K+          V++ + +Q
Sbjct: 7   NLVAAIVLSLGIIFGWQYFIVKPQQQKQQQQIALQKAKDLKKKESAQLEATPVIVQEASQ 66

Query: 64  ALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAE 123
           A    PR+++ + +L GSI+LKG +FDDL L+ Y  D+S NSP V L SPS+TK+AYFAE
Sbjct: 67  A----PRIKIDSNALSGSISLKGLRFDDLILKKYKQDLSENSPEVVLFSPSDTKDAYFAE 122

Query: 124 LDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIV 183
           + +VS  ++++LPN+ T+WN  S +ILTP  P+ L + N + + F   I++DE+YLF I 
Sbjct: 123 IGWVSNLSSVKLPNNETIWNSDS-EILTPEKPVNLFWVNEDGVKFLVAITVDENYLFTIE 181

Query: 184 DTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSIS 243
            T+ NNS  ++     G I R           + +G I  + D++L E  Y DI+     
Sbjct: 182 QTIVNNSNQELPVQSYGLINRKYTAVEKAVNILHQGPIGCI-DENLKEYSYDDIKDKKSE 240

Query: 244 NFHESN-SWLGISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILPGKS 301
            F  S   W+GI+DKYW +  IP K +++ S F Y +     RYQ  F +    + PG++
Sbjct: 241 KFSASKVDWIGITDKYWLTSLIPDKSSNYSSNFNYAVKQEVERYQVDFISPVQIVKPGEN 300

Query: 302 ITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFG 361
            +    LFAGAK+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY  VGNFG
Sbjct: 301 FSIKGRLFAGAKKVDLLDKYEKQYDIKLFDRAIDFGWFYIITKPVFYAMNFFYKYVGNFG 360

Query: 362 IAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKT 421
           I+I++ TV +KLL F LA K Y S   MKN+QP+I+ ++  +     ++ Q+ M  LYK 
Sbjct: 361 ISILIVTVIIKLLMFTLANKSYRSMKRMKNLQPEINRIKNLYGDDKARLNQEIM-ALYKK 419

Query: 422 HNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILP 481
             +NP+AGC PIL+QIPVFF+IYKV+ +++EMR APF+GWIKDL+A DPT+IF LFG+L 
Sbjct: 420 EKVNPVAGCLPILVQIPVFFSIYKVLYVTIEMRQAPFYGWIKDLSAPDPTSIFNLFGLLH 479

Query: 482 FYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIY 541
           F LP F+ +G WPI+M+++MF+Q +MSP PAD  QA ++ +MP+VF+   SSFPAGL+IY
Sbjct: 480 FSLPSFLMIGAWPILMAITMFLQQRMSPEPADPVQAQVMKFMPLVFLVMFSSFPAGLLIY 539

Query: 542 WSWSNVISIVQQAVIMKMH 560
           WSW+N++SI+QQ  I K+ 
Sbjct: 540 WSWNNILSIIQQYYINKLD 558


>gi|192289066|ref|YP_001989671.1| inner membrane protein translocase component YidC [Rhodopseudomonas
           palustris TIE-1]
 gi|192282815|gb|ACE99195.1| 60 kDa inner membrane insertion protein [Rhodopseudomonas palustris
           TIE-1]
          Length = 622

 Score =  468 bits (1203), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 249/619 (40%), Positives = 359/619 (57%), Gaps = 43/619 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERK----------NIQTVKQPNQVD 50
           M  N N  +A+ LS +++  WQ F+  P++E+    ++            QT    +   
Sbjct: 1   MSDNRNTILAVVLSGLVLLGWQYFFNIPQMEKQRAAQQAQQQAAKQQAETQTPGAASPAA 60

Query: 51  ---------------NSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLR 95
                             AA     R  AL+  PR++++ P L GSI LKGA+ DDL L 
Sbjct: 61  APAAPGAPGSAPASPQQQAAAPTVSREAALAAGPRIKVETPRLSGSIALKGARIDDLALM 120

Query: 96  GYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWNLISGKILTPTT 154
            Y   V   SP + L SPS +   Y+AE  +V  A  +++LP+ NT+W       LTP  
Sbjct: 121 QYRETVDPKSPPIELFSPSGSARPYYAEFGWVGAAGASVKLPDHNTLWEQEGTGALTPAN 180

Query: 155 PIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTF 214
           P+ L + N   + F R I++D+ YLF + D VTN     +   P   I RH        +
Sbjct: 181 PVTLKWDNGEGLTFRRQITVDDRYLFTVKDDVTNTGGAPVTLYPFALISRHGTPHVEGYY 240

Query: 215 GVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQ 274
            + EG I  LGD+ L E  YS I+++    F  +N WLGI+DKYWAS  +P       ++
Sbjct: 241 ILHEGLIGYLGDQGLQEYSYSKIDEAKSVGFKATNGWLGITDKYWASALLPDTSAQLQAR 300

Query: 275 FKYLSDGH-ARYQAKFSANEITILPGKSITTTNFLFAGAKE---------FPTIHHYEKD 324
           F     G+   YQ  +  +  T+  G ++T    LFAGAKE         F  +  Y++ 
Sbjct: 301 FSANKVGNVTTYQTDYLEDARTVPIGGTVTANARLFAGAKEARVVGINFPFAGLGGYDRQ 360

Query: 325 LAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYV 384
           L +  F++LIDWGWFYFI KPMF+ + +F++LVGNFG+AI+L TV VKLLF PLA K Y 
Sbjct: 361 LGLNHFDLLIDWGWFYFITKPMFLALDFFFHLVGNFGVAILLVTVLVKLLFLPLANKSYA 420

Query: 385 STANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIY 444
           S A MK IQP++  L+E+      +  Q+ M+++Y+   INP+AGC PILLQIPVFF++Y
Sbjct: 421 SMAKMKAIQPQLAALKERHPDDKVKQ-QQEMMEIYRKEKINPVAGCLPILLQIPVFFSLY 479

Query: 445 KVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPF------YLPGFMHVGIWPIIMS 498
           KV+ +++EMRHAPF+GWI DL+A DPTNIF LFG++P+       L  ++ +G WP++M 
Sbjct: 480 KVLFVTIEMRHAPFFGWIHDLSAPDPTNIFNLFGLIPYDPTAIPVLGHYLVLGAWPLVMG 539

Query: 499 LSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
            +M+ QMK++P P D  Q MI  WMPV+F F L+ FPAGL+IYW+W+N +S+ QQA IM+
Sbjct: 540 FTMWFQMKLNPQPPDPTQQMIFAWMPVIFTFMLAHFPAGLVIYWAWNNTLSVAQQAFIMQ 599

Query: 559 MHGAEIGLIDRLRSTFSKN 577
            +G ++ L D LR++F+K 
Sbjct: 600 RNGVKVELWDNLRTSFAKK 618


>gi|165932637|ref|YP_001649426.1| membrane protein insertase [Rickettsia rickettsii str. Iowa]
 gi|189036358|sp|B0BVZ4|OXAA_RICRO RecName: Full=Inner membrane protein oxaA
 gi|165907724|gb|ABY72020.1| 60 kDa inner membrane protein [Rickettsia rickettsii str. Iowa]
          Length = 560

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 242/558 (43%), Positives = 353/558 (63%), Gaps = 23/558 (4%)

Query: 14  SVIIVYAWQNFYVYPR---------IEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQA 64
           S+ I++ WQ F V P          +++  N +K     +Q   +      +++ + +Q 
Sbjct: 15  SLSIIFGWQYFVVKPEQKKQQQQIAVQKAENLKK-----QQLKALVEPATGIVVQEESQV 69

Query: 65  LSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAEL 124
                R+++++ SL GSI+LKG +FDDL L+ Y  D+S NS  V L SP+NT+NAYFAE+
Sbjct: 70  ----QRIKIESESLTGSISLKGLRFDDLILKKYKQDLSKNSSEVRLFSPANTENAYFAEV 125

Query: 125 DYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVD 184
             VS  ++++LPN++T+WN  S +IL+P  P+ L + N + + F  TI++DE+YLF I  
Sbjct: 126 GLVSNLSSVKLPNNDTIWNSDS-EILSPEKPVHLFWVNEDGVKFLVTITVDENYLFTIEQ 184

Query: 185 TVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISN 244
           T+ NNS  ++     G I R           + +G I  + D++L E  Y DI+      
Sbjct: 185 TIVNNSDKELPVQSYGLINRKYIAVEKAVNILHQGPIGCI-DENLKEYSYDDIKDKKSEK 243

Query: 245 FHESN-SWLGISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILPGKSI 302
           F  S   W+GI+DKYW S  IP K +++ S F Y L  G  RYQ  F +    I PGK+ 
Sbjct: 244 FAASKVDWIGITDKYWLSSLIPDKSSNYSSNFNYALKQGIERYQVDFISPVQIIKPGKNF 303

Query: 303 TTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGI 362
           +  + +FAGAK+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY  VGNFG+
Sbjct: 304 SIKSRIFAGAKKVDLLDKYEKQYDIKLFDRAIDFGWFYIITKPVFYAMNFFYGYVGNFGV 363

Query: 363 AIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTH 422
           +I++ TV +KLL F LA K Y S   MKN+QP+ID ++  +     ++ Q+ M  LYK  
Sbjct: 364 SILIVTVIIKLLMFTLANKSYRSMKKMKNLQPEIDRIKNLYSDDKARLNQEIM-ALYKKE 422

Query: 423 NINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPF 482
            +NP+AGC PIL+QIPVFF+IYKV+ +++EMR APF+GWIKDL+A DPT IF LFG+LPF
Sbjct: 423 KVNPVAGCLPILVQIPVFFSIYKVLYVTIEMRQAPFYGWIKDLSAPDPTTIFNLFGLLPF 482

Query: 483 YLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYW 542
             P F+ +G WPI+M+++MF+Q KMSP PAD  QA ++ +MP++F+F  SSFP GL+IYW
Sbjct: 483 APPSFLMIGAWPILMAITMFLQQKMSPEPADPMQAQVMKFMPLIFLFMFSSFPVGLLIYW 542

Query: 543 SWSNVISIVQQAVIMKMH 560
           SW+N++SI+QQ  I K +
Sbjct: 543 SWNNILSIIQQYYINKFN 560


>gi|239946952|ref|ZP_04698705.1| inner membrane protein OxaA [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921228|gb|EER21252.1| inner membrane protein OxaA [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 560

 Score =  467 bits (1201), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 242/552 (43%), Positives = 350/552 (63%), Gaps = 11/552 (1%)

Query: 14  SVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL---IDDRAQALSMSPR 70
           S+ I++ WQ F V P   E   +++ I   K  N       A++    D   Q  +   R
Sbjct: 15  SLSIIFGWQYFVVKP---EQKKQQQQIAVQKAENLKKQQLKALVEPATDIVVQEENQVQR 71

Query: 71  VELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTA 130
           +++++ SL GSI+LKG +FDDL L+ Y  D+S NSP V L SP+NT+NAYFAE+  VS  
Sbjct: 72  IKIESESLTGSISLKGLRFDDLILKKYKQDLSKNSPEVRLFSPANTENAYFAEIGLVSNL 131

Query: 131 NNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNS 190
           ++++LPN++T+WN  + +IL+P   + L + N + + F  TI++DE+YLF I  T+ NNS
Sbjct: 132 SSVKLPNNDTIWNS-NSEILSPEKSVNLFWVNEDGVKFLVTITVDENYLFTIEQTIVNNS 190

Query: 191 IDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESN- 249
             ++     G I R           + +G I  + D++L E  Y DI+      F     
Sbjct: 191 DKELPVQSYGLINRKYIAVEKAVNILHQGPIGCI-DENLKEYSYDDIKDKKSEKFAAGKV 249

Query: 250 SWLGISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILPGKSITTTNFL 308
            W+GI+DKYW S  IP K +++ S F Y L  G  RYQ  F +    I PG++ +  + +
Sbjct: 250 DWIGITDKYWLSSLIPDKSSNYSSNFNYALKQGAERYQVDFISPVQIIKPGENFSIKSRI 309

Query: 309 FAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTT 368
           FAGAK+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY  VGNFG++I++ T
Sbjct: 310 FAGAKKVDLLDKYEKQYDIKLFDRAIDFGWFYIITKPVFYAMNFFYGYVGNFGVSILIVT 369

Query: 369 VFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLA 428
           V +KLL F LA K Y S   MKN+QP+ID ++  +     ++ Q+ M  LYK   +NP+A
Sbjct: 370 VIIKLLMFTLANKSYRSMKKMKNLQPEIDRIKNLYSDDKARLNQEIM-ALYKKEKVNPVA 428

Query: 429 GCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFM 488
           GC PIL+QIPVFF+IYKV+ +++EMR APF+GWIKDL+A DPT IF LFG+LPF  P F+
Sbjct: 429 GCLPILVQIPVFFSIYKVLYVTIEMRQAPFYGWIKDLSAPDPTTIFNLFGLLPFLPPSFL 488

Query: 489 HVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVI 548
            +G WPI+M+++MF+Q KMSP PAD  QA ++ +MP++F+F  SSFP GL+IYWSW+N++
Sbjct: 489 MIGAWPILMAITMFLQQKMSPEPADPMQAQVMKFMPLIFLFMFSSFPVGLLIYWSWNNIL 548

Query: 549 SIVQQAVIMKMH 560
           SI+QQ  I K +
Sbjct: 549 SIIQQYYINKFN 560


>gi|39933709|ref|NP_945985.1| putative inner membrane protein translocase component YidC
           [Rhodopseudomonas palustris CGA009]
 gi|39647556|emb|CAE26076.1| 60 kDa inner membrane protein [Rhodopseudomonas palustris CGA009]
          Length = 622

 Score =  466 bits (1200), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 248/619 (40%), Positives = 359/619 (57%), Gaps = 43/619 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSY------- 53
           M  N N  +A+ LS +++  WQ F+  P++E+    ++  Q   +      +        
Sbjct: 1   MSDNRNTILAVVLSGLVLLGWQYFFNIPQMEKQRAAQQAQQQAAKQQAETQTPGAASPAA 60

Query: 54  ------------------AAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLR 95
                             AA     R  AL+  PR++++ P L GSI LKGA+ DDL L 
Sbjct: 61  APAAPGAPGSAPASPQQPAAAPTVSREAALAAGPRIKVETPRLSGSIALKGARIDDLALM 120

Query: 96  GYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWNLISGKILTPTT 154
            Y   V   SP + L SPS +   Y+AE  +V  A  +++LP+ NT+W       LTP  
Sbjct: 121 QYRETVDPKSPPIELFSPSGSARPYYAEFGWVGAAGASVKLPDHNTLWEQEGTGALTPAN 180

Query: 155 PIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTF 214
           P+ L + N   + F R I++D+ YLF + D VTN     +   P   I RH        +
Sbjct: 181 PVTLKWDNGEGLTFRRQITVDDRYLFTVKDDVTNTGGAPVTLYPFALISRHGTPHVEGYY 240

Query: 215 GVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQ 274
            + EG I  LGD+ L E  YS I+++    F  +N WLGI+DKYWAS  +P       ++
Sbjct: 241 ILHEGLIGYLGDQGLQEYSYSKIDEAKSVGFKATNGWLGITDKYWASALLPDTSAQLQAR 300

Query: 275 FKYLSDGH-ARYQAKFSANEITILPGKSITTTNFLFAGAKE---------FPTIHHYEKD 324
           F     G+   YQ  +  +  T+  G ++T    LFAGAKE         F  +  Y++ 
Sbjct: 301 FSANKVGNVTTYQTDYLEDARTVPIGGTVTANARLFAGAKEARVVGINFPFAGLGGYDRQ 360

Query: 325 LAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYV 384
           L +  F++LIDWGWFYFI KPMF+ + +F++LVGNFG+AI+L TV VKLLF PLA K Y 
Sbjct: 361 LGLNHFDLLIDWGWFYFITKPMFLALDFFFHLVGNFGVAILLVTVLVKLLFLPLANKSYA 420

Query: 385 STANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIY 444
           S A MK IQP++  L+E+      +  Q+ M+++Y+   INP+AGC PILLQIPVFF++Y
Sbjct: 421 SMAKMKAIQPQLAALKERHPDDKVKQ-QQEMMEIYRKEKINPVAGCLPILLQIPVFFSLY 479

Query: 445 KVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPF------YLPGFMHVGIWPIIMS 498
           KV+ +++EMRHAPF+GWI DL+A DPTNIF LFG++P+       L  ++ +G WP++M 
Sbjct: 480 KVLFVTIEMRHAPFFGWIHDLSAPDPTNIFNLFGLIPYDPTAIPVLGHYLVLGAWPLVMG 539

Query: 499 LSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
            +M+ QMK++P P D  Q MI  WMPV+F F L+ FPAGL+IYW+W+N +S+ QQA IM+
Sbjct: 540 FTMWFQMKLNPQPPDPTQQMIFAWMPVIFTFMLAHFPAGLVIYWAWNNTLSVAQQAFIMQ 599

Query: 559 MHGAEIGLIDRLRSTFSKN 577
            +G ++ L D LR++F+K 
Sbjct: 600 RNGVKVELWDNLRTSFAKK 618


>gi|157825202|ref|YP_001492922.1| putative inner membrane protein translocase component YidC
           [Rickettsia akari str. Hartford]
 gi|166977406|sp|A8GLY9|OXAA_RICAH RecName: Full=Inner membrane protein oxaA
 gi|157799160|gb|ABV74414.1| putative inner membrane protein translocase component YidC
           [Rickettsia akari str. Hartford]
          Length = 560

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 236/557 (42%), Positives = 349/557 (62%), Gaps = 5/557 (0%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQAL 65
           N   AI LS+ I++ WQ F + P  ++   +    +      Q   +      D   Q  
Sbjct: 7   NLIAAIVLSLSIIFGWQYFVIKPEQKKQQQQIAVQKAANLKKQQLKALVEPATDIVVQEE 66

Query: 66  SMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELD 125
           S   R+++++ SL GSI+LKG +FDDL L+ Y  D+S NS  V L SP+NT+++YFAE+ 
Sbjct: 67  SQVQRIKIESESLTGSISLKGLRFDDLILKKYKQDLSKNSSDVVLFSPTNTEHSYFAEIG 126

Query: 126 YVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDT 185
            VS  ++++LPN++T+W+   G+IL+P  P+ L + N + + F  TI++D++YLF I  T
Sbjct: 127 LVSNLSSVKLPNNDTIWSS-DGEILSPEKPVNLFWVNEDGVKFLVTITVDKNYLFTIEQT 185

Query: 186 VTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNF 245
           + NNS  ++     G I R           + +G I  + D++L E  Y DI+      F
Sbjct: 186 IVNNSDKELPIQSYGLINRKYTAVEKAVNILHQGPIGCI-DENLKEYSYDDIKDKKSEKF 244

Query: 246 HESN-SWLGISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILPGKSIT 303
             S   W+GI+DKYW S  IP K +++ S F Y +  G  +YQ  F +    I PG++  
Sbjct: 245 AASKVDWIGITDKYWLSALIPDKSSNYSSNFNYAVKQGIEKYQVDFISPVQIIKPGENFA 304

Query: 304 TTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIA 363
             + +FAGAK+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY  VGNFG++
Sbjct: 305 IKSRIFAGAKKVDLLDQYEKQYDIKLFDRAIDFGWFYIITKPVFYAMNFFYGYVGNFGVS 364

Query: 364 IMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHN 423
           I++ TV +KLL F LA K Y S   +KN+QP+ID ++  +     ++ Q+ M  LYK   
Sbjct: 365 ILIVTVIIKLLMFTLANKSYRSMKKIKNLQPEIDRIKNLYSDDKARLNQEIM-ALYKKEK 423

Query: 424 INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY 483
           +NP+AGC PIL+QIPVFF+IYKV+ +++EMR A F+GWIKDL+A DPT IF LFG+LPF 
Sbjct: 424 VNPVAGCLPILVQIPVFFSIYKVLYVTIEMRQAQFYGWIKDLSAPDPTTIFNLFGLLPFS 483

Query: 484 LPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWS 543
            P F+ +G WPI+M+++MF+Q KMSP PAD  QA ++ +MP++F+F  SSFP GL+IYWS
Sbjct: 484 PPSFLMIGAWPILMAITMFLQQKMSPEPADPMQAQVMKFMPLIFLFMFSSFPVGLLIYWS 543

Query: 544 WSNVISIVQQAVIMKMH 560
           W+N++SI+QQ  I K +
Sbjct: 544 WNNILSIIQQYYINKFN 560


>gi|114569009|ref|YP_755689.1| protein translocase subunit YidC [Maricaulis maris MCS10]
 gi|122316769|sp|Q0ASI6|OXAA_MARMM RecName: Full=Inner membrane protein oxaA
 gi|114339471|gb|ABI64751.1| protein translocase subunit yidC [Maricaulis maris MCS10]
          Length = 592

 Score =  458 bits (1179), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 227/591 (38%), Positives = 366/591 (61%), Gaps = 20/591 (3%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNI---QTVKQPNQVDNSY--AAV 56
           E   N F+A+ L ++I+  +Q F + P  EE   E+  +   Q +  P+   ++   AA 
Sbjct: 3   EDQRNLFIALGLILVILTGYQMFVMGPAEEERRAEQAAVEASQELADPDLPASALEPAAA 62

Query: 57  LIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNT 116
              DR  AL  + RV +  PS++GS++L GA+ DD+ LR +   +  ++P V LL+P  +
Sbjct: 63  TTVDRETALGGNQRVTIDAPSVLGSLSLTGARLDDVRLRRHTETIDDDTP-VALLNPIGS 121

Query: 117 KNAYFAELDYVS-TANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD 175
            + ++A   + S T+   +LP  +T W L SG  LTP TPI L + + + + FER IS+D
Sbjct: 122 DHVFYARDGWTSATSGFTDLPGGSTEWTLASGSTLTPDTPITLTYDSPSGLHFERVISVD 181

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRH--KPQTATNTFGVQEGFIAVLGDKSLVEQK 233
           ++YLF + DTVTNNS  ++  S  G ++RH  +P+  T    V EG +AV+ D ++V   
Sbjct: 182 DNYLFTLTDTVTNNSGQEVELSRYG-LVRHEGRPEDETRNMAVFEGALAVI-DGAMVRSS 239

Query: 234 YSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGH-ARYQAKFSAN 292
           +  +E  + +    +  W+GI+ +YW +  +P ++  F ++F+ +  G    ++A +   
Sbjct: 240 FGKLEDGNQTEESGTGGWVGITQRYWMAAAVPDQDRPFTARFRTIERGEIDAFEASYVEQ 299

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
            I +  G+S+ +T  +FAGAKE   +   + ++ I RF+M I+WGW +F+ +P   L++ 
Sbjct: 300 AIAVPAGESLASTTRIFAGAKELGVLQQVQNEVGIERFDMAINWGWLWFLTRPFVWLLTM 359

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
               +G FG+AI+  T+ VK++ FPLA + Y S A MK +QPK+ E++E++  +  Q  Q
Sbjct: 360 LEGALGQFGLAILALTLMVKIVMFPLANRAYASMAKMKAVQPKMAEIKERYG-ADQQKQQ 418

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           +A+++LYKT  INPLAGC PIL QIP+FFA+Y+ +  ++EMRHAPF+GWI+DL+AADPTN
Sbjct: 419 QALMELYKTEKINPLAGCLPILPQIPIFFALYQTLFNAIEMRHAPFFGWIRDLSAADPTN 478

Query: 473 IFTLFGILPF------YLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVV 526
           I+ LFG++P+       + G + +G WPIIM L+M  Q  ++PPP D  QA I  ++P+V
Sbjct: 479 IWNLFGLIPYDPTGIWLIGGVLGIGAWPIIMGLTMAAQQALNPPPPDPMQARIFAFLPIV 538

Query: 527 FVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           F F L+ F AGL+IYW+W+N +S++QQ +IM+ HG E   +D+L +   K 
Sbjct: 539 FTFILAPFAAGLVIYWAWNNFLSVLQQYIIMRRHGNET-QVDKLVARLLKR 588


>gi|144899247|emb|CAM76111.1| 60 kDa inner membrane insertion protein [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 575

 Score =  454 bits (1169), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 226/578 (39%), Positives = 342/578 (59%), Gaps = 19/578 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPR---IEEMNNERKNIQTVKQPNQVD------- 50
           M    N F+AIALSV+I++ +Q  +++P      E         T   P   D       
Sbjct: 1   MNEQRNLFLAIALSVLILFGFQ--WLFPSKTPAPESAPATTAAGTPPVPTSGDAVVPAPV 58

Query: 51  NSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTL 110
            + A + +  R  AL+ + R+ +  P+L GS+++ GA+ DDL L GYH      S  + L
Sbjct: 59  QTAAQMAVKSRTDALATAKRIRINTPTLHGSLSVTGARLDDLTLAGYHETADPTSKEIEL 118

Query: 111 LSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFER 170
           LSP+   + Y AE  +V     ++ P  +TVW++  G  L+P + + L + N + + F R
Sbjct: 119 LSPTGAAHPYHAEFGWVPVDAGVKTPGPDTVWSVAQGNELSPGSTVVLNWDNGDGLRFVR 178

Query: 171 TISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLV 230
           T+S+DE+Y+F+I   V N     +   P G I R         + + EG + V  D +L 
Sbjct: 179 TVSVDENYMFQIAQRVENYGTKPVTLHPFGLISRTGTPKTEGMYILHEGPLGVF-DGTLK 237

Query: 231 EQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKF 289
           E KY D++K S      +  W+GI+DKYW +  +P ++     +F +  +D   RYQ  F
Sbjct: 238 EHKYDDLKKLSTERNKTTGGWIGITDKYWLTALVPDQKEELTGRFVHQRADNADRYQVDF 297

Query: 290 SANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFML 349
           +     + PG +  TT  LFAGAK    + HY +   + RF++ ID+GWFYF+ KP F L
Sbjct: 298 TGAAKVVAPGAAAETTFHLFAGAKLVSLLDHYTEKFGVERFDLAIDFGWFYFLTKPFFYL 357

Query: 350 MSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQ 409
           +    + +GN G+AI+  TV +K + FPLA K Y S + MK +QP++  L+E+F     +
Sbjct: 358 LKMMNSGLGNMGLAILALTVLIKGIMFPLANKSYASMSKMKLLQPQVKALQERFGDDKVR 417

Query: 410 VLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAAD 469
            LQ+ M+ LYK   +NP++GC PIL+QIPVFFA+YKV+ +++EMRHAPF+GWIKDL+A D
Sbjct: 418 -LQQEMMALYKKEKVNPVSGCLPILIQIPVFFALYKVLFVAIEMRHAPFYGWIKDLSAQD 476

Query: 470 PTNIFTLFGILP----FYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPV 525
           PT I  LFG++P     YLP F+H+G+WP+IM  +M++Q K++P P D  QA ++ ++PV
Sbjct: 477 PTTIMNLFGLIPWDPALYLPAFLHIGVWPLIMGATMWLQQKLNPQPLDPVQAKMMMFLPV 536

Query: 526 VFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           VF F L  F AGL+IYW+WSN++SI QQ VIM+ +G +
Sbjct: 537 VFTFMLGQFAAGLVIYWAWSNILSIAQQWVIMRKYGVK 574


>gi|163795447|ref|ZP_02189414.1| 60 kDa inner membrane insertion protein [alpha proteobacterium
           BAL199]
 gi|159179433|gb|EDP63964.1| 60 kDa inner membrane insertion protein [alpha proteobacterium
           BAL199]
          Length = 584

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 225/581 (38%), Positives = 342/581 (58%), Gaps = 23/581 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNN------------ERKNIQTVKQ--- 45
           M    N  +AI LSV+I+  +Q     P+I++               +  ++    Q   
Sbjct: 1   MTDQKNMILAIVLSVLILLGFQFLVERPKIDQQRQQQAQQQGQTSQADGSSVPVPGQSTA 60

Query: 46  ---PNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVS 102
              P    +S      + R  AL++SPR+ +  P + GSI LKGA+ DD+ L  Y + + 
Sbjct: 61  PSAPGAARDSAGQTAGESREAALALSPRITISTPRVQGSIALKGARIDDVVLTDYRVTID 120

Query: 103 SNSPIVTLLSPSNTKNAYFAELDYVS-TANNIELPNSNTVWNLISGKILTPTTPIKLVFK 161
             SP + LL P+  K+ Y+AE  +V+ + +++ +P   T+W   S   LTP  P+ L + 
Sbjct: 121 PKSPPIHLLDPTGLKHPYYAEFGWVAASGSSVAVPTPETIWTTDS-TTLTPERPVTLSWS 179

Query: 162 NANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFI 221
           N     FERTI++D+ Y+F +   V N S D I   P G I R       + + + EG +
Sbjct: 180 NGQGQTFERTIAIDKDYMFTVSQRVVNKSTDAITLYPYGLISRGGTPETLDFYILHEGPL 239

Query: 222 AVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKY-LSD 280
            V  D +L E  YSD+ +        +  W+GI+DKYW +  +P +  +++  F++ + +
Sbjct: 240 GVFND-TLTEINYSDLREDGDVQRAATGGWIGITDKYWLAALVPGQGQTWNYNFRHSVRN 298

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
              RYQ  F     +I  G++ +T N LFAGAK    +  YE+   +  F++ ID+GWFY
Sbjct: 299 QSDRYQVDFLGEATSIAAGETASTENRLFAGAKLVKVLDRYEEQYGVANFDLAIDFGWFY 358

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           F+ KP F ++++ + L+GNFG+AI+  T+ VKLLFFPLA K Y S A MK + PK+ E+R
Sbjct: 359 FLTKPFFYVLTWLHALLGNFGLAILGLTICVKLLFFPLANKSYASMAKMKALTPKLQEMR 418

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           EK      Q L   M+ LYK   +NP AGC PI++QIPVFFA+YK + +++EMRHAPF+G
Sbjct: 419 EKHGDDR-QRLNDEMMALYKREKVNPAAGCLPIVIQIPVFFALYKTLFVNIEMRHAPFYG 477

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMIL 520
           WIKDL+A DPT IF L G++P+  P F+ +GIWP++M ++MF+Q K++P PAD  QA I 
Sbjct: 478 WIKDLSAPDPTTIFNLLGVIPWDPPQFLMIGIWPVLMGITMFLQQKLNPAPADPVQAKIF 537

Query: 521 NWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHG 561
            ++P++F F L  F AGL+IYW+W+N++SI QQ +IM+  G
Sbjct: 538 MFLPLMFTFLLGHFAAGLVIYWTWNNLLSITQQWIIMRRMG 578


>gi|329888537|ref|ZP_08267135.1| membrane protein insertase, YidC/Oxa1 family, N-terminal
           domain-containing protein [Brevundimonas diminuta ATCC
           11568]
 gi|328847093|gb|EGF96655.1| membrane protein insertase, YidC/Oxa1 family, N-terminal
           domain-containing protein [Brevundimonas diminuta ATCC
           11568]
          Length = 600

 Score =  445 bits (1145), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 225/537 (41%), Positives = 324/537 (60%), Gaps = 17/537 (3%)

Query: 55  AVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPS 114
            V I DRAQAL    RV ++ P+L GS++L+GA+ DDL L  Y   +  NSP V L  P 
Sbjct: 65  GVFIKDRAQALGTVARVPIQTPTLKGSLSLQGARIDDLYLTRYRETLDKNSPPVELFRPQ 124

Query: 115 NTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISL 174
             ++AYFA+  +        +P  NTVW L  G  LTPTTP++L + N + + F R +S+
Sbjct: 125 GMEHAYFAQFGWSGPNVAGGVPGPNTVWRLTKGSTLTPTTPVELTWDNGSGLRFTRVVSI 184

Query: 175 DEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHK-PQTATNTFGVQEGFIAVLGDK---SLV 230
           D+ Y+F + DTV N     I  +P GR+ R   P        + EG I   GD    S  
Sbjct: 185 DDQYMFTVKDTVANLGTQAIAIAPYGRVERQGVPVDLGKQMILHEGAIGTFGDGGGYSTE 244

Query: 231 EQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYL-SDGHARYQAKF 289
           + KY D  K        +  WLGI+DKYW +  IP+++ +   +F    + G   ++A  
Sbjct: 245 QVKYKDWAKKPRIENQSTGGWLGITDKYWLAALIPTQDETIEGRFSVRDAQGMNIHEAAM 304

Query: 290 SANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFML 349
                TI PG+ I  T  LFAGAK    +  YE+ L +PRF   IDWG F+F+ +P+F +
Sbjct: 305 LGATHTIQPGRQIEETQRLFAGAKRAEVLKAYEQSLNLPRFVYAIDWGMFWFLTRPIFTV 364

Query: 350 MSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQ 409
           + +FY ++GNFG+AI+  TV VKL+ FPLA K Y S + M+N+QPK++E+++K   S PQ
Sbjct: 365 VEFFYGVLGNFGLAILALTVVVKLILFPLANKSYESLSKMRNLQPKMEEIKKKHG-SEPQ 423

Query: 410 VLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAAD 469
             Q+ M+ LY+   INPLAGC P+++QIPVF+A+YKV+ +++EMRHAPF+GWI+DL+A D
Sbjct: 424 KQQQEMMALYQREKINPLAGCLPMVVQIPVFYALYKVLFVTIEMRHAPFFGWIRDLSARD 483

Query: 470 PTNIFTLFGILPF----------YLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMI 519
           P+ I+ LFG +P+           L G +H+G+ P++   +M++QM M+PP  D  Q  I
Sbjct: 484 PSTIWNLFGAIPWDPATLPILGGILNGPLHLGVLPLVYGFTMWLQMAMNPPAQDPMQRQI 543

Query: 520 LNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSK 576
              MP+VF F ++ F AGL+IYW+W+NV+SI+QQ VIM    AE   ID   + F K
Sbjct: 544 FALMPIVFTFIMAPFAAGLLIYWAWNNVLSIIQQYVIMHRFKAE-NPIDAFLARFKK 599


>gi|209965568|ref|YP_002298483.1| hypothetical protein RC1_2283 [Rhodospirillum centenum SW]
 gi|209959034|gb|ACI99670.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 602

 Score =  445 bits (1144), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 233/594 (39%), Positives = 333/594 (56%), Gaps = 35/594 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPR---IEEMNNERKNIQTVKQPNQVDNSYAA-- 55
           M    N  +AI +SV I++ +  FY  PR   +EE   ++  +Q    P  V    A   
Sbjct: 1   MTDQKNLILAIVISVAILFGFNYFYERPRQQALEEYRQQQAALQAETAPAAVPGVTAPGS 60

Query: 56  ------------------------VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDD 91
                                       DR   L  S RV++  P L GS+NL+G + DD
Sbjct: 61  TVPGPAGDIPVPAPGAPAPTDAVPAAPRDRGAVLGDSQRVQVDTPRLHGSVNLRGGRIDD 120

Query: 92  LNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNI--ELPNSNTVWNLISGKI 149
           L L  YH+    +SP V LLSP  T   YFAE  +V TA+     LP   T W  +S   
Sbjct: 121 LTLANYHVTPDKSSPEVVLLSPVGTSQPYFAEFGWVPTADTAGQPLPGPTTDWQPVSQGP 180

Query: 150 LTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT 209
           LTP +P+ L + N   ++FER I++D  Y+F +   VTN S   +   P G + R    T
Sbjct: 181 LTPDSPVVLRWDNGQGLVFEREIAIDRDYMFTVTQRVTNQSGQPVTLHPYGFVQRRGTPT 240

Query: 210 ATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSS-ISNFHESNSWLGISDKYWASVFIPSKE 268
            +  F + EG + V  D +L E  YSD++ S+  +    +  W G +DKYW    +P + 
Sbjct: 241 TSGFFILHEGALGVF-DGTLREFDYSDLKDSTQPATQTTTGGWFGFTDKYWLVTLVPDQA 299

Query: 269 TSFHSQFKYLSDG-HARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAI 327
           +    +  +   G    YQ  F    +T+ PG +  +T+ LFAGAK   T+  YE +L I
Sbjct: 300 SPVDVRVLHQDQGGQPLYQVDFRGQGLTVAPGATAESTHRLFAGAKIVRTLDAYESELGI 359

Query: 328 PRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTA 387
            RF   +DWGWFYF+ KP F  +      +GNFGIAI++ TV ++L FFPLA KQY + A
Sbjct: 360 ARFSYAVDWGWFYFLTKPFFYGLDLLGQALGNFGIAILVFTVLLRLAFFPLANKQYKAFA 419

Query: 388 NMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVI 447
            MK +QPK++ELR++      Q L  A ++LYK   +NPL+GC PILLQIPVFFA+YKV+
Sbjct: 420 KMKLLQPKMEELRKRHGDDR-QKLSMATMELYKQEKVNPLSGCLPILLQIPVFFALYKVL 478

Query: 448 SISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKM 507
            +++EMRHAPF+GWI DL+A DPT +F LFG++P+  PGF+ VG  P++M  +M++Q K+
Sbjct: 479 FVTIEMRHAPFYGWITDLSAPDPTTVFNLFGLIPWSPPGFLMVGALPLMMGFTMWLQQKI 538

Query: 508 SPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHG 561
           SP   D  Q  I   +P +F + +++FPAGL+IYW+WSN+++I QQ  IM+  G
Sbjct: 539 SPANPDPIQQRIFMVLPFLFTYMMAAFPAGLVIYWTWSNLLAIAQQWYIMRRMG 592


>gi|23015970|ref|ZP_00055732.1| COG0706: Preprotein translocase subunit YidC [Magnetospirillum
           magnetotacticum MS-1]
          Length = 578

 Score =  442 bits (1136), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 223/575 (38%), Positives = 340/575 (59%), Gaps = 19/575 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFY--VYPRIEEMN---------NERKNI---QTVKQP 46
           M    N FVAIA+SV I+  WQ F+    P +E+           +   N+    T   P
Sbjct: 1   MNDQRNLFVAIAISVAILIGWQYFFPTAKPPVEQAAQQQAAEVKASAPANVPSPATASSP 60

Query: 47  NQVDNSYAAVLID--DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
            QV  + AA       R +AL  S R+ ++ PS+ GSI L GA+ DD+ L  Y    +++
Sbjct: 61  AQVPGTPAAAAQTGASRNEALGKSRRIAIQTPSMHGSIALTGARIDDITLVKYRETPAAD 120

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           S  + L+SP+ +   Y+AE  +V+T  N+++P   +VW       LT  +P+ L + N  
Sbjct: 121 SAEIDLMSPAESPEPYWAEFGWVATDANVKVPGPESVWQAQGTGPLTQASPVVLTWDNGE 180

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVL 224
            + F RT ++DE+Y+F +   V N         P   + R         + + EG + V 
Sbjct: 181 GLRFVRTYTVDENYMFGVTQRVENYGTKAASLHPYALLARTGTPHVAGMYILHEGPLGVF 240

Query: 225 GDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA- 283
            D +L E KY D++K   + +  +  W GI+DKYW +  +P  +T    +F +   G+A 
Sbjct: 241 -DGTLKEMKYDDLKKEGSARYKTTGGWAGITDKYWLTALVPPAKTEITGRFVHQRLGNAD 299

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
           RYQ  + A    I  GK+      LF GAK+   +  Y +   I RF++ ID+GWFYF+ 
Sbjct: 300 RYQVDYLAPARVIEAGKTEEAGFHLFTGAKQVSLLDGYGEKFGIDRFDLAIDFGWFYFLT 359

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           KP F L+   ++ +GN G+AI+  TV +KL  FPLA K YV+   MK +QPK+ EL+ ++
Sbjct: 360 KPFFYLLQMLHSALGNMGLAILALTVILKLAMFPLANKSYVAMGKMKKLQPKVQELQARY 419

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
                + LQ+ M+ LYK   +NP++GC PI++QIPVFFA+YKV+ +++EMRHAPF+GWI 
Sbjct: 420 ADDKMR-LQQEMMALYKAEKVNPVSGCLPIMVQIPVFFALYKVLFVTIEMRHAPFYGWIS 478

Query: 464 DLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWM 523
           DL+A DPTNIFTLFG++P+  P  MH+G+WP+IM ++M++Q K++P P D  QA ++ ++
Sbjct: 479 DLSAQDPTNIFTLFGLIPWTPPHIMHLGVWPLIMGITMYLQQKLNPQPTDPVQAKMMQFL 538

Query: 524 PVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           P++F F L++F +GL+IYW+WSN +SI+QQ VIMK
Sbjct: 539 PLIFTFLLANFASGLVIYWAWSNTLSILQQWVIMK 573


>gi|83859293|ref|ZP_00952814.1| putative inner membrane protein translocase component YidC
           [Oceanicaulis alexandrii HTCC2633]
 gi|83852740|gb|EAP90593.1| putative inner membrane protein translocase component YidC
           [Oceanicaulis alexandrii HTCC2633]
          Length = 672

 Score =  441 bits (1135), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 229/598 (38%), Positives = 360/598 (60%), Gaps = 28/598 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNN-ERKNIQTVKQ------PNQVDNSY 53
           M  N N+ +A  +++ I++ +Q F + P   +    E+   +T  Q      P   D+ +
Sbjct: 1   MGENRNFLLAAVIAIGILFFYQAFILDPMARDREAAEQATAETQVQETGDDAPQATDSGF 60

Query: 54  AAVLIDD---RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTL 110
           AA L ++   R  AL+ S R+E++  +L GS++L GA+ DDL L  Y  +V S  P VTL
Sbjct: 61  AAGLGENGMSREDALARSQRIEIRTEALSGSLSLTGARIDDLQLLRYETEVDSGVP-VTL 119

Query: 111 LSPSNTKNAYFAELDYVSTANNIE-LPNSNTVWNLISGKILTPTTPIKLVFKNANNILFE 169
           +SP       FA   ++  AN  + LP  +T W L+ G +LT TTP+ L    A ++ F 
Sbjct: 120 MSPEGFDGYQFAASGWLGGANAPQGLPGLSTNWTLVEGDVLTETTPVVLEHA-AGDLTFR 178

Query: 170 RTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHK-PQTATNTFGVQEGFIAVLGDKS 228
           RTIS+DE+YLF + DTV NN    +   P   + +H  P    N F + EG + V+ D +
Sbjct: 179 RTISVDENYLFTVNDTVINNGSAAVSLRPYALVRQHGVPADLQNFFVLHEGAVGVI-DGT 237

Query: 229 LVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD-GHARYQA 287
             ++K+   E   +   +    W+GI+ KYW +   P  + +  +QF+ +S      +++
Sbjct: 238 HFDRKFKKWEDEGLIERNGPGGWMGITSKYWLAAVAPEGQPNVRAQFRVVSRPDRPVFES 297

Query: 288 KFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMF 347
            + ++  T+ PG ++ +T+++FAGAK+ P +  YE DL I R  M IDWG F+F+ +P F
Sbjct: 298 NYLSDAETLAPGATLESTSYVFAGAKKQPILAAYENDLGIDRLTMAIDWGMFWFLTRPFF 357

Query: 348 MLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSP 407
             + +FY ++GN+G+AIM+ T+ +KL+ FPL  + + S A M++  PK+ E+RE++K   
Sbjct: 358 AALHFFYGVLGNYGLAIMVVTLLIKLVLFPLNNRAFASMAKMRSAAPKMTEIRERYKDD- 416

Query: 408 PQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAA 467
           PQ  QKAM++LY+   INP+AGC P+L QIP+FFA+YK + ISL+ RHAPF+GWI+D++A
Sbjct: 417 PQAQQKAMMELYRKERINPVAGCLPMLPQIPIFFALYKTVFISLDARHAPFFGWIQDMSA 476

Query: 468 ADPTNIFTLFGILPFYLPGF------MHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILN 521
            DPT I  LFG+LP+   G       + +G+WP++M ++M+ Q  ++PPPADK Q  I  
Sbjct: 477 PDPTMIGNLFGLLPYDPSGLPIVGPILAIGVWPLLMGVTMWAQQSLNPPPADKIQRQIFA 536

Query: 522 WMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDR----LRSTFS 575
           +MPV+F   ++ FPA LIIYWSW+N ++I QQ +IM+  G  +  +DR    LRS  +
Sbjct: 537 FMPVIFTIIMAPFPAALIIYWSWNNTLTIGQQYLIMRRQGV-VTELDRNFFKLRSKLT 593


>gi|330813521|ref|YP_004357760.1| inner membrane protein translocase component YidC, long form
           [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486616|gb|AEA81021.1| inner membrane protein translocase component YidC, long form
           [Candidatus Pelagibacter sp. IMCC9063]
          Length = 564

 Score =  437 bits (1125), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 222/560 (39%), Positives = 339/560 (60%), Gaps = 14/560 (2%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPRIE-EMNNERKNIQTV------KQPNQVDNSYAAVLI 58
           N   AI LS II+  WQ   + P I+ E     K IQT         P+           
Sbjct: 5   NILTAIILSTIIIVGWQVLVIDPEIKKEQAKVEKTIQTKPTAGKPSAPSLNKKIQVQKKK 64

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
             R +AL    RV+L N  + GSI+L GA  DD+ L+ Y   +  NS  V +L+P     
Sbjct: 65  VSRQEALLTDQRVKLDNAKITGSISLVGALIDDVTLKNYQESLDENSKQVVILNPKKINK 124

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHY 178
            Y+ E  + S ANNI +P++N+VW L   + LTP TPI+L + N N ++F + I +D+ Y
Sbjct: 125 GYYLESGWAS-ANNINVPDNNSVWKLTRNRTLTPRTPIELEWDNQNGLVFTKKIEVDDQY 183

Query: 179 LFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIE 238
           LF I +++ NNS   +      +I R +     + + + EG + V+ D++L E+ Y D+ 
Sbjct: 184 LFSITESIKNNSKANVDLFHYSQITRKEKPQVQDFYILHEGLVGVI-DETLQEEDYDDV- 241

Query: 239 KSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILP 298
           K     +  ++ WLGI+DKYW +  +P K+ +F+++F Y +   A Y      N  +I  
Sbjct: 242 KDKNQKYQGTSGWLGITDKYWLTAIVPQKKQAFNAEFIYDTAYKANY---ILTNPTSIPS 298

Query: 299 GKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVG 358
           GK  ++++  F GAKE  TI  Y +   I +F++ IDWGWFYF  KP+F ++ Y YN  G
Sbjct: 299 GKINSSSSQFFIGAKEVKTIDGYAESANINKFDLAIDWGWFYFFTKPLFFIIDYLYNFSG 358

Query: 359 NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQL 418
           NFG AI+L T  +++LFFPLA   + S A MK +QP+I  +++ +K    Q +Q  M+ L
Sbjct: 359 NFGWAIVLLTAGIRILFFPLANYSFASMAKMKALQPEIARMKDLYKDDK-QKIQTEMMGL 417

Query: 419 YKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFG 478
           Y+   INP++GC P+L+QIP FFAIYK++ ++LEMRHAPF+GWI+DL+A DPT++F LFG
Sbjct: 418 YRKEKINPVSGCLPMLIQIPFFFAIYKMLFVTLEMRHAPFFGWIQDLSAPDPTSLFNLFG 477

Query: 479 ILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGL 538
           ++P+  P F+ +G+WPI+M +SM+IQ K++P P D  QA I  + P+     L+SFP+GL
Sbjct: 478 LIPWDPPSFLMIGVWPILMGVSMWIQQKLNPAPTDPIQAKIFAFFPLFLTVMLASFPSGL 537

Query: 539 IIYWSWSNVISIVQQAVIMK 558
           ++YW+ +NV+++ QQ VI++
Sbjct: 538 VVYWTVNNVLTMAQQYVIIR 557


>gi|254455826|ref|ZP_05069255.1| 60 kDa inner membrane protein [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207082828|gb|EDZ60254.1| 60 kDa inner membrane protein [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 558

 Score =  437 bits (1124), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 223/556 (40%), Positives = 341/556 (61%), Gaps = 13/556 (2%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPRI--EEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQ 63
           N   AI+LS  ++  +  ++  P I  E++  + K  QT   P+ +D       +  R +
Sbjct: 5   NVIAAISLSAAVIILYSLYFAPPPITKEQLAEKNKTEQTTDAPS-LDQKETITEVS-REE 62

Query: 64  ALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAE 123
           ALS S R++ +N S+IGSI+LKGA  DDL  + Y++ + S+   V LLSP + K+ Y  E
Sbjct: 63  ALSQSKRIKFENQSIIGSISLKGAAIDDLTFKEYNVALESDEK-VKLLSPRSAKDGYLIE 121

Query: 124 LDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIV 183
             +++T  NI++PNSN+ W++    ILT  +P+KL + N   I FE+ ISLD+ +LF I 
Sbjct: 122 SGFITTDKNIDIPNSNSEWSVSGSNILTDQSPVKLTWTNDQGITFEKEISLDDKFLFTIK 181

Query: 184 DTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSIS 243
             V N++  +  F P G+I+R +    +N + + EG IA L D+ L+E+ Y DI++   S
Sbjct: 182 QKVINSTNKEFDFYPYGQIIRKEIPEISNFYILHEGLIATL-DEELIEEDYDDIQEEKFS 240

Query: 244 NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSIT 303
              +   WLGISDK+W +  IP     F + F Y      +++A F   E   L G S  
Sbjct: 241 KTSQ-KGWLGISDKFWITSLIPPNGKEFKTTFDY----KDKFRANFVGTEPLELKGNSSI 295

Query: 304 TTNF-LFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGI 362
                +   AK    I  Y + L I +F++ IDWG+ YFI KP+F  + YF+ L+GN+G+
Sbjct: 296 EDKLQVIVAAKRVDVIDGYAESLNIDKFDLTIDWGFLYFITKPLFYGIDYFFKLLGNYGL 355

Query: 363 AIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTH 422
           AI+  T+ ++L FFPLA   + S A MK +QP++  L++  K+   + LQ+ M+ LYK  
Sbjct: 356 AIIAITICIRLAFFPLANFSFRSMAKMKALQPEMVRLKDLHKEDKMK-LQQEMMALYKKE 414

Query: 423 NINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPF 482
            +NP++GC PIL+QIPVFFA+YKV+ +++EMR  PF+GWI+DL+  DPT++F LFG+LP+
Sbjct: 415 KVNPMSGCLPILVQIPVFFALYKVLFVTIEMRQMPFYGWIQDLSERDPTSLFNLFGLLPY 474

Query: 483 YLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYW 542
            +P F+ +G WPI M +SMFIQ K++P P D  QA I  + P+     L+ FPAGL+IYW
Sbjct: 475 DVPSFLMIGAWPIAMGVSMFIQQKLNPAPTDPMQAKIFMFFPLFLTIILAPFPAGLVIYW 534

Query: 543 SWSNVISIVQQAVIMK 558
           + +N++++ QQ  IMK
Sbjct: 535 TVNNILTMAQQVFIMK 550


>gi|83313455|ref|YP_423719.1| putative inner membrane protein translocase component YidC
           [Magnetospirillum magneticum AMB-1]
 gi|82948296|dbj|BAE53160.1| Preprotein translocase subunit YidC [Magnetospirillum magneticum
           AMB-1]
          Length = 579

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 223/580 (38%), Positives = 332/580 (57%), Gaps = 28/580 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPR---------------------IEEMNNERKN 39
           M    N FVAIA+SV I+  WQ F+   +                               
Sbjct: 1   MNDQRNLFVAIAISVAILIGWQYFFPTAKPPVEQAAQQQSAEQKASAPATAPTPATASSP 60

Query: 40  IQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHL 99
            Q    P       AA   D    AL  S R+ ++ PS+ GSI L GA+ DD+ L  Y  
Sbjct: 61  AQVPGSPAAAAAQPAATRAD----ALGKSRRIAIQTPSMHGSIALTGARIDDITLVKYRE 116

Query: 100 DVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLV 159
             +++S  + L+SP+ +   Y+AE  +V+T  N+++P  ++VW       LTP +P+ L 
Sbjct: 117 TPAADSREIDLMSPAESPEPYWAEFGWVATEANVKVPGPDSVWQAQGSGPLTPASPLVLT 176

Query: 160 FKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEG 219
           + N   + F RT ++DE+Y+F +   V N         P   + R         + + EG
Sbjct: 177 WDNGEGLRFVRTYTVDENYMFGVAQRVENYGTKPASLHPYALLARTGTPHVAGMYILHEG 236

Query: 220 FIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLS 279
            + V  D +L E KY D++K   S    +  W GI+DKYW +  +P  +T    +F +  
Sbjct: 237 PLGVF-DGTLKEMKYDDLKKEGSSRHKTTGGWAGITDKYWLTALVPPAKTEITGRFVHQR 295

Query: 280 DGHA-RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGW 338
            G+A RYQ  + A    I PGKS      LF GAK+   +  Y +   I RF++ ID+GW
Sbjct: 296 LGNADRYQVDYLAPARMIEPGKSEEAGFHLFTGAKQVSLLDGYAEKFGIDRFDLAIDFGW 355

Query: 339 FYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDE 398
           FYF+ KP F L+   ++ +GN G+AI+  TV +KL  FPLA K YV+   MK +QPK+ E
Sbjct: 356 FYFLTKPFFYLLQMLHSALGNMGLAILALTVILKLAMFPLANKSYVAMGKMKKLQPKVQE 415

Query: 399 LREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF 458
           L+ ++     + LQ+ M+ LYKT  +NP++GC PI++QIPVFFA+YKV+ +++EMRHAPF
Sbjct: 416 LQARYADDKMR-LQQEMMALYKTEKVNPVSGCLPIMVQIPVFFALYKVLFVTIEMRHAPF 474

Query: 459 WGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAM 518
           +GWI DL+A DPTNIFTLFG++P+  P   H+G+WP+IM ++MF+Q K++P P D  QA 
Sbjct: 475 YGWISDLSAQDPTNIFTLFGMIPWTPPSMFHLGVWPLIMGVTMFLQQKLNPQPTDPVQAK 534

Query: 519 ILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           ++ ++P++F F L++F +GL+IYW+WSN +SI+QQ VIMK
Sbjct: 535 MMQFLPIIFTFLLANFASGLVIYWAWSNTLSILQQWVIMK 574


>gi|146278901|ref|YP_001169060.1| putative inner membrane protein translocase component YidC
           [Rhodobacter sphaeroides ATCC 17025]
 gi|145557142|gb|ABP71755.1| protein translocase subunit yidC [Rhodobacter sphaeroides ATCC
           17025]
          Length = 628

 Score =  432 bits (1111), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 227/611 (37%), Positives = 351/611 (57%), Gaps = 38/611 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNI----QTVKQPNQVDNSYAAVL 57
           ++N N  +A  LS +++  W  F+++P  E +  +        +T   P+   ++    +
Sbjct: 6   DQNKNLILATGLSFLVIMVW--FFLFPPPEAVTQDEPATVATQETALAPSATPDAPMTAV 63

Query: 58  IDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTK 117
             D    L  +PRV +  P L GSI++ G + DDL+L+ YH  +   S IV LLSP    
Sbjct: 64  PPD--AELPETPRVAIDTPRLQGSISMLGGRIDDLSLKSYHETLDPGSQIVRLLSPVGEP 121

Query: 118 NAYFAELDYVSTA--NNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD 175
           NAY+A   +      +  ++P +NT W  + G  L    P+ L + N   ++F RTIS+D
Sbjct: 122 NAYYALYGWTPAGALDYEDVPGANTTWTQVGGATLGVDQPVTLEWDNGQGLVFTRTISVD 181

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVLGDKSLVEQKY 234
           +HY+F I  TV N + + +R +P G + RH KP    N F + EG +    D  L E  Y
Sbjct: 182 DHYMFTISQTVENRTGEAVRLAPYGIVARHGKPLNLQNFFVLHEGAVG-RADGELTETNY 240

Query: 235 SDI-------EKSSISNFHES--NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARY 285
            DI        + +++   E+  + W+G +DKYW +  IP +   F S  KY+  G   Y
Sbjct: 241 DDIAELPQVAREGALAEVVEAQQDGWIGFTDKYWMTTLIPQQGQPFSSVTKYVP-GADIY 299

Query: 286 QAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAI---------PRFEMLIDW 336
           QA+     +T+ PG +   ++ LFAGAKE+  I  Y+ + AI         P F   IDW
Sbjct: 300 QAETREQLVTVAPGGTAEVSSRLFAGAKEWEAIRAYQNEGAIEPTEGAEPIPGFIDSIDW 359

Query: 337 GWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKI 396
           GWF+F+ KP+F ++ +   ++GN G+AI+  T  +K L  PLA K YVS A MK +QP++
Sbjct: 360 GWFFFLTKPIFAVLHWLNQMIGNMGLAIIALTFLLKALVLPLAYKSYVSMARMKELQPEL 419

Query: 397 DELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHA 456
           + LRE+  +    ++Q+ M++LYK   +NP AGC PIL+QIP+FF++YKVI +++E+RHA
Sbjct: 420 EALRERAGEDK-MLMQREMMRLYKEKQVNPAAGCLPILIQIPIFFSLYKVIFVTIELRHA 478

Query: 457 PFWGWIKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPP 510
           PF+GW+ DL+A DP++IF  FG+ P+  P        + +GI PI++ +SM++Q K++P 
Sbjct: 479 PFFGWLTDLSAPDPSSIFNFFGLAPWAAPTPGSTMALIFIGILPILLGISMWLQQKLNPA 538

Query: 511 PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL 570
           P DK QAMI  WMP VF+F L  F +GL++YW  +NVI+  QQ VIM+ HG    L   +
Sbjct: 539 PTDKAQAMIFAWMPWVFMFMLGHFASGLVLYWIVNNVITFSQQYVIMRSHGHHPDLFGNI 598

Query: 571 RSTFSKNYNSQ 581
           ++ FS+   +Q
Sbjct: 599 KAGFSRKSAAQ 609


>gi|288957364|ref|YP_003447705.1| preprotein translocase YidC subunit [Azospirillum sp. B510]
 gi|288909672|dbj|BAI71161.1| preprotein translocase YidC subunit [Azospirillum sp. B510]
          Length = 577

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 204/503 (40%), Positives = 306/503 (60%), Gaps = 4/503 (0%)

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
           A+ ++   RV++  P+L GS+NL G + DDL L  YH      SP + LL+P+ T  AY+
Sbjct: 77  AEQMAAGTRVKIDTPALHGSVNLVGGRIDDLTLAQYHETPDPKSPEIVLLAPAGTPAAYY 136

Query: 122 AELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFK 181
           AE  +V     +  P + T W    G  LTP  P+ L + N   ++FER I++D  ++F 
Sbjct: 137 AEFGWVPQGAGVATPTATTRWT-ADGAALTPEKPLTLSWDNGQGLVFERKIAVDPDFMFT 195

Query: 182 IVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSS 241
           +  TV N     +   P   + R      +  + + EG + V  + SL E+KY D+ K+ 
Sbjct: 196 VTQTVRNTGAAPVTLLPYSLVSRSGTPHTSGYYILHEGPLGVF-NGSLTEEKYDDVRKAG 254

Query: 242 ISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA-RYQAKFSANEITILPGK 300
                 +  W+GI+DKYW    +P       ++F Y    +A RYQ       +T+ PG 
Sbjct: 255 SIAKDTTGGWIGITDKYWLVSLVPDPSEKVTARFLYNQVANADRYQTDTMGAPVTVAPGA 314

Query: 301 SITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF 360
           S   T  LFAGAK+   +  Y + L I  F++ ID+GWFYF+ KP F  + +   ++GNF
Sbjct: 315 SAENTGRLFAGAKQVKLLDGYSEKLNIKNFDLAIDFGWFYFLTKPFFYALDFLGRIIGNF 374

Query: 361 GIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYK 420
           GIAI++ TV VK +FFPLA K Y + + MK +QPK+ ELREKF     ++ Q+ M  LYK
Sbjct: 375 GIAILVLTVCVKAVFFPLANKSYQAMSKMKALQPKMQELREKFSDDQARMNQELM-ALYK 433

Query: 421 THNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL 480
              ++P++GC PI++QIPVFF++YKV+ +++EMRHAPF+GWI DL++ DPT IF LFG++
Sbjct: 434 REKVSPVSGCLPIVIQIPVFFSLYKVLFVTIEMRHAPFFGWIHDLSSPDPTTIFNLFGLI 493

Query: 481 PFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLII 540
           P+  P  +H+G+WP+IM ++M+ Q KM+P P D  QA +  ++P+VF F L+ FPAGL+I
Sbjct: 494 PWDPPAMLHLGLWPLIMGVTMWFQQKMNPAPPDPVQAKVFQFLPIVFTFMLAGFPAGLVI 553

Query: 541 YWSWSNVISIVQQAVIMKMHGAE 563
           YW+W+N +S++QQ  IMK  G +
Sbjct: 554 YWAWNNTLSVLQQWTIMKRMGVK 576


>gi|83594668|ref|YP_428420.1| putative inner membrane protein translocase component YidC
           [Rhodospirillum rubrum ATCC 11170]
 gi|83577582|gb|ABC24133.1| protein translocase subunit yidC [Rhodospirillum rubrum ATCC 11170]
          Length = 595

 Score =  428 bits (1101), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 209/511 (40%), Positives = 314/511 (61%), Gaps = 4/511 (0%)

Query: 54  AAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSP 113
           AA L  + A A  +SPR+ +    L GSI L+GA+ DDL+L  Y   V   SP ++LLSP
Sbjct: 87  AASLSREEALAADISPRIGIDTARLHGSIRLRGARIDDLSLVDYRETVDPQSPEISLLSP 146

Query: 114 SNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTIS 173
                 Y+AE  +V+    +++P+++T+W    G  L    P+ L + N   + F R I+
Sbjct: 147 PGAPLPYYAEFGWVAGTPGVKVPDADTLWQADRGA-LGVDAPVTLTWDNGEGLRFIRKIA 205

Query: 174 LDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQK 233
           +D  ++F I   V N     +   P G + R       N + + EG + V  D +L E K
Sbjct: 206 IDHDFMFSITQAVENTGAGAVTLFPYGLVSRINTPALLNYYILHEGPLGVF-DGTLKEVK 264

Query: 234 YSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYL-SDGHARYQAKFSAN 292
           YS ++         +  W+GI+DKYW +  +  +      +F Y   DG   YQA F   
Sbjct: 265 YSALKDDGEVKHTSTGGWMGITDKYWLTALVTDQSMPVTGRFLYQPRDGRDGYQADFLGA 324

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
             T+ PG  I T+N LF+GAKE   +  Y  +L I  F++ ID+GWFYF+ KP F+ + +
Sbjct: 325 AFTVEPGGRIETSNHLFSGAKEVKLLDRYTDELGIKNFDLAIDFGWFYFMTKPFFLSIQF 384

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
            + ++GN G+AI+  TV +KL+FFPLA K Y S + MK +QP++ +L+E+FK    + L 
Sbjct: 385 LHGILGNMGLAILAFTVVLKLVFFPLANKSYRSMSKMKLLQPELKKLQERFKDDRAR-LN 443

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           + M+ LYK   +NPL+GC PI++QIPVFFA+YKV+ +S+EMRH PF+GWI+DLAA DPT 
Sbjct: 444 QEMMSLYKKEQVNPLSGCLPIVIQIPVFFALYKVLFVSIEMRHEPFYGWIRDLAAPDPTT 503

Query: 473 IFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALS 532
           +F LFG++P+  P  + +G WP+IM ++M++Q K++P PAD  QA I+ ++P++F F L+
Sbjct: 504 VFNLFGLIPWDPPNMLMLGAWPLIMGVTMWMQQKLNPTPADPTQAKIMMFLPIMFTFMLA 563

Query: 533 SFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
            F AGL+IYW+W+N++SI QQ VIMK  GA+
Sbjct: 564 HFAAGLVIYWTWNNLLSITQQWVIMKRMGAK 594


>gi|197103856|ref|YP_002129233.1| preprotein translocase subunit [Phenylobacterium zucineum HLK1]
 gi|254773009|sp|B4RDV5|OXAA_PHEZH RecName: Full=Inner membrane protein oxaA
 gi|196477276|gb|ACG76804.1| preprotein translocase subunit [Phenylobacterium zucineum HLK1]
          Length = 598

 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 207/511 (40%), Positives = 310/511 (60%), Gaps = 16/511 (3%)

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           R  A++ +PRV++  P L GS++L+GA+ DDL L  +   V  +SP V LL P   +  +
Sbjct: 68  RQAAVAATPRVKIDTPMLTGSLSLRGARIDDLYLDRFRQTVEKDSPPVELLRPEGAQYPW 127

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF 180
           FAE+ +V  AN   LP+S  VW L  G  L P  P+ L + N   + F R I +D+ YLF
Sbjct: 128 FAEVGWVG-ANVPGLPDSGAVWTLAQGSTLAPGQPVVLTYANGQGLTFTRRIEVDDRYLF 186

Query: 181 KIVDTVTNNSIDQIRFSPRGRIMRHK-PQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEK 239
            I DTV N +   +  +P G + R   P        V EG I  L D  L + KY    K
Sbjct: 187 TITDTVANTTGQPVTIAPYGTVQRQGVPADLGKNQIVHEGAIGWL-DGKLRQVKYGKWRK 245

Query: 240 SSIS-NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYL-SDGHARYQAKFSANEITIL 297
                 ++ +  WLGI+DKYW +  IP ++ +   QF+   + G     A F    +TI 
Sbjct: 246 EGGGPAYNSTGGWLGITDKYWLAALIPGQQEAVTGQFRRTQAPGVDVLDANFVGAPVTIP 305

Query: 298 PGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLV 357
            G+ ++ T   FAGAK+ P +  YE+ L +  F+  +DWG F+F+ +P+F  + + +  +
Sbjct: 306 AGRQVSETTRFFAGAKQVPILRDYEQSLGVAHFDNAVDWGNFWFLTRPIFQFLEFIHRYI 365

Query: 358 GNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQ 417
           G FG+AI+  TV V+L+FFPLA KQY S   MK +QP+++ELR+K+K  P +  Q+ ++ 
Sbjct: 366 GTFGLAILALTVVVRLIFFPLANKQYESITKMKKVQPQMEELRKKYKDDPAK-QQQELLA 424

Query: 418 LYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLF 477
           LY+   +NPLAGC P+LLQIPVF+A+YKV+++++EMRHAPF GWI+DL+A DPT I+ LF
Sbjct: 425 LYQREKVNPLAGCLPLLLQIPVFYALYKVLTVTIEMRHAPFMGWIQDLSARDPTTIWNLF 484

Query: 478 GILPF----------YLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVF 527
           G++P+          +L G +H+G+ PI+   +M++ M MSPP  D  Q  I   MP++F
Sbjct: 485 GLIPWDPASAPLIGAFLNGPLHLGVLPILYGFTMWLTMAMSPPAGDPIQQKIFQLMPIIF 544

Query: 528 VFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
            F ++ F  GL+IYW+WSNV++++QQ VIM+
Sbjct: 545 TFIMAPFAVGLLIYWTWSNVLTLLQQYVIMR 575


>gi|126463485|ref|YP_001044599.1| putative inner membrane protein translocase component YidC
           [Rhodobacter sphaeroides ATCC 17029]
 gi|166977405|sp|A3PNB1|OXAA_RHOS1 RecName: Full=Inner membrane protein oxaA
 gi|126105149|gb|ABN77827.1| protein translocase subunit yidC [Rhodobacter sphaeroides ATCC
           17029]
          Length = 623

 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 224/610 (36%), Positives = 348/610 (57%), Gaps = 37/610 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNI---QTVKQPNQVDNSYAAVLI 58
           ++N N  +A  LS +++  W  F+++P  E +      +   QT   P+   ++    + 
Sbjct: 3   DQNKNLILATGLSFLVIMVW--FFLFPPPEAVTEGETTVATQQTAVAPSATPDAPTTAVP 60

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
            D    L  + RV +  P L GSI++ G + DDL+L+ YH  +   S IV LLSP    N
Sbjct: 61  PD--AELPETQRVVIDTPRLQGSISMLGGRLDDLSLKSYHETLDPQSQIVRLLSPVGQPN 118

Query: 119 AYFAELDYVSTA--NNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE 176
           AY+A   +         ++P +NT W  +    L    P+ L + N   ++F RTIS+D+
Sbjct: 119 AYYALYGWTPAGALGYEDVPGANTTWTQVGSGALGVDQPVTLQWDNGKGLVFTRTISVDD 178

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
           HY+F +  TV NNS   ++ +P G + RH KP    N F + EG +    D  L E KY 
Sbjct: 179 HYMFSVAQTVENNSGQAVQLAPYGIVARHGKPLNLQNFFVLHEGVVG-RADGKLTETKYD 237

Query: 236 DI-EKSSISNFH--------ESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQ 286
            + E   ++           + + W+G +DKYW +  IP +   F S  KY+  G   YQ
Sbjct: 238 KVAELPQVAREGAQAEVIDAQQDGWIGFTDKYWMTTLIPQQGQPFTSVTKYVP-GADIYQ 296

Query: 287 AKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLA---------IPRFEMLIDWG 337
           A+     +T+ PG +   ++ LFAGAKE+ TI  Y+ + A         IP F   IDWG
Sbjct: 297 AETREQLVTVAPGATAEVSSRLFAGAKEWETIRAYQNEGATEPTEGAEPIPGFIDSIDWG 356

Query: 338 WFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKID 397
           WF+F+ KP+F ++ +  +++GN G+AI+  T  +K L  PLA K YVS A MK +QP+++
Sbjct: 357 WFFFLTKPIFTVLHWLNHMIGNMGLAIIALTFLLKALVLPLAYKSYVSMARMKELQPELE 416

Query: 398 ELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAP 457
            LRE+       ++Q+ M++LYK   +NP AGC PIL+QIP+FF++YKVI +++E+RHAP
Sbjct: 417 ALRERAGDDK-MLMQREMMRLYKEKQVNPAAGCLPILIQIPIFFSLYKVIFVTIELRHAP 475

Query: 458 FWGWIKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPP 511
           F+GW+KDL+A DP++IF  FG+ P+  P        + +G  PI++ +SM++Q K++P P
Sbjct: 476 FFGWLKDLSAPDPSSIFNFFGLAPWAAPTPGTTMALIFIGALPILLGVSMWLQQKLNPAP 535

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLR 571
            DK QAMI  WMP VF+F L  F +GL++YW  +N+I+  QQ VIM+ HG    +   ++
Sbjct: 536 GDKAQAMIFAWMPWVFMFMLGHFASGLVLYWIVNNLITFTQQYVIMRSHGHHPDIFGNIK 595

Query: 572 STFSKNYNSQ 581
           ++FS+   +Q
Sbjct: 596 ASFSRKPAAQ 605


>gi|332559538|ref|ZP_08413860.1| membrane protein insertase [Rhodobacter sphaeroides WS8N]
 gi|332277250|gb|EGJ22565.1| membrane protein insertase [Rhodobacter sphaeroides WS8N]
          Length = 623

 Score =  425 bits (1093), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 224/610 (36%), Positives = 348/610 (57%), Gaps = 37/610 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNI---QTVKQPNQVDNSYAAVLI 58
           ++N N  +A  LS +++  W  F+++P  E +      +   QT   P+   ++    + 
Sbjct: 3   DQNKNLILATGLSFLVIMVW--FFLFPPPEAVTEGEPTVATQQTAVAPSATPDAPTTAVP 60

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
            D    L  + RV +  P L GSI++ G + DDL+L+ YH  +   S IV LLSP    N
Sbjct: 61  PD--AELPETQRVVIDTPRLQGSISMLGGRLDDLSLKSYHETLDPQSQIVRLLSPVGQPN 118

Query: 119 AYFAELDYVSTA--NNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE 176
           AY+A   +         ++P +NT W  +    L    P+ L + N   ++F RTIS+D+
Sbjct: 119 AYYALYGWTPAGALGYEDVPGANTTWTQVGSGALGVDQPVTLQWDNGKGLVFTRTISVDD 178

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
           HY+F +  TV NNS   ++ +P G + RH KP    N F + EG +    D  L E KY 
Sbjct: 179 HYMFSVAQTVENNSGQAVQLAPYGIVARHGKPLNLQNFFVLHEGVVG-RADGKLTETKYD 237

Query: 236 DI-EKSSISNFH--------ESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQ 286
            + E   ++           + + W+G +DKYW +  IP +   F S  KY+  G   YQ
Sbjct: 238 KVAELPQVAREGAQAEVIDAQQDGWIGFTDKYWMTTLIPQQGQPFTSVTKYVP-GADIYQ 296

Query: 287 AKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLA---------IPRFEMLIDWG 337
           A+     +T+ PG +   ++ LFAGAKE+ TI  Y+ + A         IP F   IDWG
Sbjct: 297 AETREQLVTVAPGATAEVSSRLFAGAKEWETIRAYQNEGATEPTEGAEPIPGFIDSIDWG 356

Query: 338 WFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKID 397
           WF+F+ KP+F ++ +  +++GN G+AI+  T  +K L  PLA K YVS A MK +QP+++
Sbjct: 357 WFFFLTKPIFTVLHWLNHMIGNMGLAIIALTFLLKALVLPLAYKSYVSMARMKELQPELE 416

Query: 398 ELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAP 457
            LRE+       ++Q+ M++LYK   +NP AGC PIL+QIP+FF++YKVI +++E+RHAP
Sbjct: 417 ALRERAGDDK-MLMQREMMRLYKEKQVNPAAGCLPILIQIPIFFSLYKVIFVTIELRHAP 475

Query: 458 FWGWIKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPP 511
           F+GW+KDL+A DP++IF  FG+ P+  P        + +G  PI++ +SM++Q K++P P
Sbjct: 476 FFGWLKDLSAPDPSSIFNFFGLAPWAAPTPGTTMALIFIGALPILLGVSMWLQQKLNPAP 535

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLR 571
            DK QAMI  WMP VF+F L  F +GL++YW  +N+I+  QQ VIM+ HG    +   ++
Sbjct: 536 GDKAQAMIFAWMPWVFMFMLGHFASGLVLYWIVNNLITFTQQYVIMRSHGHHPDIFGNIK 595

Query: 572 STFSKNYNSQ 581
           ++FS+   +Q
Sbjct: 596 ASFSRKPAAQ 605


>gi|221640557|ref|YP_002526819.1| putative inner membrane protein translocase component YidC
           [Rhodobacter sphaeroides KD131]
 gi|254773018|sp|B9KNZ6|OXAA_RHOSK RecName: Full=Inner membrane protein oxaA
 gi|221161338|gb|ACM02318.1| Inner membrane protein oxaA [Rhodobacter sphaeroides KD131]
          Length = 623

 Score =  425 bits (1092), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 224/610 (36%), Positives = 348/610 (57%), Gaps = 37/610 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNI---QTVKQPNQVDNSYAAVLI 58
           ++N N  +A  LS +++  W  F+++P  E +      +   QT   P+   ++    + 
Sbjct: 3   DQNKNLILATGLSFLVIMVW--FFLFPPPEAVTEGEPTVATQQTAVAPSATPDAPTTAVP 60

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
            D    L  + RV +  P L GSI++ G + DDL+L+ YH  +   S IV LLSP    N
Sbjct: 61  PD--ADLPETRRVAIDTPRLQGSISMLGGRLDDLSLKSYHETLDPQSQIVRLLSPVGQPN 118

Query: 119 AYFAELDYVSTA--NNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE 176
           AY+A   +         ++P +NT W  +    L    P+ L + N   ++F RTIS+D+
Sbjct: 119 AYYALYGWTPAGALGYEDVPGANTTWTQVGSGALGVDQPVTLQWDNGKGLVFTRTISVDD 178

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
           HY+F +  TV NNS   ++ +P G + RH KP    N F + EG +    D  L E KY 
Sbjct: 179 HYMFSVAQTVENNSGQAVQLAPYGIVARHGKPLNLQNFFVLHEGVVG-RADGKLTETKYD 237

Query: 236 DI-EKSSISNFH--------ESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQ 286
            + E   ++           + + W+G +DKYW +  IP +   F S  KY+  G   YQ
Sbjct: 238 KVAELPQVAREGAQAEVIDAQQDGWIGFTDKYWMTTLIPQQGQPFTSVTKYVP-GADIYQ 296

Query: 287 AKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLA---------IPRFEMLIDWG 337
           A+     +T+ PG +   ++ LFAGAKE+ TI  Y+ + A         IP F   IDWG
Sbjct: 297 AETREQLVTVAPGATAEVSSRLFAGAKEWETIRAYQNEGATEPTEGAEPIPGFIDSIDWG 356

Query: 338 WFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKID 397
           WF+F+ KP+F ++ +  +++GN G+AI+  T  +K L  PLA K YVS A MK +QP+++
Sbjct: 357 WFFFLTKPIFTVLHWLNHMIGNMGLAIIALTFLLKALVLPLAYKSYVSMARMKELQPELE 416

Query: 398 ELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAP 457
            LRE+       ++Q+ M++LYK   +NP AGC PIL+QIP+FF++YKVI +++E+RHAP
Sbjct: 417 ALRERAGDDK-MLMQREMMRLYKEKQVNPAAGCLPILIQIPIFFSLYKVIFVTIELRHAP 475

Query: 458 FWGWIKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPP 511
           F+GW+KDL+A DP++IF  FG+ P+  P        + +G  PI++ +SM++Q K++P P
Sbjct: 476 FFGWLKDLSAPDPSSIFNFFGLAPWAAPTPGTTMALIFIGALPILLGVSMWLQQKLNPAP 535

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLR 571
            DK QAMI  WMP VF+F L  F +GL++YW  +N+I+  QQ VIM+ HG    +   ++
Sbjct: 536 GDKAQAMIFAWMPWVFMFMLGHFASGLVLYWIVNNLITFTQQYVIMRSHGHHPDIFGNIK 595

Query: 572 STFSKNYNSQ 581
           ++FS+   +Q
Sbjct: 596 ASFSRKPAAQ 605


>gi|77464645|ref|YP_354149.1| putative inner membrane protein translocase component YidC
           [Rhodobacter sphaeroides 2.4.1]
 gi|123590899|sp|Q3IYY6|OXAA_RHOS4 RecName: Full=Inner membrane protein oxaA
 gi|77389063|gb|ABA80248.1| protein translocase subunit yidC [Rhodobacter sphaeroides 2.4.1]
          Length = 623

 Score =  424 bits (1091), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 224/610 (36%), Positives = 348/610 (57%), Gaps = 37/610 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNI---QTVKQPNQVDNSYAAVLI 58
           ++N N  +A  LS +++  W  F+++P  E +      +   QT   P+   ++    + 
Sbjct: 3   DQNKNLILATGLSFLVIMVW--FFLFPPPEAVTEGEPTVATQQTAVAPSATPDAPTTAVP 60

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
            D    L  + RV +  P L GSI++ G + DDL+L+ YH  +   S IV LLSP    N
Sbjct: 61  PD--ADLPETQRVVIDTPRLQGSISMLGGRLDDLSLKSYHETLDPQSQIVRLLSPVGQPN 118

Query: 119 AYFAELDYVSTA--NNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE 176
           AY+A   +         ++P +NT W  +    L    P+ L + N   ++F RTIS+D+
Sbjct: 119 AYYALYGWTPAGALGYEDVPGANTTWTQVGSGALGVDQPVTLQWDNGKGLVFTRTISVDD 178

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
           HY+F +  TV NNS   ++ +P G + RH KP    N F + EG +    D  L E KY 
Sbjct: 179 HYMFSVAQTVENNSGQAVQLAPYGIVARHGKPLNLQNFFVLHEGVVG-RADGKLTETKYD 237

Query: 236 DI-EKSSISNFH--------ESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQ 286
            + E   ++           + + W+G +DKYW +  IP +   F S  KY+  G   YQ
Sbjct: 238 KVAELPQVAREGAQAEVIDAQQDGWIGFTDKYWMTTLIPQQGQPFTSVTKYVP-GADIYQ 296

Query: 287 AKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLA---------IPRFEMLIDWG 337
           A+     +T+ PG +   ++ LFAGAKE+ TI  Y+ + A         IP F   IDWG
Sbjct: 297 AETREQLVTVAPGATAEVSSRLFAGAKEWETIRAYQNEGATEPTEGAEPIPGFIDSIDWG 356

Query: 338 WFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKID 397
           WF+F+ KP+F ++ +  +++GN G+AI+  T  +K L  PLA K YVS A MK +QP+++
Sbjct: 357 WFFFLTKPIFTVLHWLNHMIGNMGLAIIALTFLLKALVLPLAYKSYVSMARMKELQPELE 416

Query: 398 ELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAP 457
            LRE+       ++Q+ M++LYK   +NP AGC PIL+QIP+FF++YKVI +++E+RHAP
Sbjct: 417 ALRERAGDDK-MLMQREMMRLYKEKQVNPAAGCLPILIQIPIFFSLYKVIFVTIELRHAP 475

Query: 458 FWGWIKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPP 511
           F+GW+KDL+A DP++IF  FG+ P+  P        + +G  PI++ +SM++Q K++P P
Sbjct: 476 FFGWLKDLSAPDPSSIFNFFGLAPWAAPTPGTTMALIFIGALPILLGVSMWLQQKLNPAP 535

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLR 571
            DK QAMI  WMP VF+F L  F +GL++YW  +N+I+  QQ VIM+ HG    +   ++
Sbjct: 536 GDKAQAMIFAWMPWVFMFMLGHFASGLVLYWIVNNLITFTQQYVIMRSHGHHPDIFGNIK 595

Query: 572 STFSKNYNSQ 581
           ++FS+   +Q
Sbjct: 596 ASFSRKPAAQ 605


>gi|148556519|ref|YP_001264101.1| putative inner membrane protein translocase component YidC
           [Sphingomonas wittichii RW1]
 gi|148501709|gb|ABQ69963.1| protein translocase subunit yidC [Sphingomonas wittichii RW1]
          Length = 577

 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 211/569 (37%), Positives = 322/569 (56%), Gaps = 12/569 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQ----NFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAV 56
           ME   N  +AI LS ++++ WQ     F+   +      E    + + QP     +    
Sbjct: 1   MENQRNMILAIVLSALVLFGWQFLGDRFFPPAKPPVTKIEGGQEKVLPQPGADPAAAGPK 60

Query: 57  LIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNT 116
            I  RA  L  +PRV +  P L GSINLKGA+ DDL L+ Y   V+ N+P + LLSP  +
Sbjct: 61  AIRARAAVLRETPRVAIDTPKLAGSINLKGARIDDLVLKAYRETVAKNAPPIRLLSPLGS 120

Query: 117 KNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE 176
             AY+A   +  T + ++ P  NTVW   SG  LTP TP+ L + N     FE  I++D 
Sbjct: 121 PAAYYAGFGW--TGDGVDAPGPNTVWT-ASGTALTPETPVTLSWTNTRGQRFETVIAVDR 177

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
            Y+F I   + N     +   P G I +       +++ +  G I V  D +  +  +  
Sbjct: 178 DYMFTITQKLVNGGAGAVAARPYGLISKDGVSKDPSSWTLHTGPIGVFNDAANYDLSFKK 237

Query: 237 IEKSSISN--FHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
           ++++      F  +  WLG  DKYW +  +P  + S  + F  LS     YQA  S   +
Sbjct: 238 LDEAGQPGIRFASTGGWLGFGDKYWLTALVPDSKASVDAGF--LSTAPQVYQAVESGRAL 295

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
            I PG++ + +   FAGAKE   +  YE D  +P F   IDWGWF  + KP+F ++   +
Sbjct: 296 VIAPGQAGSVSQRFFAGAKEVALLDRYENDQGVPLFSRAIDWGWFRVLEKPIFWVLDQVF 355

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
            LVGNFG+AI++ T  V+ L FP+A+KQ+ S A M+ +QPK+ EL+E+ K   P+ LQ+ 
Sbjct: 356 KLVGNFGVAIIILTFLVRGLMFPIAQKQFRSMAGMRRVQPKMKELQERLKDDKPR-LQQE 414

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           +++LY+   +NPLAGC PIL+QIPVF+A+YKV+ +++EMRH PF  WI+DL+A DP ++ 
Sbjct: 415 LLKLYQEEKVNPLAGCLPILVQIPVFYALYKVLMVTIEMRHQPFVLWIRDLSAPDPLHVL 474

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSF 534
            LFG+L F  P F+ +G+  +++ +SM++Q K++P P D  Q  +   MP + +F ++ F
Sbjct: 475 NLFGLLDFTPPAFLGIGVLALLLGVSMWLQFKLNPQPMDDAQKQVFALMPWIMMFIMAPF 534

Query: 535 PAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
            AGL+IYW  SN ++I QQA + + H  E
Sbjct: 535 AAGLLIYWVTSNFLTIAQQAWLYRQHPVE 563


>gi|159042884|ref|YP_001531678.1| putative inner membrane protein translocase component YidC
           [Dinoroseobacter shibae DFL 12]
 gi|189036349|sp|A8LMA0|OXAA_DINSH RecName: Full=Inner membrane protein oxaA
 gi|157910644|gb|ABV92077.1| preprotein translocase subunit [Dinoroseobacter shibae DFL 12]
          Length = 606

 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 231/608 (37%), Positives = 352/608 (57%), Gaps = 34/608 (5%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQ----------PNQVDN 51
           ++N N  +A ALS +++  W  F ++P  E + +     Q  +           P  V  
Sbjct: 3   DQNKNLILATALSFLVILVW--FLLFPPEEPVTDPNAPTQITQSGETADVALTPPAAVTE 60

Query: 52  SYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLL 111
           +         A     +PRV++  P+L GSI+L G + DDL+LR Y+  +  +SPIV LL
Sbjct: 61  AAPGAAPQTAATPTENAPRVQIDTPALEGSISLLGGRIDDLSLRNYNETLEPDSPIVRLL 120

Query: 112 SPSNTKNAYFAELDYV--STANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFE 169
           SP +   AY+A   +    T +  ++P +NT+W + SG  LT  TP+ L ++N N ++F 
Sbjct: 121 SPVDAPGAYYALYGWAPAGTLSFDDVPGANTLWTVESGDTLTVDTPVVLRWENGNGLIFR 180

Query: 170 RTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSL 229
           RT+++D+ ++F +  +V N +    R  P G I RH      N F + EG +A + D SL
Sbjct: 181 RTLAVDDDFMFTVTQSVENTTETDKRMQPYGIIARHGEPDTINFFVLHEGVVA-MADGSL 239

Query: 230 VEQKYSDI----------EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLS 279
           +E  Y D+           ++ +    E N W+G +DK W +  IP+    F S  KY+ 
Sbjct: 240 IESDYDDMLDYDFVEREGARAEVEQI-EQNGWIGFTDKNWMTTLIPTPGQPFTSVAKYVG 298

Query: 280 DGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWF 339
           +    YQ +      T+  G+++T    LFAGAKE+  I  YE++L I  F   IDWGWF
Sbjct: 299 NADI-YQTETRLPTQTVPGGQTVTVETRLFAGAKEWEAIRGYERELGIEGFIDSIDWGWF 357

Query: 340 YFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDEL 399
           YF+ KP+F ++     L+GN G+AI++ T+ +K L  PLA K YVS A MK +QP++++L
Sbjct: 358 YFLTKPIFFVLHELNLLIGNMGVAIIVLTLLIKALLLPLAWKSYVSMARMKELQPEMEKL 417

Query: 400 REKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFW 459
           +EK      Q LQ AM++LYK   +NP AGC PILLQIP+FF++YKVI +++E+RHAPF+
Sbjct: 418 KEKAGDD-RQKLQVAMMELYKKEKVNPAAGCLPILLQIPIFFSLYKVIFVTIELRHAPFF 476

Query: 460 GWIKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPAD 513
           G  +DL+A DPT+I  LFG+LPF  P        + +GI P+++ +SM++Q K++P P D
Sbjct: 477 GPFQDLSAPDPTSIMNLFGLLPFASPEPGSILALIFIGILPLLLGISMWLQQKLNPAPTD 536

Query: 514 KGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRST 573
             QAMI  W+P VF+F L +F +GLI+YW  +NVI+  QQ  IM+ HG +  L   + ++
Sbjct: 537 PTQAMIFAWLPWVFMFMLGTFASGLIVYWIANNVITFAQQYFIMRRHGYKPDLFGNIVAS 596

Query: 574 FSKNYNSQ 581
           F K   S+
Sbjct: 597 FKKKKPSE 604


>gi|84685375|ref|ZP_01013273.1| putative inner membrane protein translocase component YidC
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84666532|gb|EAQ13004.1| putative inner membrane protein translocase component YidC
           [Rhodobacterales bacterium HTCC2654]
          Length = 613

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 225/613 (36%), Positives = 344/613 (56%), Gaps = 47/613 (7%)

Query: 3   RNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVD------NSYAAV 56
           +N N  +A  LS +++ AW    ++P  E    + + +     P   D      N+    
Sbjct: 4   QNRNLLIATVLSFVVITAW--MLLFPPAEPEAVQPEEVAETLAPGATDGAATPPNAAEQT 61

Query: 57  LIDDRAQA----------LSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSP 106
             D   +A          L  SPR+ ++ P L GSI+L G + DDL+L  Y + +   S 
Sbjct: 62  GTDAAPEATPDTTTTAQTLENSPRIPVETPKLSGSISLIGGRIDDLHLSDYRVSLDKGSD 121

Query: 107 IVTLLSPSNTKNAYFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
            VTLL PS +  AY+    +    N  N ++P + T W L  G  LTP TPI L + N  
Sbjct: 122 TVTLLRPSGSDEAYYTLYGWAPGGNLGNADVPGAMTQWELEEGDTLTPETPITLAWTNDA 181

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAV 223
            ++F RTIS+DE YLF +  +V N S    R +P G I RH +P      F + EG I  
Sbjct: 182 GMIFRRTISVDEDYLFTVRQSVENGSDIAQRLAPYGLIARHGEPSNLKGFFILHEGVIRQ 241

Query: 224 LGDKSLVEQKYSDI-------------EKSSISNFHESNSWLGISDKYWASVFIPSKETS 270
             D  L E  Y D              E ++I+     N W+G +D YW ++ +P     
Sbjct: 242 -DDTELSEIDYKDARELDRDPREGAPAEATAITE----NGWVGFTDHYWETILVPESGQP 296

Query: 271 FHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRF 330
           + +  KY+ +G   YQ +     I + PG +   +  LFAGAKE+ TI  Y+ D  I RF
Sbjct: 297 YTAVVKYV-EGADIYQTEVRLPTIEVAPGATAEVSTRLFAGAKEWDTIRDYQNDEGIYRF 355

Query: 331 EMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMK 390
              IDWG F+F+ KP+F ++ + ++ +GN G +I+  T  +K++ FPLA + YVS A MK
Sbjct: 356 LDSIDWGMFFFLTKPIFAVLHWLHSFIGNMGWSIIALTFVIKMVLFPLAYRSYVSMAKMK 415

Query: 391 NIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISIS 450
            +QP++++LRE+      + +Q+ M++LYK + +NP +GC PILLQIP++F++YKVI ++
Sbjct: 416 ELQPEMEKLREQAGDDRMK-MQQGMMELYKKNKVNPASGCLPILLQIPIWFSLYKVIFVT 474

Query: 451 LEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPG------FMHVGIWPIIMSLSMFIQ 504
           LE+RH P++GWI+DL+A DP++I  LFG+LP   P       F  +G+ PI++ +SM++Q
Sbjct: 475 LELRHEPWFGWIRDLSAPDPSSILNLFGLLPNAAPDPTSWFYFFSLGVLPILLGISMWLQ 534

Query: 505 MKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEI 564
            K++P PAD  QA I+NWMP VF+F L  F +GL+IYW  +N ++ +QQ  IM+ HGA+ 
Sbjct: 535 QKLNPAPADATQATIMNWMPWVFMFMLGRFASGLVIYWIANNTLTFIQQYTIMRSHGAKP 594

Query: 565 GLIDRLRSTFSKN 577
            +   ++S+F K 
Sbjct: 595 DIFGNIKSSFKKK 607


>gi|302381828|ref|YP_003817651.1| membrane protein insertase, YidC/Oxa1 family [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302192456|gb|ADL00028.1| membrane protein insertase, YidC/Oxa1 family [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 614

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 213/539 (39%), Positives = 319/539 (59%), Gaps = 22/539 (4%)

Query: 46  PNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNS 105
           P     +     + DR +AL    R+ +  P+L GS++L+G + DDL L+ Y   +   S
Sbjct: 62  PASTGATGPVTFVTDRTKALGNVARIPVSTPTLQGSMSLQGGRIDDLFLKNYRQTIDPTS 121

Query: 106 PIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANN 165
           P   L  P   ++AYFA+  +        +P +NTVW L +G  LTP TP+ L + N   
Sbjct: 122 PYEELFRPQGMEHAYFAQFGWTGPNVPGGVPGANTVWRLTAGSTLTPATPVTLTWDNGQG 181

Query: 166 ILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHK-PQTATNTFGVQEGFIAVL 224
           + F R +S+D+ Y+F + DTV N     I  +P GR+ R   P     T  + EG I   
Sbjct: 182 LRFTRVLSVDDRYMFTVTDTVANLGTAPITIAPYGRVERQGVPPALGKTQILHEGGIGTF 241

Query: 225 --GDKSLVEQ-KYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDG 281
             GD  +  Q KY D  K        +  WLGI+DKYW +  IP ++ +  ++F+     
Sbjct: 242 SKGDGYVTSQLKYGDWAKKPRQEHESTGGWLGITDKYWMAALIPPQDEAIQAEFRVTDAA 301

Query: 282 -HARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
            +  ++A+      TI PG+ +T    LFAGAK    +  YEK   +PRF   IDWG+ +
Sbjct: 302 TYDIHEARMLGAARTIQPGRQVTEVQHLFAGAKRNEILADYEKQFDLPRFIYAIDWGFLF 361

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           F+ +P+F+L+ +FY LVGNFG+AI+L T+ +KL+ FPLA K Y S + M+ +QP +++++
Sbjct: 362 FLTRPIFLLVEFFYGLVGNFGVAILLLTLTIKLIMFPLANKSYESLSKMRKLQPLMEKIK 421

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E+ K   PQ  QKA ++LY+   INPLAGC PIL+QIPVF+A+YKV+ +++EMRHAPF+G
Sbjct: 422 EQNKDD-PQAQQKATMELYQKEKINPLAGCLPILVQIPVFYALYKVLYVTIEMRHAPFFG 480

Query: 461 WIKDLAAADPTNIFTLFGILPF------YLPGFM--HVG--------IWPIIMSLSMFIQ 504
           WI+DL+A DPTNI+TLFG++P+       + G +  H G        +  I+   +M++Q
Sbjct: 481 WIRDLSAPDPTNIWTLFGLIPWDPSSAPLIGGLIGVHTGGGFTLALSVLAILYGFTMWLQ 540

Query: 505 MKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
             M+PP  D  Q  I  +MP++F F ++SFPAGL++YW+W+N++SI QQ  IM   GAE
Sbjct: 541 QAMNPPAPDPVQRQIFAFMPIIFTFIMASFPAGLLVYWAWNNILSIAQQYFIMHRFGAE 599


>gi|259415716|ref|ZP_05739636.1| inner membrane protein OxaA [Silicibacter sp. TrichCH4B]
 gi|259347155|gb|EEW58932.1| inner membrane protein OxaA [Silicibacter sp. TrichCH4B]
          Length = 611

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 228/610 (37%), Positives = 342/610 (56%), Gaps = 36/610 (5%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAA------ 55
           ++N N  +A ALS +++  W  F+  P  E      +  +T   P       AA      
Sbjct: 3   DQNKNLLLATALSFLVILGWY-FFFPPPEEAPQPAAQVTETTATPGDTSGPAAAPSAGEA 61

Query: 56  -----VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTL 110
                        A   +PR+ +  P + GSI+LKG + DDL L+ Y   +  +SPIVTL
Sbjct: 62  TAEADAAATAEVDAAEDAPRLAINTPRVEGSISLKGGRIDDLRLKDYRETLDDDSPIVTL 121

Query: 111 LSPSNTKNAYFAELDYV-STANNIE-LPNSNTVWNLISGKILTPTTPIKLVFKNANNILF 168
           LSP+   NAY+A   +   T   IE +P +NT W    G  LTP T + L + N   + F
Sbjct: 122 LSPAGQANAYYALYGWAPGTGLGIEDVPTANTRWQAADGATLTPETSVTLTWDNGKGLTF 181

Query: 169 ERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHK-PQTATNTFGVQEGFIAVLGDK 227
            R I++DE Y+F I  +VTN S + +  +P G + RH  P    N F + EG +  + D 
Sbjct: 182 SREIAIDEDYMFSITQSVTNTSGESVALAPYGTLARHGLPANLENFFVLHEGVVG-MADG 240

Query: 228 SLVEQKYSDI----------EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKY 277
            L E  Y D+           +S I++  E N W+G +  YW S  IP+   +F S  KY
Sbjct: 241 ELAEIDYDDMTDFDPDPRDGSRSQITSVTE-NGWIGFTGHYWMSTLIPAPGDAFRSIVKY 299

Query: 278 LSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWG 337
             +    YQ       +T+  G+S + +  LFAGAKE+ TI  YE+   I  F   IDWG
Sbjct: 300 -DERRDIYQTDVVLPTVTLAAGESTSASTQLFAGAKEWATIREYERG-GIAGFLDSIDWG 357

Query: 338 WFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKID 397
           WF+F  KP+F ++ +    +GN G+AI+  T  +K+L FPLA K Y S A MK +QP+++
Sbjct: 358 WFFFFTKPIFAVLHWLNAAIGNMGVAIIALTFLLKILVFPLAYKSYASMARMKELQPEME 417

Query: 398 ELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAP 457
           +LRE+      Q +QK M++LYK   +NP AGC PIL+QIP+FF++YKVI ++LE+RH+ 
Sbjct: 418 KLRERAGDDR-QKMQKEMMELYKREKVNPAAGCLPILIQIPIFFSLYKVIFVTLELRHSA 476

Query: 458 FWGWIKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPP 511
           F+G  +DL+A DPT+++ LFG+LP+  P        + +GI PI++ +SM++Q K++P P
Sbjct: 477 FFGPFQDLSAPDPTSLYNLFGLLPWGAPAPDSLLALVFIGILPILLGISMWLQQKLNPAP 536

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLR 571
           AD+ Q MI  WMP VF+F L  F +GL++YW  +NVI+  QQ +IM+ HG    +   ++
Sbjct: 537 ADETQKMIFAWMPWVFMFMLGGFASGLVVYWITNNVITFTQQYLIMRSHGYTPDVFGNIK 596

Query: 572 STFSKNYNSQ 581
           S+F +   ++
Sbjct: 597 SSFKRGEKAE 606


>gi|260577136|ref|ZP_05845113.1| 60 kDa inner membrane insertion protein [Rhodobacter sp. SW2]
 gi|259020610|gb|EEW23929.1| 60 kDa inner membrane insertion protein [Rhodobacter sp. SW2]
          Length = 646

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 224/596 (37%), Positives = 346/596 (58%), Gaps = 28/596 (4%)

Query: 3   RNWNYFVAIALSVIIVYAWQNFYVYPRIEEM---NNERKNIQTVKQPNQVDNSYAAVLID 59
           +N N  +A ALS +++  W  F ++P  E +   N    +      P   D + AA    
Sbjct: 4   QNKNLILATALSFLVILVW--FVLFPPPEPVVDPNAPAISATEALTPPVADQTTAATTE- 60

Query: 60  DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNA 119
             A A+  +PR+ +  P L GSI++ G + DDL+L+GY   +   S IV LLSP    +A
Sbjct: 61  -PAAAVPETPRLTIDTPLLQGSISMLGGRIDDLSLKGYKESLDPASDIVRLLSPVGKDSA 119

Query: 120 YFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEH 177
           Y+A   +    +  N ++P +NT W L +G  L P  P+ L + N   + F RTI++D+H
Sbjct: 120 YYALYGWAPGGDLANEDVPGANTEWKLAAGTSLAPGQPVTLAWDNGKGLNFTRTIAIDDH 179

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
           Y+F +   V N +  ++R +P G + RH KP    N + + EG +    D  L E KY D
Sbjct: 180 YMFTVTQGVENTTGAEVRLAPYGIVARHGKPAGLQNFYVLHEGVVGRT-DGKLEEVKYKD 238

Query: 237 I-------EKSSISNFHE--SNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA 287
           +        + + +   E  ++ W+G +DKYW +  IP++   F S  KY++     YQ 
Sbjct: 239 LVDLPVVEREGAQAEVVEATTDGWIGFTDKYWMTTLIPAQGKPFTSVTKYVASADI-YQV 297

Query: 288 KFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMF 347
           +     + + PG    TT+ LFAGAKE+ TI  Y+ D  +P F   IDWGWF+F+ KPMF
Sbjct: 298 ETREPVLVVAPGAKAETTSRLFAGAKEWATIRGYQNDAGVPGFIDSIDWGWFFFLTKPMF 357

Query: 348 MLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSP 407
            ++     L+GN G+AI+  T+ +K++ FPLA K YVS A MK +QP+I+ ++E+     
Sbjct: 358 WVLHNLNALIGNMGLAIIGLTLVLKVIVFPLAYKSYVSMARMKELQPEIEAMKERVGDD- 416

Query: 408 PQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAA 467
            Q +Q  M++LYK   +NP AGC P+L+QIP+FF++YKVI ++LE+RHAPF+GW+ DL+A
Sbjct: 417 KQKVQVEMMKLYKEKKVNPAAGCLPVLIQIPIFFSLYKVIFVTLELRHAPFFGWLTDLSA 476

Query: 468 ADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILN 521
            D +++F  FG+ P+  P        + +G+ PI++ +SM++Q K++P PAD  Q MI  
Sbjct: 477 RDSSSLFNFFGLAPWAAPEHGTLLATIFIGLLPILLGISMWLQQKLNPAPADPTQQMIFA 536

Query: 522 WMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           WMP VF+F L SF +GL++YW  +NVI+  QQ +IM+ HG    +   ++S F K 
Sbjct: 537 WMPWVFMFMLGSFASGLVLYWITNNVITFTQQYIIMRSHGHHPDIFGNIKSGFKKK 592


>gi|315498839|ref|YP_004087643.1| membrane protein insertase, yidc/oxa1 family [Asticcacaulis
           excentricus CB 48]
 gi|315416851|gb|ADU13492.1| membrane protein insertase, YidC/Oxa1 family [Asticcacaulis
           excentricus CB 48]
          Length = 658

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 225/606 (37%), Positives = 355/606 (58%), Gaps = 33/606 (5%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNE---RKNIQTVKQPNQVDNSYAAVLI 58
           + N N F+ +ALS+ I++ +Q F   P++E+       +K I+  K P     S      
Sbjct: 4   DDNRNMFIFLALSMAILFGYQFFVAGPQMEKERAAAMAQKKIEAAKSPVATPESLFVEGK 63

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
             R QA++ +PRV + +P+L GS++L GA+ DDL L+ Y   + ++SP V L  P   ++
Sbjct: 64  LPRDQAVAATPRVAIDSPALKGSLSLAGARIDDLFLKQYKETLKADSPNVELFRPQGAEH 123

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHY 178
           AY+AE  +V  AN   LP+ N+VW ++SG +L+P   + L +     + FER +SLD+ Y
Sbjct: 124 AYYAESGWVG-ANVPGLPSGNSVWTVVSGSVLSPGKDVVLGYDAGTGLRFERRLSLDDKY 182

Query: 179 LFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVLGDKSLV------E 231
           +  + DTV N +   +  +P   ++R   P+T      + EG I      +        E
Sbjct: 183 MITVTDTVVNTTGAAVTLAPYANVVRQGAPETLGKNMILHEGGIGAFSKDATGKGYTTPE 242

Query: 232 QKYSDIEKSSI-SNFH--ESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR---- 284
            K+ + EK    +NF    +  W+G++DKYW +  IP ++   H+  K      A     
Sbjct: 243 FKFHNWEKDEKKANFKADSTGGWMGLTDKYWLAAVIPDQKAKIHASMKATDQTTANEKDF 302

Query: 285 ---YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYF 341
              YQA + A+ +T+ PGK ++ T  +FAGAK+   +  Y+  L +P F+  IDWG F+F
Sbjct: 303 NFLYQAGYVADAVTVQPGKPVSVTYHIFAGAKQASLLAAYQDKLKLPAFDKAIDWGMFWF 362

Query: 342 IAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELRE 401
             +PMF ++ + +  VGNFG+AI+  TV VKL+FFPLA K Y S   MK +QP+++EL++
Sbjct: 363 FTRPMFFVLDFLFKYVGNFGLAILGLTVLVKLIFFPLAHKSYESMTKMKMLQPQVEELKK 422

Query: 402 KFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGW 461
           K + +P Q +Q  M+ LY+   +NP++GC PI +Q+PVF+A+YKV+ +++EMRHAPF+GW
Sbjct: 423 KHEGNPQQ-MQIEMMGLYQKEKVNPMSGCLPIFVQMPVFYALYKVLFVTIEMRHAPFFGW 481

Query: 462 IKDLAAADPTNIFTLFGILPF---YLP---GFM----HVGIWPIIMSLSMFIQMKMSPPP 511
           I+DL+  DPT +F LFG+LP+    LP   G M    H+GI P++   SM++   M+PP 
Sbjct: 482 IQDLSDKDPTTMFNLFGLLPYDPAALPVIGGLMATSLHIGILPLLYGASMWLSQSMNPPM 541

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLR 571
            D  Q  I  +MPV+F F ++ F +GL+IYW W+NV+++ QQ ++M+  G E   ID L 
Sbjct: 542 PDPMQRKIFAFMPVMFTFIMAPFASGLLIYWIWNNVLTVAQQYMLMRQMGVE-NPIDTLL 600

Query: 572 STFSKN 577
              +K 
Sbjct: 601 GKVAKT 606


>gi|40062654|gb|AAR37575.1| inner membrane protein, 60 kDa [uncultured marine bacterium 313]
          Length = 560

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 216/558 (38%), Positives = 335/558 (60%), Gaps = 15/558 (2%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLID---DRA 62
           N  +AI LS +++  W  F+  P +E    E    Q  K       S   V +    +R 
Sbjct: 5   NVLIAIVLSTLVLVFWATFFEPPPVERQIVED---QITKSEEPSSPSIEKVELSKKIERN 61

Query: 63  QALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFA 122
            A+    RV+++N ++ GSI+L+GA  DD+  + Y   + S+  ++  L+P ++   Y+ 
Sbjct: 62  DAIDSVARVKIENNNIKGSISLQGAIIDDIIFKNYKESLESDQKVI-FLNPKSSDEGYYI 120

Query: 123 ELDYVSTANN-IELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFK 181
           E  + S +N  ++LP  NT+W +   K+LTP  PI L + N   ++F + I LD+ YLFK
Sbjct: 121 ETGWASNSNEKLKLPLDNTIWKVKGNKVLTPNNPIVLEWDNNEGLIFTKKIELDDKYLFK 180

Query: 182 IVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSS 241
           I   + N S     F P  +I R+        + + EGFI +  D+ L E+ Y D+E   
Sbjct: 181 ISQGIKNTSNKSYEFFPYAQITRNYKPDVIPIYILHEGFIGMFDDE-LKEEDYKDVEDEK 239

Query: 242 ISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGK- 300
               + S  WLGI+DKYW +  +P K   F S+F  + DG  +Y+A F   E T+L    
Sbjct: 240 FI-INSSKGWLGITDKYWLTAIVPEKGKKFKSEFLSI-DG--KYKANFIIKEPTVLSSNA 295

Query: 301 SITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF 360
           SIT     F  AKE   I  Y + L+I +F++ IDWGWFYFI KP+F ++ YF+ L GNF
Sbjct: 296 SITNEINAFVMAKEVAVIDGYAERLSIEKFDLTIDWGWFYFITKPLFFVIEYFFKLTGNF 355

Query: 361 GIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYK 420
           G+AI++ T  V+++FFPL+   + S A MK +QP++  L+E  K    + LQ+ M+ LYK
Sbjct: 356 GVAIIILTALVRIVFFPLSNYSFRSMAKMKILQPEMIRLKELHKDDKTK-LQQEMMALYK 414

Query: 421 THNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL 480
              +NP++GC P+L+QIP FFA+YK++ +++EMR  PF+GWI+DL+A DPT+IF LFG++
Sbjct: 415 REKVNPISGCLPVLIQIPFFFAVYKMLYVTIEMRQQPFFGWIQDLSARDPTSIFNLFGLI 474

Query: 481 PFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLII 540
           P+  P F+ +G+WPI+M L+MF+Q K++P P D  QA I  ++P+     L+ FP+GL++
Sbjct: 475 PWDPPTFLMIGVWPILMGLTMFLQQKLNPTPPDPMQAKIFMFLPIFLTIILAPFPSGLVV 534

Query: 541 YWSWSNVISIVQQAVIMK 558
           YW+ SNV+++ QQ VI++
Sbjct: 535 YWTISNVLTMAQQWVIIR 552


>gi|126737055|ref|ZP_01752790.1| putative inner membrane protein translocase component YidC
           [Roseobacter sp. SK209-2-6]
 gi|126721640|gb|EBA18343.1| putative inner membrane protein translocase component YidC
           [Roseobacter sp. SK209-2-6]
          Length = 601

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 222/604 (36%), Positives = 341/604 (56%), Gaps = 30/604 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYP------RIEEMNNERKNIQTVKQPNQVDNSYAA 55
           ++N N  +A  LS +++  W  F+  P       +    N  ++  T+       ++ A 
Sbjct: 3   DQNKNLILATVLSFLVILGWYTFFPPPEPEQPVDVAVTENAAESGTTLVPTADATDAVAN 62

Query: 56  VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSN 115
              ++ +     +PR+ +  P + GSI L+G + DDL+L+ Y   ++  SPIV LL P  
Sbjct: 63  ATTEEASA--PDAPRLAIDTPRVTGSIALQGGRIDDLSLKDYRETLADGSPIVKLLKPVG 120

Query: 116 TKNAYFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTIS 173
              AY+A   +   A   + ++P +N++W+  +G  L+P TP+ L + N N + F RTIS
Sbjct: 121 EAQAYYALYGWAPGAGLTSSDVPGANSIWSAPAGATLSPETPVTLTWDNGNGLTFARTIS 180

Query: 174 LDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVLGDKSLVEQ 232
           +DE Y+F +  +VTN +   I  +P G + RH +P+   N F + EG +  + D  L E 
Sbjct: 181 VDEDYMFSVTQSVTNATDGTISLAPYGTLARHGEPEDLKNFFILHEGVVG-MADGELSEL 239

Query: 233 KYSDIEKSSISNFHES---------NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
            YSD+    I     S         N W+G +D YW S  IP     F S  K+  +   
Sbjct: 240 DYSDVADFDIDPRDGSRSEVKQVTTNGWIGFTDHYWMSTLIPEPGQGFRSIAKF-DERRG 298

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
            YQ       +++  G S   T  LFAGAKE+ +I  YEK   I  F   IDWGWF+F+ 
Sbjct: 299 IYQTDIVLPTVSLAAGNSTEVTTMLFAGAKEWASIRSYEKS-GIAGFLDSIDWGWFFFLT 357

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           KPMF ++ +   L+GN G AI+  TV +K++ FPLA K Y S A MK +QP++++L+E+ 
Sbjct: 358 KPMFAVLHWLNLLIGNMGWAIIGLTVLIKIIVFPLAYKSYASMAKMKELQPEMEKLKERT 417

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
                Q +QK M++LYK   +NP AGC PIL+QIP+FF++YKVI ++LE+RHAPF+G  +
Sbjct: 418 GDDR-QKMQKEMMELYKKEKVNPAAGCLPILIQIPIFFSLYKVIFVTLELRHAPFFGPFQ 476

Query: 464 DLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQA 517
           DL+A DPT++  LFG+LPF  P        + +GI P+++ +SM++Q K++P P D  Q 
Sbjct: 477 DLSAPDPTSLMNLFGLLPFSGPEAGSILALVFIGILPLLLGISMWLQQKLNPAPTDPTQQ 536

Query: 518 MILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           MI  WMP VF+F L  F +GL++YW  +N I+  QQ +IM+ HG +  +   ++S F K 
Sbjct: 537 MIFAWMPWVFMFMLGGFASGLVVYWIANNTITFTQQYLIMRSHGYKPDVFGNIKSGFKKK 596

Query: 578 YNSQ 581
             S+
Sbjct: 597 PKSE 600


>gi|114770125|ref|ZP_01447663.1| putative inner membrane protein translocase component YidC [alpha
           proteobacterium HTCC2255]
 gi|114548962|gb|EAU51845.1| putative inner membrane protein translocase component YidC [alpha
           proteobacterium HTCC2255]
          Length = 612

 Score =  415 bits (1066), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 227/614 (36%), Positives = 353/614 (57%), Gaps = 47/614 (7%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIE-------EMNNERKNIQTVKQPNQVDNSYA 54
           + N N  +A  LS++++  W  FY +P+ +       ++      I           S  
Sbjct: 4   DNNKNMILASVLSMLVLLTW--FYFFPQEDYQPVATNQITASENGIAAAPTAGNGIASAP 61

Query: 55  AV---LIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLL 111
           A+   + + R  AL  + RVE+++  + GS++L GA+ DDL L  Y++ ++  S  VTLL
Sbjct: 62  AISTTVAETREIALEKTKRVEIRSNRIKGSLSLTGARIDDLKLLDYNVKLNDTSEKVTLL 121

Query: 112 SPSNTKNAYFAELDYVSTANNIE---LPNSNTVWNLISGKILTPTTPIKLVFKNANNILF 168
           SP+   +AY+  L   S A +++   +P + T+W++ +G ILTP + + L + N+N ++F
Sbjct: 122 SPAGGPSAYYI-LHGFSPAGSLDFDDVPTATTIWSVENGNILTPNSSVTLKWDNSNGLVF 180

Query: 169 ERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQE---------- 218
            R I +D+ Y+F I  +V NN+   I  +P G I +  P  A   +G QE          
Sbjct: 181 YRKIEVDDDYMFTITQSVQNNTNANISLAPYGLIAQKGP-IARAAYGRQESSKNGVYILH 239

Query: 219 -GFIAVLGDKSLVEQKYSDIEKSSISNFHESN---------SWLGISDKYWASVFIPSKE 268
            G +   G  SL E  YSD+     S+   +N          W+G + KYW +  IP   
Sbjct: 240 EGIVLQTG-SSLEEIDYSDMPDEDFSSSERANLKVVDSTKKGWIGFTGKYWMTTLIPDN- 297

Query: 269 TSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIP 328
           ++F +  KY ++G  RYQA+     I IL G+     + LFAGAKE+ TI HY     + 
Sbjct: 298 SAFKAVSKY-TEGADRYQAEARQETIQILAGQRRDVQSRLFAGAKEYATIQHYGDKEGVT 356

Query: 329 RFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTAN 388
            F   IDWG F+FI KPMF L+ +   L+GN G AI+  T+ +K + FPLA K +VS A 
Sbjct: 357 DFVDSIDWGMFFFITKPMFALLHFLNGLIGNMGWAIIALTLIIKTILFPLAYKSFVSMAR 416

Query: 389 MKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVIS 448
           MK +QP++++L+EK  +   Q +QKA +++Y+T  +NP AGC PILLQIP+FF++YKVI 
Sbjct: 417 MKELQPEMEKLKEKHGED-RQAMQKATMEMYRTKKVNPAAGCLPILLQIPIFFSLYKVIF 475

Query: 449 ISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPG------FMHVGIWPIIMSLSMF 502
           ++LE+RHAPF GW+KDL+  DP+++  LFG++P+  PG       + +G+WPI+M ++M+
Sbjct: 476 VTLELRHAPFIGWLKDLSVPDPSSLLNLFGLMPWDAPGPNSFFVILSIGVWPILMGITMW 535

Query: 503 IQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           +Q K++P P DK QAMI  WMP VF+F L  F +GL+IYW  +N ++ +QQ  IM+  G 
Sbjct: 536 LQQKLNPAPTDKTQAMIFAWMPWVFMFMLGGFASGLVIYWVANNTLTFMQQYTIMRSQGV 595

Query: 563 EIGLIDRLRSTFSK 576
              ++  +   F K
Sbjct: 596 NPDILGNMFKRFKK 609


>gi|89068160|ref|ZP_01155577.1| putative inner membrane protein translocase component YidC
           [Oceanicola granulosus HTCC2516]
 gi|89046399|gb|EAR52456.1| putative inner membrane protein translocase component YidC
           [Oceanicola granulosus HTCC2516]
          Length = 597

 Score =  415 bits (1066), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 218/597 (36%), Positives = 350/597 (58%), Gaps = 36/597 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEE---MNNERKNI---------QTVKQPNQV 49
           ++N N  +A ALS I++  W  F ++P  E+   + N    +           +     +
Sbjct: 3   DQNKNLILATALSFIVILIW--FVLFPPPEQAPGLTNAEGEVVAQDDTALRDEMSPDGAI 60

Query: 50  DNSYAAVLIDDRAQ-ALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIV 108
           D + A   +    Q A   + RV ++ P L+GSIN  G + DDL L  YH  +  +SP+V
Sbjct: 61  DGTAAGTPVATLEQDAPVEAARVAIETPRLVGSINTAGGRIDDLKLTAYHETLDPDSPLV 120

Query: 109 TLLSPSNTKNAYFAELDYV--STANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNI 166
            LLSP   +  Y+A   ++  S A+  E+P  +TVW +  G+ LTP +P+ L ++N   +
Sbjct: 121 RLLSPGGEEAQYYALHGWIALSGASADEVPGDSTVWEIEEGETLTPDSPVVLRWENGAGL 180

Query: 167 LFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGD 226
           +F +TI++D++YLF +  +V N + D +   P G++ RH    +   F + EG +  + D
Sbjct: 181 VFRKTIAVDDNYLFTVTQSVENTTGDAVELRPYGQVRRHGLPDSRQFFILHEGVVR-MAD 239

Query: 227 KSLVEQKYSDI-----EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDG 281
             L E  Y D+     E+S I      + W+G +DKYW +  +P+  T F S  + +   
Sbjct: 240 GELEEIDYDDLPDLTAEESRIEV--AEDGWVGFTDKYWMTTLVPASGTPFRSVAREV--- 294

Query: 282 HARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYF 341
           +  Y  +     + +  G++++  + +FAGAKE+ TI  YE    I RF   IDWGWF+F
Sbjct: 295 NGIYLTESIYPPVAVAAGETVSAESHVFAGAKEWETIRAYEA-AGIDRFVDSIDWGWFFF 353

Query: 342 IAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELRE 401
           + KP+F L+ +   ++GN G +I++ T+ +K + FPLA K Y S A MK +QP++++L+E
Sbjct: 354 LTKPIFALLHWLNGVIGNMGWSIIVLTLIIKAVLFPLAYKSYASMAKMKELQPEMEKLKE 413

Query: 402 KFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGW 461
           +      Q LQK M++LYKT+ +NP +GC PILLQIP+FF++YKVI ++LE+RHAP+ GW
Sbjct: 414 RAGDDR-QALQKGMMELYKTNKVNPASGCLPILLQIPIFFSLYKVIFVTLELRHAPWIGW 472

Query: 462 IKDLAAADPTNIFTLFGILPFYLPG------FMHVGIWPIIMSLSMFIQMKMSPPPADKG 515
           I+DL+A DP++I  LFG+LP+  P          +G+ PI++ +SM++Q K++P P D  
Sbjct: 473 IRDLSAPDPSSILNLFGLLPWDTPDPGSIFFIFSLGVLPILLGISMWLQQKLNPAPPDPT 532

Query: 516 QAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRS 572
           Q MI  WMP VF+F L SF +GL+IYW  +N+I+  QQ +IM+ HG +  ++  +R 
Sbjct: 533 QRMIFAWMPWVFMFMLGSFASGLVIYWIANNMITFTQQYLIMRSHGYKPDILGNIRG 589


>gi|295690947|ref|YP_003594640.1| membrane protein insertase [Caulobacter segnis ATCC 21756]
 gi|295432850|gb|ADG12022.1| membrane protein insertase, YidC/Oxa1 family [Caulobacter segnis
           ATCC 21756]
          Length = 618

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 215/554 (38%), Positives = 317/554 (57%), Gaps = 40/554 (7%)

Query: 51  NSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTL 110
           N   A L   R QA + SPR+ +  P+L GSI LKG + DDL LR Y    + NSP V L
Sbjct: 59  NGNPAPLRLSRDQAKAQSPRIVVDTPALSGSIALKGGRIDDLFLRKYAETTAKNSPPVEL 118

Query: 111 LSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFER 170
             P   ++A+FA+  +   AN   LP+S TVW    G++L P +P+ L + N   + F R
Sbjct: 119 FRPEGAEHAWFADFGWAG-ANLPGLPDSRTVWTAAPGQVLRPNSPVTLTYDNGMGLTFTR 177

Query: 171 TISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFG----VQEGFIAVLG- 225
            I++D+  +F + D+V NN     + +P   + R   Q  T+  G    V EG I VLG 
Sbjct: 178 VIAVDDQAMFSVTDSVKNNGTAAFQLAPYATVQR---QGITDHLGKTQIVHEGAIGVLGS 234

Query: 226 --DKSLVEQKYSDIEKSS-ISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLS-DG 281
             D+ L   KY   +K   ++ F     W GI+DKYW +  IP +  +  +Q++  +  G
Sbjct: 235 GKDQKLELAKYQKWKKDKPLTTFDSVGGWAGITDKYWLAALIPGQTEAIKAQYRVTNVAG 294

Query: 282 HARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLA--------------- 326
              Y   F      + PG ++T T  LFAGAK  P +  Y+   A               
Sbjct: 295 VDVYDVNFVGPTQALNPGATLTQTTRLFAGAKTVPLLRKYQYGGAKPPAWWEFWSNAKAE 354

Query: 327 IPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVST 386
           IPRF+  +DWG F    +P+F ++  FY +VGNFG+AI+  TV +KL+ +P+A K Y S 
Sbjct: 355 IPRFDWAVDWGMFSMFTRPIFNVLEIFYKMVGNFGLAILALTVLLKLILYPMADKSYESM 414

Query: 387 ANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKV 446
           A MK I P++++L+ K K  P +  Q+ M+ LY+   INP+ GC P+L+QIPVF+A+YKV
Sbjct: 415 AKMKKIAPEVEKLKAKHKDDPAK-QQQEMMALYQKEKINPMMGCLPMLIQIPVFYALYKV 473

Query: 447 ISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPF----------YLPGFMHVGIWPII 496
           +++++EMRHAPF+GWI+DL+A DP+ IF LFG +P+          +L G +H+G+WP++
Sbjct: 474 LTVTIEMRHAPFFGWIQDLSARDPSTIFNLFGAIPWDPATAPLIGGFLGGPLHIGVWPLL 533

Query: 497 MSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVI 556
              +M++   M+PP  D  Q  I    P++F F LS F  GL+IYW WSNV++IVQQ V+
Sbjct: 534 YGFTMWLTTAMNPPAGDPIQQKIFQLFPIIFTFTLSQFAVGLVIYWCWSNVLTIVQQYVM 593

Query: 557 MKMHGAEIGLIDRL 570
           M+ +  E   IDR+
Sbjct: 594 MRRYKVE-NPIDRI 606


>gi|114327390|ref|YP_744547.1| 60 kDa inner membrane protein YIDC [Granulibacter bethesdensis
           CGDNIH1]
 gi|122327634|sp|Q0BU78|OXAA_GRABC RecName: Full=Inner membrane protein oxaA
 gi|114315564|gb|ABI61624.1| 60 kDa inner membrane protein YIDC [Granulibacter bethesdensis
           CGDNIH1]
          Length = 578

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 224/569 (39%), Positives = 327/569 (57%), Gaps = 27/569 (4%)

Query: 8   FVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQALSM 67
           F+AIA+S+ I+  +Q  Y +  + E     +      Q  + +N+  AV  D  A   S 
Sbjct: 7   FLAIAISLGILLGFQGLYRH-FVPEPPAAARTATNAGQ-GKPNNTLGAVPTDATA---SQ 61

Query: 68  SP------RVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
           SP      R+ +  P + GSI+L GA+FDDL LR YH  V  NSP+V LL+P +    Y+
Sbjct: 62  SPPPKEGARLAVDAPRVKGSISLVGARFDDLVLRDYHETVDKNSPLVRLLAPLSGDEPYY 121

Query: 122 AELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFK 181
            E  +V   + I  P  +T W       LTP  P+ L + N   + F   +++D  Y+F 
Sbjct: 122 VEYGWVPEESGIATPGRDTEWK-ADAATLTPNKPVTLSWDNGAGLTFMLKVAVDADYMFS 180

Query: 182 IVDTVTNNSIDQIRFSPRGRIMR-HKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS 240
           +  +V N +   +   P  R+ R ++P+    T  + EG I V+ D  L E  Y   +  
Sbjct: 181 VTQSVRNTTGKPVVLHPYARVRRDYRPEVEGYTV-LHEGLIGVV-DGILHEITYKSADSD 238

Query: 241 SISN------FHESNSWLGISDKYWASVFIPSKETSFHSQFKYLS-DGHARYQAKF-SAN 292
              N         +  W GI+DKYW +  IP + TS    F+    +G   YQ    S N
Sbjct: 239 GAKNNGLAFEHASTGGWAGITDKYWLTALIPDQITSVDFSFRDTKPNGRDGYQVGIISHN 298

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
              +  G    +T  LFAGAK    + HY+ +  IP F   +D+GWF+FI +P F  + +
Sbjct: 299 PDQVAAGAESASTTHLFAGAKVVSLLDHYQAEYHIPSFWEAVDFGWFWFITRPFFYALDW 358

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
            Y+LVGNFG+AI++ TV VK  F+PLA K Y S + M+ + PKI  LRE++K  P ++ Q
Sbjct: 359 LYHLVGNFGVAILIFTVLVKAAFYPLASKSYRSMSKMRLLAPKIQSLRERYKDDPTRMQQ 418

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           + M QLYK    NP +GC P+LLQ P+FF++YKVI +++EMRHAPF+GWI DL+A DPTN
Sbjct: 419 EVM-QLYKAEGANPASGCLPMLLQFPIFFSLYKVIFVTIEMRHAPFFGWIHDLSAVDPTN 477

Query: 473 IFTLFGILPF---YLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVF 529
           +F LFG+LPF   ++  F+H+GIWP+IM  +M++Q KM+PP  D  QA +  +MP++F F
Sbjct: 478 LFNLFGLLPFDPTHISPFLHLGIWPLIMGGTMYLQQKMNPPMPDPVQARMFQFMPIIFTF 537

Query: 530 ALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
            L+ FP GL+IYWSW+N++SI QQ +I +
Sbjct: 538 MLARFPVGLVIYWSWNNLLSIGQQWLIQR 566


>gi|294010745|ref|YP_003544205.1| preprotein translocase YidC subunit [Sphingobium japonicum UT26S]
 gi|292674075|dbj|BAI95593.1| preprotein translocase YidC subunit [Sphingobium japonicum UT26S]
          Length = 567

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 211/565 (37%), Positives = 323/565 (57%), Gaps = 12/565 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAW----QNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAV 56
           M+   N  +A+ L+  I++ W    Q F+          E      +        +  A 
Sbjct: 1   MDDKKNIILAVVLTAAILFGWPYVAQYFFPAANPPATKIEGGKTTPLTPSGAAPAAEGAA 60

Query: 57  LIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNT 116
            I D A  L  SPRV ++ P + GSINLKGA+ DD+ L  Y   ++ +SP + L SPS T
Sbjct: 61  AIRDLALVLKDSPRVAIRTPKITGSINLKGARIDDIVLPTYKETIAKSSPAIRLYSPSGT 120

Query: 117 KNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE 176
           K+AYFA   +      ++ P+  TVW   S K LTPT+P+ L + N     FE   S+DE
Sbjct: 121 KHAYFAGFGW--QGEGVKTPDGGTVWT-ASAKELTPTSPVTLSWNNGAGQTFEIRYSIDE 177

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
           +Y+      V+N     +     G + R  P    +T+ +  G + V    +  +  YSD
Sbjct: 178 NYMITAQQKVSNGGAGAVGVKSYGYVSRATPSADPDTWTIHVGPMGVFNGAANYDVNYSD 237

Query: 237 IEKS-SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
           +EK  +  +F  +  W+G +DKYW S  IP ++ +F  Q +       ++Q   S   I 
Sbjct: 238 LEKGPATQSFQSTGGWIGFTDKYWLSALIPDQKAAFTGQMR--KGAGTQFQTDMSLAPIM 295

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           + PGK++T TN LF GAKE  T+  Y+ D  +P F+  IDWGWFY+  KP+F L+ + + 
Sbjct: 296 VAPGKAVTQTNRLFVGAKEVKTLEAYQ-DAGVPLFDRAIDWGWFYWFEKPIFALLHWLFE 354

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
            +GNFG+AI+  T  V+ L FP+A++Q+ S A M+ +QPK+  L+EK+K   P+ LQ+ M
Sbjct: 355 HIGNFGVAIICLTFVVRGLMFPVAQRQFASMAAMRAVQPKMKALQEKYKDDKPR-LQQEM 413

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           ++LYK   +NPLAGC PI +QIP+FFA+YKV+ +++EMRH PF  WIKDL+A DP +I  
Sbjct: 414 MELYKREKVNPLAGCLPIFIQIPIFFALYKVLQLTIEMRHQPFVLWIKDLSAPDPLHIVN 473

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFP 535
           LFG+LPF  P F+ +G+  +++ +SM+ Q K++P   D  Q  +   MP + +F ++ F 
Sbjct: 474 LFGLLPFTPPAFLGIGVLALLLGISMYFQFKLNPAQMDPMQQQVFAIMPWMMMFIMAPFA 533

Query: 536 AGLIIYWSWSNVISIVQQAVIMKMH 560
           AGL++YW  +N +S++QQ  + K H
Sbjct: 534 AGLLVYWITNNCLSMLQQWWLYKRH 558


>gi|163739492|ref|ZP_02146902.1| 60 kDa inner membrane insertion protein [Phaeobacter gallaeciensis
           BS107]
 gi|161387245|gb|EDQ11604.1| 60 kDa inner membrane insertion protein [Phaeobacter gallaeciensis
           BS107]
          Length = 605

 Score =  412 bits (1058), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 210/531 (39%), Positives = 315/531 (59%), Gaps = 22/531 (4%)

Query: 69  PRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVS 128
           PR+ ++ P + G+I+L G + DDL+L+ Y + +  ++ IV +LSP+   NAY+A   +  
Sbjct: 77  PRLAIETPRVSGTISLLGGRLDDLSLKDYRVSLEEDAAIVKMLSPAGDPNAYYALYGWAP 136

Query: 129 TAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTV 186
            A     ++P +NT+W       LTP +P+ L + N   + F RTI++D+ YLF I  +V
Sbjct: 137 GAGLGPDDVPGANTLWQAGGDATLTPDSPVTLTWDNGKGLTFNRTIAVDQDYLFTITQSV 196

Query: 187 TNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNF 245
           TN S + +  +P G + RH +PQ   N F + EG I  + D +L E  Y D+    +   
Sbjct: 197 TNASGNTVALAPYGTLARHGEPQDLKNFFILHEGVIG-MADGTLAEIDYDDMTDFEVDAR 255

Query: 246 H---------ESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITI 296
                     E+N W+G +D YW S  +P    +F S  K+  +    YQ       +T+
Sbjct: 256 SGARAEVTQVETNGWIGFTDHYWMSTLVPEPGQAFRSIAKF-DERREIYQTDIVLPTVTV 314

Query: 297 LPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNL 356
             G++   T  LFAGAKE+ TI  Y+KD  I  F   IDWGWF+F+ KP+F ++ +   L
Sbjct: 315 ADGETSEATTMLFAGAKEWATIRGYQKD-GIEGFLDSIDWGWFFFLTKPIFAVLHWLNAL 373

Query: 357 VGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMI 416
           +GN G AI+  TV +KLL FPLA K Y S A MK +QP+++E++EK      Q LQ+ M+
Sbjct: 374 IGNMGWAIIGLTVLIKLLVFPLAYKSYASMAKMKELQPRMEEIKEKAGDDR-QKLQQEMM 432

Query: 417 QLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTL 476
            LYK   +NP AGC PIL+QIP+FF++YKVI ++LE+RHAPF+G  +DL+A DPT+I  L
Sbjct: 433 ALYKKEKVNPAAGCLPILIQIPIFFSLYKVIFVTLELRHAPFFGPFQDLSAPDPTSIMNL 492

Query: 477 FGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFA 530
           FG+LP   P        + +GI PI++ +SM++Q K++P P D  Q MI  WMP VF+F 
Sbjct: 493 FGLLPMAAPVEGTLMATIFIGILPILLGISMWLQQKLNPAPTDPTQQMIFAWMPWVFMFM 552

Query: 531 LSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ 581
           L  F +GL++YW  +N I+  QQ +IM+ HG +  +   ++S F K   ++
Sbjct: 553 LGGFASGLVVYWIANNTITFTQQYLIMRSHGYKPDVFGNIKSGFKKTPKAE 603


>gi|91762399|ref|ZP_01264364.1| putative inner membrane protein translocase component YidC
           [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718201|gb|EAS84851.1| putative inner membrane protein translocase component YidC
           [Candidatus Pelagibacter ubique HTCC1002]
          Length = 558

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 213/559 (38%), Positives = 338/559 (60%), Gaps = 18/559 (3%)

Query: 6   NYFVAIALSVIIVYAWQNFY------VYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLID 59
           N   AI+LS  ++  +  F+      +   + E N    N  T   P+   N   + L  
Sbjct: 5   NVIAAISLSAAVIILYSLFFQPDPATIKKNLAEQNKIENNEDT---PSLDKNENFSKL-- 59

Query: 60  DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNA 119
            RA AL  + R++ +N S++GSI+LKGA  DDL  + Y+++++ N  I TLLSP N ++ 
Sbjct: 60  SRADALKENDRIQFENGSVVGSISLKGAAIDDLTFKEYNIELNRNEKI-TLLSPRNVEDG 118

Query: 120 YFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYL 179
           Y  E  +VST  NI++P+++TVW +     LT   P+KL + N   I FE+ ISLD+ +L
Sbjct: 119 YLIESGFVSTNKNIDIPDASTVWEVSGNNKLTNNNPVKLTWSNTQGITFEKHISLDDQFL 178

Query: 180 FKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEK 239
           F + + + N+S     F   G+I+R++    +  + + EGF++VL D+ L+E+ Y DI+ 
Sbjct: 179 FTVKEKIINSSDKSYNFYSYGQIIRNEIPEISGFYILHEGFLSVLDDE-LIEEDYDDIQD 237

Query: 240 SSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPG 299
              +   + + ++ ISDK+W +  IP K   F + F Y +   A Y    S   I +   
Sbjct: 238 KKFTQIAQ-DGFVAISDKFWVTSVIPPKGKEFKTTFDYKNKFRANY---ISTKGIEVKAN 293

Query: 300 KSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGN 359
            SI     +   AK    I  Y ++L I +F++ IDWG+ YFI KP+F ++ YF+ L+GN
Sbjct: 294 SSIEEKIQIIVAAKRVNVIDGYAENLNINKFDLAIDWGFMYFITKPLFFVLDYFFKLLGN 353

Query: 360 FGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLY 419
           +G+AI+  T+ ++L FFPLA   + S   MK + P++  L+E  K    + LQ+AM+ LY
Sbjct: 354 YGLAIIAVTICIRLAFFPLANFSFKSMGKMKLLAPEMARLKELHKDDKMK-LQQAMMALY 412

Query: 420 KTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGI 479
           K   +NP++GC PIL+QIPVFFA+YKV+ +++EMRH PF+GWI DL+  DPT++F +FG+
Sbjct: 413 KKEKVNPMSGCLPILVQIPVFFALYKVLFVTIEMRHMPFYGWIHDLSDRDPTSLFNVFGL 472

Query: 480 LPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLI 539
           +P+  P F+ +G WPIIM ++M+IQ K++P P D  QA I  + PV     L+ FPAGL+
Sbjct: 473 IPWDPPSFLLIGAWPIIMGITMWIQQKLNPTPPDPIQAKIFMFFPVFLTVILAPFPAGLV 532

Query: 540 IYWSWSNVISIVQQAVIMK 558
           IYWS++N+ +++QQ ++ +
Sbjct: 533 IYWSFNNIFTMIQQYIVQR 551


>gi|71083172|ref|YP_265891.1| putative inner membrane protein translocase component YidC
           [Candidatus Pelagibacter ubique HTCC1062]
 gi|123647065|sp|Q4FNF1|OXAA_PELUB RecName: Full=Inner membrane protein oxaA
 gi|71062285|gb|AAZ21288.1| 60 kDa inner membrane protein [Candidatus Pelagibacter ubique
           HTCC1062]
          Length = 558

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 213/559 (38%), Positives = 338/559 (60%), Gaps = 18/559 (3%)

Query: 6   NYFVAIALSVIIVYAWQNFY------VYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLID 59
           N   AI+LS  ++  +  F+      +   + E N    N  T   P+   N   + L  
Sbjct: 5   NVIAAISLSAAVIILYSLFFQPDPATIKKNLAEQNKIENNEDT---PSLDKNENFSKL-- 59

Query: 60  DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNA 119
            RA AL  + R++ +N S++GSI+LKGA  DDL  + Y+++++ N  I TLLSP N ++ 
Sbjct: 60  SRADALKENDRIQFENGSVVGSISLKGAAIDDLTFKEYNIELNRNEKI-TLLSPRNVEDG 118

Query: 120 YFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYL 179
           Y  E  +VST  NI++P+++TVW +     LT   P+KL + N   I FE+ ISLD+ +L
Sbjct: 119 YLIESGFVSTNKNIDIPDASTVWEVSGNNKLTNNNPVKLTWSNTQGITFEKHISLDDQFL 178

Query: 180 FKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEK 239
           F + + + N+S     F   G+I+R++    +  + + EGF++VL D+ L+E+ Y DI+ 
Sbjct: 179 FTVKEKIINSSDKSYNFYSYGQIIRNELPEISGFYILHEGFLSVLDDE-LIEEDYDDIQD 237

Query: 240 SSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPG 299
              +   + + ++ ISDK+W +  IP K   F + F Y +   A Y    S   I +   
Sbjct: 238 KKFTQIAQ-DGFVAISDKFWVTSVIPPKGKEFKTTFDYKNKFRANY---ISTKGIEVKAN 293

Query: 300 KSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGN 359
            SI     +   AK    I  Y ++L I +F++ IDWG+ YFI KP+F ++ YF+ L+GN
Sbjct: 294 SSIEEKIQIIVAAKRVNVIDGYAENLNINKFDLAIDWGFMYFITKPLFFVLDYFFKLLGN 353

Query: 360 FGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLY 419
           +G+AI+  T+ ++L FFPLA   + S   MK + P++  L+E  K    + LQ+AM+ LY
Sbjct: 354 YGLAIIAVTICIRLAFFPLANFSFKSMGKMKLLAPEMARLKELHKDDKMK-LQQAMMALY 412

Query: 420 KTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGI 479
           K   +NP++GC PIL+QIPVFFA+YKV+ +++EMRH PF+GWI DL+  DPT++F +FG+
Sbjct: 413 KKEKVNPMSGCLPILVQIPVFFALYKVLFVTIEMRHMPFYGWIHDLSDRDPTSLFNVFGL 472

Query: 480 LPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLI 539
           +P+  P F+ +G WPIIM ++M+IQ K++P P D  QA I  + PV     L+ FPAGL+
Sbjct: 473 IPWDPPSFLLIGAWPIIMGITMWIQQKLNPTPPDPIQAKIFMFFPVFLTVILAPFPAGLV 532

Query: 540 IYWSWSNVISIVQQAVIMK 558
           IYWS++N+ +++QQ ++ +
Sbjct: 533 IYWSFNNIFTMIQQYIVQR 551


>gi|163740285|ref|ZP_02147679.1| putative inner membrane protein translocase component YidC
           [Phaeobacter gallaeciensis 2.10]
 gi|161386143|gb|EDQ10518.1| putative inner membrane protein translocase component YidC
           [Phaeobacter gallaeciensis 2.10]
          Length = 605

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 210/531 (39%), Positives = 313/531 (58%), Gaps = 22/531 (4%)

Query: 69  PRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVS 128
           PR+ ++ P + G+I+L G + DDL+L+ Y + +  ++ IV +LSP+   NAY+A   +  
Sbjct: 77  PRLTIETPRVSGTISLLGGRLDDLSLKDYRVSLEEDAAIVKMLSPAGDPNAYYALYGWAP 136

Query: 129 TAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTV 186
            A     ++P +NT+W       LTP +P+ L + N   + F RTI++D+ YLF I  +V
Sbjct: 137 GAGLGPDDVPGANTLWQAEGDATLTPDSPVTLTWDNGKGLTFNRTIAVDQDYLFTITQSV 196

Query: 187 TNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNF 245
           TN S   +  +P G + RH +PQ   N F + EG I  + D +L E  Y D+    +   
Sbjct: 197 TNASGSTVALAPYGTLARHGEPQDLKNFFILHEGVIG-MADGTLAEIDYDDMTDFEVDAR 255

Query: 246 H---------ESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITI 296
                     E+N W+G +D YW S  +P    +F S  K+  +    YQ       +T+
Sbjct: 256 SGARAEVTQVETNGWIGFTDHYWMSTLVPEPGQAFRSIAKF-DERREIYQTDIVLPTVTV 314

Query: 297 LPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNL 356
             G +   T  LFAGAKE+ TI  Y+KD  I  F   IDWGWF+F+ KP+F ++ +   L
Sbjct: 315 AAGDTSEVTTMLFAGAKEWATIRGYQKD-GIEGFLDSIDWGWFFFLTKPIFAVLHWLNAL 373

Query: 357 VGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMI 416
           +GN G AI+  TV +KLL FPLA K Y S A MK +QP+++E++EK      Q LQ+ M+
Sbjct: 374 IGNMGWAIIGLTVLIKLLVFPLAYKSYASMAKMKELQPRMEEIKEKAGDDR-QKLQQEMM 432

Query: 417 QLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTL 476
            LYK   +NP AGC PIL+QIP+FF++YKVI ++LE+RHAPF+G  +DL+A DPT+I  L
Sbjct: 433 ALYKKEKVNPAAGCLPILIQIPIFFSLYKVIFVTLELRHAPFFGPFQDLSAPDPTSIMNL 492

Query: 477 FGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFA 530
           FG+LP   P        + +GI PI++ +SM++Q K++P P D  Q MI  WMP VF+F 
Sbjct: 493 FGLLPMAAPVEGTLMATIFIGILPILLGISMWLQQKLNPAPTDPTQQMIFAWMPWVFMFM 552

Query: 531 LSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ 581
           L  F +GL++YW  +N I+  QQ +IM+ HG +  +   ++S F K   ++
Sbjct: 553 LGGFASGLVVYWIANNTITFTQQYLIMRSHGYKPDVFGNIKSGFKKTPKAE 603


>gi|296535613|ref|ZP_06897793.1| inner membrane protein OxaA [Roseomonas cervicalis ATCC 49957]
 gi|296264068|gb|EFH10513.1| inner membrane protein OxaA [Roseomonas cervicalis ATCC 49957]
          Length = 524

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 201/504 (39%), Positives = 307/504 (60%), Gaps = 13/504 (2%)

Query: 70  RVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVST 129
           R+ +++P + GS+ L+GA+ DDL L+ Y    +++SP+V + +P      YFA+  + S 
Sbjct: 9   RLRVESPRVSGSLLLRGARLDDLVLKDYRETTAASSPLVRMFAPREELQPYFAQWGWSSA 68

Query: 130 ANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNN 189
                +P++ T W   SG  L P +P+ L ++N     F+  +SLD +Y+F+    V N+
Sbjct: 69  DGRTRVPDNETDWT-ASGGPLGPDSPVTLSWENGQGQTFQIVLSLDRNYMFQAEQRVINS 127

Query: 190 SIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNF---- 245
           + D +   P  R+ R +       + + EGF+ VL  + L E  Y   +           
Sbjct: 128 AADPVLVLPWSRVRRERTPHVAGFYILHEGFVGVLNGR-LNELTYKSAKDDGARTRGVAL 186

Query: 246 --HESNSWLGISDKYWASVFIP-SKETSFHSQFKYLSD-GHARYQAKFSANEI-TILPGK 300
               S  W G +DKYW +   P        + ++++++ G  R+Q  F+  +  T+  G 
Sbjct: 187 EQETSGGWAGFTDKYWLAAIAPVDAAQPLRAAWRHVAENGEDRWQVDFATPQPQTVASGA 246

Query: 301 SITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF 360
           + +    LFAGAKE   +  Y  +L I  F+  ID+GWFYF+ KP F  + Y + L GNF
Sbjct: 247 TGSIATRLFAGAKEVHLLDAYRDNLGITDFDKAIDFGWFYFLTKPFFYALDYLFKLFGNF 306

Query: 361 GIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYK 420
           GIAI++ TV +KL FFPLA K Y S A MK + PK+ E+RE++K  P +  Q  M+ LY+
Sbjct: 307 GIAILVFTVALKLAFFPLANKAYKSMARMKVLTPKMQEIRERYKDDPAKA-QSEMMALYR 365

Query: 421 THNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL 480
           +  +NP +GC PIL+QIPVFFA+YKV+ +++EMRHAPF+GWI+DL+A DPTN+F LFG++
Sbjct: 366 SEKVNPASGCLPILIQIPVFFALYKVLFVTIEMRHAPFFGWIRDLSAPDPTNLFNLFGLI 425

Query: 481 PFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLII 540
           P+  P  +H+ +W IIM ++MF+Q K++P PAD  QA I  WMP++F F L+SFPAGL+I
Sbjct: 426 PWDPPALLHMPVWAIIMGVTMFVQQKLNPAPADPIQAKIFTWMPIIFTFMLASFPAGLVI 485

Query: 541 YWSWSNVISIVQQAVIMKMHGAEI 564
           YWSW+N++S+ QQ  IM+ H  E+
Sbjct: 486 YWSWNNLLSVAQQWYIMR-HEREV 508


>gi|110678771|ref|YP_681778.1| putative inner membrane protein translocase component YidC
           [Roseobacter denitrificans OCh 114]
 gi|123172722|sp|Q16AA1|OXAA_ROSDO RecName: Full=Inner membrane protein oxaA
 gi|109454887|gb|ABG31092.1| inner membrane protein oxaA, putative [Roseobacter denitrificans
           OCh 114]
          Length = 606

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 223/602 (37%), Positives = 344/602 (57%), Gaps = 30/602 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIE-----EMNNE-RKNIQTVKQPNQVDNSYAA 55
           ++N N  +A ALS I++  W   +  P  E     E + E   +  T   P+   ++  +
Sbjct: 3   DQNKNLILATALSFIVILVWFVLFPPPEPEMPLTGETSTELTPDAATGSLPSVTSDTAPS 62

Query: 56  VLIDD--RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSP 113
           V+I+   R+ AL  +PRVE+    + GSI+L G + DDL+L+ Y      ++ IVT+LSP
Sbjct: 63  VVIEGETRSAALEQAPRVEIATDRVKGSISLLGGRIDDLSLKDYRETQEEDADIVTMLSP 122

Query: 114 SNTKNAYFAELDYVSTA--NNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERT 171
             +  AY+A   + + A  +  ++P  +T W +I G IL+   P+ L + N   + F R 
Sbjct: 123 VGSPGAYYALYGWAAGAGVDPSQVPGPDTEWQVIDGDILSVDAPVTLQWDNGAGLSFTRI 182

Query: 172 ISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVLGDKSLV 230
           I +D++Y+F+I  +V N S   +  +P G + RH +P    N F + EG +A + D  L 
Sbjct: 183 IEIDDNYMFQITQSVANTSDAPVTVAPYGILARHGEPDDLKNFFILHEGVVA-MADGELT 241

Query: 231 EQKYSDIEKSSISNFHES---------NSWLGISDKYWASVFIPSKETSFHSQFKYLSDG 281
           E  + DI +  +               N W+G +D +W SV IP    S     KY    
Sbjct: 242 ETNWDDIPEFPVDQREGVPAERIENVLNGWIGFTDHFWMSVLIPDPSASARLTTKYRPRA 301

Query: 282 HARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYF 341
              YQA+      T+ PG S++ T  LFAGAKE+ TI +Y+ D  + RF   IDWGWF+F
Sbjct: 302 DI-YQAETVLPAQTVAPGTSVSATTQLFAGAKEWETIRNYQTD-GVDRFIDSIDWGWFFF 359

Query: 342 IAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELRE 401
           + KP+F L+ Y    +GN G AI+  T+ +K +  PLA K YVS A MK +QP++++L+E
Sbjct: 360 LTKPIFFLLHYLNAFIGNMGWAIIGLTLIIKAILLPLAYKSYVSMAKMKELQPQMEKLKE 419

Query: 402 KFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGW 461
           +      Q +Q+ M++LYK   +NP AGC PILLQIP+FF++YKVI +++E+RHAPF+G 
Sbjct: 420 EAGDDR-QKMQQGMMELYKKEKVNPAAGCLPILLQIPIFFSLYKVIFVTIELRHAPFFGP 478

Query: 462 IKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKG 515
            +DL+A DPT+I  L+G+LPF  P        + +GI P+++ +SM++Q K++P P D  
Sbjct: 479 FQDLSAPDPTSIMNLYGLLPFDGPEPGSIMALIFIGILPLLLGISMWLQQKLNPAPTDPT 538

Query: 516 QAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFS 575
           Q MI  WMP VF+F L  F +GL++YW  +N I+ VQQ +IM+  G +  +   ++  F 
Sbjct: 539 QQMIFAWMPWVFMFMLGGFASGLVVYWIANNTITFVQQYMIMRSQGYKPDVFGNIKGGFQ 598

Query: 576 KN 577
           K 
Sbjct: 599 KK 600


>gi|16125020|ref|NP_419584.1| putative inner membrane protein translocase component YidC
           [Caulobacter crescentus CB15]
 gi|221233743|ref|YP_002516179.1| inner membrane protein translocase component YidC [Caulobacter
           crescentus NA1000]
 gi|38503160|sp|Q9AA40|OXAA_CAUCR RecName: Full=Inner membrane protein oxaA
 gi|254772763|sp|B8H1E8|OXAA_CAUCN RecName: Full=Inner membrane protein oxaA
 gi|13422004|gb|AAK22752.1| 60 kd inner-membrane protein [Caulobacter crescentus CB15]
 gi|220962915|gb|ACL94271.1| inner membrane protein translocase component yidC [Caulobacter
           crescentus NA1000]
          Length = 615

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 227/612 (37%), Positives = 345/612 (56%), Gaps = 50/612 (8%)

Query: 3   RNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVD-------NSYAA 55
           +N   F+  A +++I Y  Q F + P+ ++   E +  +  +Q +          N   A
Sbjct: 6   KNTLMFIVSAFAILIGY--QFFVLGPQQKKAEAEFRAKKAAEQQSAAKAGVTLDANGNPA 63

Query: 56  VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSN 115
            L   R  A ++SPR+E+  P+L GSI LKGA+ DDL LR Y      +SP V L  P  
Sbjct: 64  PLRLSRDAAKALSPRIEVDTPALSGSIALKGARIDDLFLRKYDETTKKDSPPVELFRPEG 123

Query: 116 TKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD 175
            ++A+FA+  +   AN   LP+S TVW    G++L P +P+ L + N   + F R I++D
Sbjct: 124 AEHAWFADFGWAG-ANLPGLPDSRTVWTAAPGQVLRPNSPVTLTYDNGLGLTFTRVIAVD 182

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFG----VQEGFIAVLG---DKS 228
           +  +F + D+V NN  + ++ +P   + R   Q  ++  G    V EG I VLG   ++ 
Sbjct: 183 DQAMFTVTDSVKNNGTNGLQLAPYATVQR---QGISDALGKNQIVHEGAIGVLGATDEQK 239

Query: 229 LVEQKYSDIEKSS-ISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLS-DGHARYQ 286
           L   KY   +K   + +F     W GI+DKYW +  IP +  +  +Q++  +  G   Y 
Sbjct: 240 LEMAKYGKWKKDKPLQSFDSVGGWTGITDKYWLAALIPGQNQAIKAQYRVTNVAGIDVYD 299

Query: 287 AKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYE---------------KDLAIPRFE 331
             F      + PG +++ T  LFAGAK  P +  YE                   IPRF+
Sbjct: 300 VNFLGPVQVLNPGATVSQTTRLFAGAKTVPLLRKYEYGATPAPAIWEFWNKTKAEIPRFD 359

Query: 332 MLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKN 391
             +DWG F F  +P+F ++  FY LVGNFG+AI+L TV +KL+ +P+A K Y S A MK 
Sbjct: 360 DAVDWGMFRFFTRPIFNILEVFYKLVGNFGLAILLLTVVLKLVLYPMADKSYESMAKMKK 419

Query: 392 IQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISL 451
           I P++++L+ K K  P +  Q+ M+ LY+   INP+ GC P+L+QIPVF+A+YKV+++++
Sbjct: 420 IAPEVEKLKAKHKDDPAK-QQQEMMALYQKEKINPMMGCLPMLIQIPVFYALYKVLTVTI 478

Query: 452 EMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFM--------HVGIWPIIMSLSMFI 503
           EMRHAPF+GWI+DL+A DPT +F LFG++P + PG +        H+G+WP++   +M++
Sbjct: 479 EMRHAPFFGWIQDLSAPDPTTMFNLFGLIP-WDPGSLPLIGAMIAHLGVWPLLYGFTMWL 537

Query: 504 QMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
              M+PP  D  Q  I  W PV+F F LS F  GL+IYW WSNV++I QQ +IM+ +  E
Sbjct: 538 TTAMNPPAGDPIQQKIFQWFPVIFTFTLSGFAVGLVIYWCWSNVLTIFQQYIIMRRYKVE 597

Query: 564 ---IGLIDRLRS 572
                +I RLR 
Sbjct: 598 NPIDQIIARLRG 609


>gi|262277963|ref|ZP_06055756.1| 60 kDa inner membrane insertion protein [alpha proteobacterium
           HIMB114]
 gi|262225066|gb|EEY75525.1| 60 kDa inner membrane insertion protein [alpha proteobacterium
           HIMB114]
          Length = 560

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 211/559 (37%), Positives = 333/559 (59%), Gaps = 10/559 (1%)

Query: 3   RNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD-- 60
            N N   A+ LS  ++  WQ +Y  P  +  N E+   Q +K       S +   ++   
Sbjct: 2   ENKNVLAAVVLSTFVIMMWQFWYGEPVPQTQNQEQVQQQQLKGDKPSAPSISQKKVETKL 61

Query: 61  -RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNA 119
            R+ A++   R++++N ++ GSI L GA  DD+ L+ Y+ D + +   V LL+P     A
Sbjct: 62  TRSDAINQGDRIKIENSAVEGSIALTGALIDDVTLKNYNQDNTGDQTKVILLNPKKYDQA 121

Query: 120 YFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYL 179
           YF E  + ++ N I +P++ T+W     K LTP TP++L + N   + F +  ++D+ YL
Sbjct: 122 YFLETGWATSGNEI-VPDNQTLWTAKGNKTLTPNTPVELEWNNGQGLTFIKKFTIDDQYL 180

Query: 180 FKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEK 239
             I + + NNS   +      +I R +     + F + EG + ++ D++L E+ Y DI +
Sbjct: 181 ITINEEIKNNSNQTVNLFHYAQITRQEKPEIQDFFILHEGLLGIV-DETLTEEDYDDIVE 239

Query: 240 SSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPG 299
                F+ S  W+GI+DKYW +  IP K  +F ++F Y     + Y      +  TI   
Sbjct: 240 KK-KTFNGSQGWVGITDKYWLTAIIPEKGKNFKAEFSYDKSFKSNY---IITDATTINVN 295

Query: 300 KSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGN 359
           ++ +  + LF GAKE   I  Y       +F++ IDWGWF+F  KP+F ++ Y +   GN
Sbjct: 296 QTGSNISNLFIGAKEVSVIDGYTASNGFHKFDLAIDWGWFHFFTKPLFFIIDYLFKWCGN 355

Query: 360 FGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLY 419
           FGIAI+L T  V+L+FFPLA   + S A MK +QP++  L++ +K+   Q +Q  M+ LY
Sbjct: 356 FGIAIILLTAGVRLIFFPLANYSFASMAKMKALQPEMQRLKDLYKEDK-QKIQMEMMNLY 414

Query: 420 KTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGI 479
           K   +NP++GC P++LQIP FFAIYK++ +++EMRHAPF+GWI+DL+AADPT+IF LFG+
Sbjct: 415 KREKVNPISGCLPVMLQIPFFFAIYKMLFVTIEMRHAPFYGWIQDLSAADPTSIFNLFGL 474

Query: 480 LPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLI 539
           +P+  PGF+ +G WPIIM ++M+IQ K++P P D  QA I  + P      L+SFP+GL+
Sbjct: 475 IPWDPPGFLIIGAWPIIMGVTMYIQQKLNPAPPDPIQAKIFMFFPFFLTILLASFPSGLV 534

Query: 540 IYWSWSNVISIVQQAVIMK 558
           IYWS +NV+++ QQ VI++
Sbjct: 535 IYWSVNNVLTMAQQYVIIR 553


>gi|89053128|ref|YP_508579.1| putative inner membrane protein translocase component YidC
           [Jannaschia sp. CCS1]
 gi|122499543|sp|Q28UQ8|OXAA_JANSC RecName: Full=Inner membrane protein oxaA
 gi|88862677|gb|ABD53554.1| protein translocase subunit yidC [Jannaschia sp. CCS1]
          Length = 626

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 227/627 (36%), Positives = 353/627 (56%), Gaps = 51/627 (8%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNN------ERKNIQT-----VKQPNQVD 50
           ++N N  +A  LS +++  W   +  P + E  N      E   ++T     +  P  V 
Sbjct: 3   DQNRNLILATGLSFVVILVWFLLFPPPEMVEDPNAIPPAAETGGVETDTGIALTPPVTVA 62

Query: 51  NSYAAVLIDDRAQ-ALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVT 109
           ++ A       ++ ALS + R+++  P++ GSI+L G + DDL+LR Y  +V  +  IV 
Sbjct: 63  DAPAGADTTAPSEVALSEAARIDIDTPAVEGSISLLGGRIDDLSLRNYFTEVDGDQ-IVR 121

Query: 110 LLSPSNTKNAYFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNIL 167
           LLSP  + + Y+A   +  + +    ++P S+T W L SG ILTP +PI L + N + ++
Sbjct: 122 LLSPVGSDDPYYALYGWTPSGDLGYADVPTSDTPWELESGTILTPDSPITLAWDNGSGLI 181

Query: 168 FERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHK-PQTATNTFGVQEGFIAVLGD 226
           F RTI +D+ ++F++  +V N    ++  +P G + RH  P    N F + EG +  + D
Sbjct: 182 FRRTIEIDDRFMFQVTQSVENTGGAEVNLAPYGIVARHGLPSDLQNFFILHEGVVRKV-D 240

Query: 227 KSLVEQKYSDIEKSSISNFH---------ESNSWLGISDKYWASVFIPSKETSFHSQFKY 277
             L E  YSD+    I             E+N W+G +DKYW +  IP +  SF S  KY
Sbjct: 241 GELSELGYSDLPDLDIIAREGVPAEVMEVETNGWIGFTDKYWMTTLIPGENQSFVSVVKY 300

Query: 278 LSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYE--------------K 323
           +      YQ +     ++I PG++   T  LFAGAKE   I  YE              +
Sbjct: 301 VPSAEI-YQTEARLPYMSIAPGETAEVTTQLFAGAKEAEAIRDYENAEPGLIASLFGAEQ 359

Query: 324 DLA---IPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAK 380
           D +   IPRF   IDWGWFYF+ KP+F L+ +    +GN G+AI+  T+ VK + FPLA 
Sbjct: 360 DASRGEIPRFIDSIDWGWFYFLTKPLFWLLHWLNGAIGNMGLAIISLTLIVKAVLFPLAY 419

Query: 381 KQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVF 440
           + YVS A MK +QP+I++L+E       Q LQ+ M++LYK + +NP  GC PILLQIP+F
Sbjct: 420 RSYVSMAKMKELQPEIEKLKESAGDDR-QKLQQGMMELYKKNKVNPAGGCLPILLQIPIF 478

Query: 441 FAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWP 494
           F++YKVI ++LE+RHAPF+GW+ DL+A D ++I  L+G+LP   P        + +GI P
Sbjct: 479 FSLYKVIFVTLELRHAPFFGWLNDLSAPDSSSIINLYGLLPNPAPEPESIMALIFIGILP 538

Query: 495 IIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQA 554
           +++ +SM++Q K++P P D  QA I  W+P VF+F L SF +GL++YW  +N ++  QQ 
Sbjct: 539 LLLGISMWLQQKLNPAPTDAMQAQIFAWLPWVFMFMLGSFASGLLVYWIANNTLTFTQQY 598

Query: 555 VIMKMHGAEIGLIDRLRSTFSKNYNSQ 581
           +IM+  G +  +   +RS+F K    +
Sbjct: 599 LIMRSQGFKPDVFGNIRSSFKKKAKEE 625


>gi|260432492|ref|ZP_05786463.1| inner membrane protein OxaA [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416320|gb|EEX09579.1| inner membrane protein OxaA [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 609

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 220/604 (36%), Positives = 347/604 (57%), Gaps = 31/604 (5%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD- 60
           ++N N  +A ALS +++  W   +  P    + ++     T     Q  N+    ++ D 
Sbjct: 3   DQNKNLILATALSFLVILVWFVLFPPPEPTTLQDQTAISATEGDEIQTPNAAEPSVVGDA 62

Query: 61  -----RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSN 115
                 AQ +S  PRVE+  P L GS++L G + D+L L+ Y + +  ++PIV LLSP  
Sbjct: 63  ATEATEAQPVSDVPRVEIDTPRLTGSLSLSGGRVDELYLKDYKVSLEDDAPIVELLSPVG 122

Query: 116 TKNAYFAELDYVSTA--NNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTIS 173
           + +AY+A   +   A  +  ++P  NT+WN+ SG+ L   +P+ L + N N + F RTI+
Sbjct: 123 SDSAYYALYGWAPGAGLSGADVPGPNTLWNIESGETLGVDSPVTLKWDNGNGLTFRRTIA 182

Query: 174 LDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFI---AVLG--DKS 228
           +DE Y+F +  +V N +  +I  +P G + RH      +  G++  FI    V+G  D +
Sbjct: 183 VDEDYMFTVTQSVENATQAEIGMAPYGILARHGMGEDGDLPGLKNFFILHEGVIGMADGT 242

Query: 229 LVEQKYSDI--------EKSSISNFH-ESNSWLGISDKYWASVFIPSKETSFHSQFKYLS 279
           L E KY D+        E++    +  + N W+G +D YW +  IP   + F +  KY S
Sbjct: 243 LTEVKYDDVRDFDIDPNERAQAEVYQVKENGWIGFTDHYWMTTLIPEPGSPFKAAAKYDS 302

Query: 280 DGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWF 339
                YQ +     +T+ PG++      LFAGAKE+ TI  Y+    + +F   IDWGWF
Sbjct: 303 R-RKIYQTETVLPTLTVAPGETAQVKTRLFAGAKEWETIREYQAQ-GVQKFIDSIDWGWF 360

Query: 340 YFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDEL 399
           +F+ KP+F L+     L+GN G +I+  T+ +K + FPLA K YVS A MK +QP+++ L
Sbjct: 361 FFLTKPIFWLLHNINALIGNMGWSIIGLTLIIKAILFPLAFKSYVSMAKMKELQPQMEAL 420

Query: 400 REKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFW 459
           +E       Q +Q+ M++LYK   +NP AGC PILLQIP+FF++YKVI +++E+RHAP++
Sbjct: 421 KEAAGDDR-QKMQQGMMELYKKEKVNPAAGCLPILLQIPIFFSLYKVIFVTIELRHAPWF 479

Query: 460 GWIKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPAD 513
           G  +DL+A DPT+I  LFG+LP+  P        + +GI P+++ +SM++Q K++P P D
Sbjct: 480 GPFRDLSAPDPTSIMNLFGLLPWAGPEPGTLMATIFIGILPLLLGISMWLQQKLNPAPTD 539

Query: 514 KGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRST 573
             QAMI  WMP VF+F L SF +GL+IYW  +N I+  QQ +IM+  G +  +   + S+
Sbjct: 540 PTQAMIFAWMPWVFMFMLGSFASGLVIYWIANNTITFTQQYLIMRSQGYKPDVFGNIMSS 599

Query: 574 FSKN 577
           F + 
Sbjct: 600 FKRT 603


>gi|148284763|ref|YP_001248853.1| putative inner membrane protein translocase component YidC
           [Orientia tsutsugamushi str. Boryong]
 gi|146740202|emb|CAM80485.1| 60 kD inner-membrane protein, preprotein translocase subunit
           [Orientia tsutsugamushi str. Boryong]
          Length = 567

 Score =  409 bits (1050), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 219/562 (38%), Positives = 340/562 (60%), Gaps = 11/562 (1%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPRIEEMNN-ERKNIQTVKQP--NQVDNSYAAVLIDDRA 62
           N  +AI LS+ I+  W  FY  PR+ +M+N +++ I+  K+   NQ     +A+ I D+ 
Sbjct: 8   NLILAITLSLAIILGWHFFYEKPRLIKMSNAQKEKIEYNKRSSTNQYLLHESALKIKDKV 67

Query: 63  QALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFA 122
             +  S RV++    L GSI+LKG +FDDL L GY  DV  NSP V LLSPS T  AYFA
Sbjct: 68  DIIDYSTRVKIMTNKLHGSISLKGLRFDDLILVGYKQDVLENSPDVELLSPSETATAYFA 127

Query: 123 ELDYVSTAN-NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFK 181
           E+ +    N + + PNS+T+W      IL         + N +N+ F  ++S+D++Y+F 
Sbjct: 128 EVGWYCAKNADSDFPNSDTLWQ-TDKSILQANDTTTFTWTNKHNVQFIVSVSIDDNYMFT 186

Query: 182 IVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI-EKS 240
           I  ++ NNS  Q+     G I R+  +   N+  + +G IA + D  L E  Y+ + EK 
Sbjct: 187 INQSIVNNSKQQLAVQFHGLIHRNLAENE-NSANIFQGPIASI-DSYLNEVTYNKLKEKK 244

Query: 241 SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKF-SANEITILPG 299
            I        WLGISDKYW + FIP  +  + + F Y   G  +YQ  F S  E+    G
Sbjct: 245 HIDYNLNVVHWLGISDKYWLTSFIPDVKYRYSTSFMYGKAGFEKYQVSFLSPKEVVNSDG 304

Query: 300 KSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGN 359
            S++  + LF GAKE   + +Y +   I  F+  ID+GWFY + KP+F  +S+FY   GN
Sbjct: 305 GSLSVVHHLFLGAKEVKLLDYYAEKYNIKLFDRAIDFGWFYILTKPLFYTLSFFYKYCGN 364

Query: 360 FGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLY 419
           FG++I++ T+ +K++ F  + + Y S   M+++QP+I  L+E +     ++ Q+ M  LY
Sbjct: 365 FGVSILIVTILIKIMMFSFSNRSYSSMKKMRDLQPRIQRLQELYGDDKIKLHQEIM-ALY 423

Query: 420 KTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGI 479
           K   ++        L+Q+P+FF++YKV+ +++EMRHAPF  WIKDL+A DPT IF LFG+
Sbjct: 424 KKEKVSLAGSFLQSLIQLPIFFSLYKVLHVTIEMRHAPFLSWIKDLSALDPTCIFNLFGL 483

Query: 480 LPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPAGL 538
           LPF++PGF+++G  P++ S +M +Q K++P P AD  QA +L +MP++ +   ++FPAGL
Sbjct: 484 LPFHVPGFLNIGALPVLTSATMILQQKINPAPTADPAQAQVLKFMPLILLIVFNNFPAGL 543

Query: 539 IIYWSWSNVISIVQQAVIMKMH 560
           +IYW+W+N++SIVQQ +I K++
Sbjct: 544 LIYWTWNNILSIVQQFIINKIN 565


>gi|254464722|ref|ZP_05078133.1| 60 kDa inner membrane insertion protein [Rhodobacterales bacterium
           Y4I]
 gi|206685630|gb|EDZ46112.1| 60 kDa inner membrane insertion protein [Rhodobacterales bacterium
           Y4I]
          Length = 600

 Score =  408 bits (1049), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 213/531 (40%), Positives = 314/531 (59%), Gaps = 24/531 (4%)

Query: 70  RVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVST 129
           R+ +  P + GSI+L+G + DDL+L+ Y   + +NSPIV LL P     AY+A   +   
Sbjct: 74  RLAIDTPRVTGSISLQGGRIDDLSLKDYRETLDANSPIVKLLKPVGEAQAYYALYGWAPG 133

Query: 130 ANNI--ELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVT 187
           A     ++P +NTVW+  +   LTP +P+ L + N   + F RTIS+DE Y+F I  +V 
Sbjct: 134 AGLSLDDVPGANTVWSAGADATLTPDSPVTLTWDNGKGLTFSRTISVDEDYMFSITQSVA 193

Query: 188 NNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI--------- 237
           N S   +  +P G + RH +P    N F + EG +  + D  L E  Y D+         
Sbjct: 194 NASGGTVSLAPYGTLARHSQPADLKNFFILHEGLVG-MSDGELAEIDYDDMADFEADARD 252

Query: 238 -EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITI 296
             K+ +    E N W+G +D YW S  +P+   +F S  K+  +    YQ       +T+
Sbjct: 253 GSKAEVRQVAE-NGWIGFTDHYWMSTLVPAPGQAFRSIAKF-DERRDIYQTDIVLPTVTV 310

Query: 297 LPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNL 356
             G+S   T  LFAGAKE+ TI  Y+K   I  F  +IDWGWF+F+ KPMF L+     L
Sbjct: 311 ADGQSSEVTTQLFAGAKEWETIRGYQK-AGIQGFLDVIDWGWFFFLTKPMFWLLHNLNVL 369

Query: 357 VGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMI 416
           +GN G AI+  TV +K+L FPLA K Y S A MK +QP++++L+E+      Q +QK M+
Sbjct: 370 IGNMGWAIIGLTVVIKILVFPLAYKSYASMAKMKELQPEMEKLKERAGDDR-QKMQKEMM 428

Query: 417 QLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTL 476
           +LYK   +NP AGC PIL+QIP+FF++YKVI ++LE+RHAPF+G  +DL+A DPT+IF L
Sbjct: 429 ELYKREKVNPAAGCLPILIQIPIFFSLYKVIFVTLELRHAPFFGPFQDLSAPDPTSIFNL 488

Query: 477 FGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFA 530
           FG+LP+  P        + +GI PI++ +SM++Q K++P P D  Q MI  WMP VF+F 
Sbjct: 489 FGLLPWAAPAPESILALVFIGILPILLGVSMWLQQKLNPAPTDPTQQMIFAWMPWVFMFM 548

Query: 531 LSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ 581
           L  F +GL++YW  +N I+  QQ +IM+ HG    +   ++S+F K   ++
Sbjct: 549 LGGFASGLVVYWIANNTITFTQQYLIMRSHGYSPDVFGNIKSSFKKKPKAE 599


>gi|84499797|ref|ZP_00998085.1| putative inner membrane protein translocase component YidC
           [Oceanicola batsensis HTCC2597]
 gi|84392941|gb|EAQ05152.1| putative inner membrane protein translocase component YidC
           [Oceanicola batsensis HTCC2597]
          Length = 608

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 211/611 (34%), Positives = 342/611 (55%), Gaps = 38/611 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
           ++N N  +A  LS I++  W  F ++P  E +++           +Q D +       D 
Sbjct: 3   DQNKNLILATVLSFIVIVVW--FLLFPPPERVDDPNAPATGETAQSQADGTAPMTPGADT 60

Query: 62  AQALSM-------------SPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIV 108
            +  S+             +PR+ +  P L GSINL+G + DDL L+ Y   + +++  V
Sbjct: 61  REGASVPSDAAPASADTEEAPRLGIDTPRLAGSINLRGGRIDDLKLKDYLTSLDADATRV 120

Query: 109 TLLSPSNTKNAYFAELDY--VSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNI 166
           T+L P + ++ ++A   +  VS A+   +P  +TVW++     LTP TP+ + ++N   +
Sbjct: 121 TVLRPEDQRDPFYALYGWIPVSGADAGAMPAEDTVWSVEGTPTLTPETPVTMTWENDAGL 180

Query: 167 LFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHK-PQTATNTFGVQEGFIAVLG 225
           +F RT+ +D  Y+F +  TV N   + +   P   + RH  P      F + EG I  + 
Sbjct: 181 IFRRTVGIDTDYMFTVRQTVENTGENPVALRPYSVLRRHGIPSDLKKFFVLHEGLIR-MS 239

Query: 226 DKSLVEQKYSDIEKSSISNFH---------ESNSWLGISDKYWASVFIPSKETSFHSQFK 276
           D  L E+ Y ++E   +             + + W G +D YW S  IP  +T+F S  K
Sbjct: 240 DGELQEESYGNLEDFDVDGREGVPAERIEVQESGWTGFTDHYWMSTIIP--DTAFRSTAK 297

Query: 277 YLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDW 336
           Y   G + +Q       + I PG S +    LFAGAKE+ TI  Y+ D  + RF   IDW
Sbjct: 298 YFP-GRSIFQTDAVLPAVEIAPGASASVDTRLFAGAKEWETIKEYQNDHGVTRFLDAIDW 356

Query: 337 GWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKI 396
           GWF+F+ KP+F ++ +  + +GN G +I+  TV +K++ FPLA K Y S A M+ +QP++
Sbjct: 357 GWFFFLTKPIFAVLHWLNSHIGNMGWSIIALTVLLKMVLFPLAYKSYASMAKMRELQPEM 416

Query: 397 DELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHA 456
           ++++E+      Q LQK M++LYK   +NP +GC PILLQIP+FF++YKVI ++LE+RHA
Sbjct: 417 EKIKERAGDD-RQKLQKEMMELYKKEKVNPASGCLPILLQIPIFFSLYKVIFVTLELRHA 475

Query: 457 PFWGWIKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPP 510
           P+ GWI DL+A DP++I  LFG+LP   P        + +G+ PI++ +SM++Q K++P 
Sbjct: 476 PWIGWIHDLSAPDPSSILNLFGLLPIATPDPDSFLAIISLGVLPILLGVSMWLQQKLNPA 535

Query: 511 PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL 570
           P D  Q MI  WMP VF+F L +F +GL++YW  +NVI+ +QQ  IM+ HG +  +   +
Sbjct: 536 PTDPTQQMIFAWMPWVFMFMLGTFASGLVLYWITNNVITFMQQYAIMRSHGFKPDVFGNI 595

Query: 571 RSTFSKNYNSQ 581
           R + ++   ++
Sbjct: 596 RKSLTRKKKAE 606


>gi|126724910|ref|ZP_01740753.1| putative inner membrane protein translocase component YidC
           [Rhodobacterales bacterium HTCC2150]
 gi|126706074|gb|EBA05164.1| putative inner membrane protein translocase component YidC
           [Rhodobacterales bacterium HTCC2150]
          Length = 620

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 221/602 (36%), Positives = 340/602 (56%), Gaps = 30/602 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD- 60
           + N N  +A+ALSV+++ AW  F+  P  E         Q+       D       + + 
Sbjct: 3   DENKNLLLAMALSVMVIIAWSIFFPAPVDETPVAATSGEQSTTAGVSADAGSDVAAVSNV 62

Query: 61  ------RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPS 114
                 R  ALS + R ++  P L GSI+  G + DDL+L+ Y +++   S IVTLL+P 
Sbjct: 63  PTSAEVRTAALSSATRADIDTPRLSGSISTLGGRIDDLSLKDYRIELDEASDIVTLLTPE 122

Query: 115 NTKNAYFAELDYVSTANN--IELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTI 172
            T++AY+A   +    +    ++P   T W +   + LTP TP+ LV++N   + F + I
Sbjct: 123 GTQDAYYALYGWAPGGDLGWDDVPGPETQWAIEGNEKLTPETPVTLVWENTTGMTFRQII 182

Query: 173 SLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVLGDKSLVE 231
           S+D  +LF +   V+NN     R +P  +I RH +P      F + EG I   G+ S  E
Sbjct: 183 SVDADFLFSVQQEVSNNGSTAARLAPYSQIRRHGEPTDMKGFFILHEGAIRQSGE-SQKE 241

Query: 232 QKYSDI----------EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDG 281
             YSD+          ++S + +   SN WLG +D YW +  IP     F S  +Y +  
Sbjct: 242 YDYSDLADFDRDDQWGDRSDVVDVA-SNGWLGFTDHYWMTALIPESAQPFKSVLQYKAQQ 300

Query: 282 HARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYF 341
              Y ++     +T+  G++ T T   FAGAKE+  I  YE +  I RF   IDWGWFYF
Sbjct: 301 DV-YLSETRLPTLTVEAGQTNTVTTHFFAGAKEWAVIREYEANNGIYRFIDSIDWGWFYF 359

Query: 342 IAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELRE 401
           + KP+F ++     ++GN G +I+  T+ +K L FPLA K YVS A MK +QP++ E++E
Sbjct: 360 LTKPIFWVLHSLNGIIGNMGWSIIGLTLLIKALLFPLAYKSYVSMAKMKELQPQMAEIKE 419

Query: 402 KFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGW 461
           K      +V QK +++LYK   +NP +GC PILLQIP+FF++YKVI +++++RHAP+ GW
Sbjct: 420 KAGDDKSKV-QKEIMELYKKEKVNPASGCLPILLQIPIFFSLYKVIFVTIDLRHAPWVGW 478

Query: 462 IKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKG 515
           IKDL+A D +++F LFGILP+  P        + +G+ P+++ +SM++Q K++P P D  
Sbjct: 479 IKDLSAPDTSSLFNLFGILPWDSPEPGSIMALIFIGVLPLLLGISMWLQQKLNPAPTDAT 538

Query: 516 QAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFS 575
           QAMI  WMP VF+F L SF +GL++YW  +N I+  QQ +IM+  G +  +   + S+F 
Sbjct: 539 QAMIFAWMPWVFMFMLGSFASGLVVYWIANNTITFTQQYLIMRSQGFKPDVFGNIMSSFK 598

Query: 576 KN 577
           K 
Sbjct: 599 KK 600


>gi|99080148|ref|YP_612302.1| putative inner membrane protein translocase component YidC
           [Ruegeria sp. TM1040]
 gi|122398415|sp|Q1GJX6|OXAA_SILST RecName: Full=Inner membrane protein oxaA
 gi|99036428|gb|ABF63040.1| protein translocase subunit yidC [Ruegeria sp. TM1040]
          Length = 608

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 210/525 (40%), Positives = 313/525 (59%), Gaps = 24/525 (4%)

Query: 69  PRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVS 128
           PR+ +  P + GSI+LKG + DDL L+ Y   +  +SPIVTLLSP+   +AY+A   +  
Sbjct: 78  PRLTIDTPRVEGSISLKGGRIDDLRLKDYRETLDDDSPIVTLLSPAGQPHAYYALYGWAP 137

Query: 129 TAN-NIE-LPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTV 186
            A   IE +P +NT+W   +G  LTP TP+ L + N   + F R +S+DE Y+F I  +V
Sbjct: 138 GAGLGIEDVPTANTLWQAEAGATLTPDTPVTLTWDNGKGLTFSREVSIDEDYMFSITQSV 197

Query: 187 TNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI-------- 237
           TN+S   +  +P G + RH +P    N F + EG +  + D  L E  Y D+        
Sbjct: 198 TNSSGASVALAPYGTLARHGEPANLENFFVLHEGVVG-MADGELSEIDYDDMTDFDPDPR 256

Query: 238 --EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
              ++ ++   E N W+G +  YW S  IP+   +F +  KY  +    YQ       +T
Sbjct: 257 DGSRAQVNTVTE-NGWIGFTGHYWMSTLIPAPGEAFRAIAKY-DERRDIYQTDVVLPTVT 314

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           +  G+S +    LFAGAKE+ TI  YE+   I  F   IDWGWF+F  KP+F ++ +   
Sbjct: 315 LAAGESTSANTQLFAGAKEWATIREYER-AGIEGFLDSIDWGWFFFFTKPIFAVLHWLNA 373

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
            +GN G+AI+  T  +K+L FPLA K Y S A MK +QP++++LRE+      Q +QK M
Sbjct: 374 AIGNMGVAIIALTFLLKILVFPLAYKSYASMARMKELQPEMEKLRERAGDDR-QKMQKEM 432

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           ++LYK   +NP AGC PIL+QIP+FF++YKVI ++LE+RHA F+G  +DL+  DPT++F 
Sbjct: 433 MELYKREKVNPAAGCLPILIQIPIFFSLYKVIFVTLELRHAAFFGPFQDLSVPDPTSLFN 492

Query: 476 LFGILPFYLPG------FMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVF 529
           LFG+LP+  P        + +GI PI++ +SM++Q K++P P D+ Q MI  WMP VF+F
Sbjct: 493 LFGLLPWAAPAPDSLLSLVFIGILPILLGVSMWVQQKLNPAPTDETQRMIFAWMPWVFMF 552

Query: 530 ALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTF 574
            L  F +GL++YW  +NVI+  QQ +IM+ HG    +   ++S F
Sbjct: 553 MLGGFASGLVVYWITNNVITFTQQYLIMRSHGYTPDVFGNIKSGF 597


>gi|307294062|ref|ZP_07573906.1| membrane protein insertase, YidC/Oxa1 family [Sphingobium
           chlorophenolicum L-1]
 gi|306880213|gb|EFN11430.1| membrane protein insertase, YidC/Oxa1 family [Sphingobium
           chlorophenolicum L-1]
          Length = 567

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 206/565 (36%), Positives = 323/565 (57%), Gaps = 12/565 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAW----QNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAV 56
           M+   N  +A+ L+  I++ W     +F+          E      +        +  A 
Sbjct: 1   MDDKKNIILAVVLTAAILFGWPYVANHFFPAANPPATKIEGGKTTPLTPSGSAPAAEGAA 60

Query: 57  LIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNT 116
            + D A  L   PR+ ++ P + GSINLKGA+ DD+ L  Y   ++ +S  + L SPS T
Sbjct: 61  AVRDLALVLKDGPRIPIRTPKITGSINLKGARIDDIVLPTYKESIARDSHAIRLYSPSGT 120

Query: 117 KNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE 176
           K+AYFA   +      ++ P+ N+VW   SGK LTP +P+ L + N     FE   S+DE
Sbjct: 121 KDAYFAGFGW--QGEGLKTPDGNSVWT-ASGKELTPASPVTLTWNNGAGQSFEIRYSIDE 177

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
           +Y+      V+N+    +     G + R  P T  +T+ +  G + V    +  +  Y D
Sbjct: 178 NYMITAQQKVSNSGAGTVAVKSYGYVSRAHPSTDPDTWTIHVGPMGVFNGAANYDVNYKD 237

Query: 237 IEKSSIS-NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
           +EK   S +F  +  W+G +DKYW S  +P ++ +F +Q +       ++Q   S   + 
Sbjct: 238 LEKGPASQSFQSTGGWIGFTDKYWLSALVPDQKAAFSAQMR--KGAGTQFQTDISLAPVM 295

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           +  GKS+T TN LF GAKE  T+  Y+ D  IP F+  IDWGWFY+  KP+F L+ + + 
Sbjct: 296 LAAGKSVTQTNRLFVGAKEVKTLEAYQ-DAGIPLFDRAIDWGWFYWFEKPIFALLHWLFE 354

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
            +GNFG+AI+  T  V+ L FP+A++Q+ S A M+ +QPK+  L+EK+K   P+ LQ+ M
Sbjct: 355 HIGNFGVAIICLTFVVRGLMFPVAQRQFASMAAMRAVQPKMKALQEKYKDDKPK-LQQEM 413

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           ++LYK   +NPLAGC PI +QIP+FFA+YKV+ +++EMRH PF  WIKDL+A DP +I  
Sbjct: 414 MELYKREKVNPLAGCLPIFIQIPIFFALYKVLQLTIEMRHQPFVLWIKDLSAPDPLHILN 473

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFP 535
           LFG+LPF  P F+ +G+  +++ +SM+ Q K++P   D  Q  +   MP + +F ++ F 
Sbjct: 474 LFGLLPFTPPAFLGIGVLALLLGISMYFQFKLNPAQMDPMQQQVFAIMPWMMMFIMAPFA 533

Query: 536 AGLIIYWSWSNVISIVQQAVIMKMH 560
           AGL++YW  +N +S++QQ  + K H
Sbjct: 534 AGLLVYWITNNCLSMLQQWWLYKRH 558


>gi|163733766|ref|ZP_02141208.1| putative inner membrane protein translocase component YidC
           [Roseobacter litoralis Och 149]
 gi|161392877|gb|EDQ17204.1| putative inner membrane protein translocase component YidC
           [Roseobacter litoralis Och 149]
          Length = 606

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 222/602 (36%), Positives = 342/602 (56%), Gaps = 30/602 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIE-----EMNNE-RKNIQTVKQPNQVDNSYAA 55
           ++N N  +A ALS +++  W   +  P  E     E + E   +  T   P+   ++  +
Sbjct: 3   DQNKNLILATALSFVVILVWFVLFPPPEPEIPLTSETSTELTPDAATGSLPSVTSDTAPS 62

Query: 56  VLIDD--RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSP 113
           V+I+   R+ AL  +PRVE+    L GSI+L G + DDL+L+ Y      ++ IVT+LSP
Sbjct: 63  VVIEGETRSAALEEAPRVEIATDRLKGSISLLGGRIDDLSLKDYRETQEDDADIVTMLSP 122

Query: 114 SNTKNAYFAELDYVSTA--NNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERT 171
             +  AY+A   + + A  +  ++P  +T W +I G IL+   PI L + N   + F R 
Sbjct: 123 VGSPGAYYALYGWAAGAGVDPSQVPGPDTEWQVIDGDILSVDAPITLQWNNGAGLSFTRI 182

Query: 172 ISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVLGDKSLV 230
           I +D++Y+F+I  +V N S   +  +P G + RH +P    N F + EG +A + D  L 
Sbjct: 183 IEIDDNYMFEITQSVANTSDAPVTVAPYGILARHGEPADLKNFFILHEGVVA-MADGELT 241

Query: 231 EQKYSDIEKSSISNFHES---------NSWLGISDKYWASVFIPSKETSFHSQFKYLSDG 281
           E  + DI +  +               N W+G +D +W SV IP    S     KY    
Sbjct: 242 ETNWDDIPEFPVDQREGVPAERIENVLNGWIGFTDHFWMSVLIPDPSASARLTTKYRPRA 301

Query: 282 HARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYF 341
              YQA+      T+ PG S++ T  LFAGAKE+ TI +Y+ D  + RF   IDWGWF+F
Sbjct: 302 DI-YQAETVLPAQTVAPGTSVSATTQLFAGAKEWETIRNYQTD-GVDRFIDSIDWGWFFF 359

Query: 342 IAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELRE 401
           + KP+F L+ Y    +GN G AI+  T+ +K +  PLA K YVS A MK +QP++++L+E
Sbjct: 360 LTKPIFFLLHYLNAFIGNMGWAIIGLTLIIKAILLPLAYKSYVSMAKMKELQPQMEKLKE 419

Query: 402 KFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGW 461
           +      Q +Q+ M++LYK   +NP AGC PILLQIP+FF++YKVI +++E+RHAPF+G 
Sbjct: 420 EAGDDR-QKMQQGMMELYKKEKVNPAAGCLPILLQIPIFFSLYKVIFVTIELRHAPFFGP 478

Query: 462 IKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKG 515
            +DL+A DPT+I   +G+LPF  P        + +GI P+++ +SM++Q K++P P D  
Sbjct: 479 FQDLSAPDPTSIMNFYGLLPFDGPEPGSIMALIFIGILPLLLGISMWMQQKLNPAPTDPT 538

Query: 516 QAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFS 575
           Q MI  WMP VF+F L  F +GL++YW  +N I+  QQ +IM+  G +  +   ++  F 
Sbjct: 539 QQMIFAWMPWVFMFMLGGFASGLVVYWIANNTITFAQQYMIMRSQGYKPDVFGNIKGGFQ 598

Query: 576 KN 577
           K 
Sbjct: 599 KK 600


>gi|254477563|ref|ZP_05090949.1| 60 kDa inner membrane insertion protein [Ruegeria sp. R11]
 gi|214031806|gb|EEB72641.1| 60 kDa inner membrane insertion protein [Ruegeria sp. R11]
          Length = 604

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 229/606 (37%), Positives = 349/606 (57%), Gaps = 31/606 (5%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRI-----EEMNNERKNIQTVKQPNQVDNSYAAV 56
           ++N N  +A ALS +++  W  F+  P        E+         V  P+         
Sbjct: 3   DQNKNLLLATALSFLVILGWYIFFPPPEPAPQPDAEIAQTAPAGDGVSAPSAAQAIAGDA 62

Query: 57  LIDDRAQALSMS--PRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPS 114
                A+A + +  PRV +    + G+I+L+G + DDL L+ Y + +  +SPIV +LSP+
Sbjct: 63  AAAGAAEAETAADAPRVAIDTARVTGTISLQGGRLDDLALKDYRVSLEPDSPIVKMLSPA 122

Query: 115 NTKNAYFAELDYVSTANN--IELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTI 172
            + NAY+A   +   A     ++P +NT+W+L  G+ LTP TP+ L ++N   + F RTI
Sbjct: 123 GSPNAYYALYGWAPGAGLGIDDVPGANTLWSLHEGETLTPETPVTLSWRNGKGLTFFRTI 182

Query: 173 SLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHK-PQTATNTFGVQEGFIAVLGDKSLVE 231
           S+DE+Y+F++V +V N     +  +P G I RH  PQ   N F + EG +  + D +L E
Sbjct: 183 SIDENYMFQVVQSVMNEGAGTVSLAPYGTIARHGMPQDLKNFFILHEGVVG-MADGTLAE 241

Query: 232 QKYSDIE----------KSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDG 281
             Y D+           +S I+   E N W+G +D YW S  +P    SF S  K+  + 
Sbjct: 242 IDYDDMADFDLDARSGARSEITQV-EGNGWIGFTDHYWMSTLVPEPGQSFRSIAKF-DER 299

Query: 282 HARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYF 341
              YQ       +T+  G+    T  LFAGAKE+ TI  Y+KD  I  F   IDWGWF+F
Sbjct: 300 REIYQTDVVLPTVTLANGEGTEVTTELFAGAKEWATIRGYQKD-GIEGFLDSIDWGWFFF 358

Query: 342 IAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELRE 401
           + KP+F ++ +   L+GN G AI+  TV +K+L FPLA K Y S A MK +QP++++++E
Sbjct: 359 LTKPIFAVLHWLNALIGNMGWAIIGLTVLIKILVFPLAYKSYASMAKMKELQPEMEKIKE 418

Query: 402 KFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGW 461
           K      Q LQ+ M+ LYK   +NP AGC PIL+QIP+FF++YKVI ++LE+RHAPF+G 
Sbjct: 419 KAGDDR-QKLQQEMMALYKKEKVNPAAGCLPILIQIPIFFSLYKVIFVTLELRHAPFFGP 477

Query: 462 IKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKG 515
            +DL+A DPT+I  LFG+LPF  P        + +GI P+++ +SM++Q K++P P D  
Sbjct: 478 FQDLSAPDPTSIMNLFGLLPFTGPEPGSILATVLIGILPLLLGISMWLQQKLNPAPTDPT 537

Query: 516 QAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFS 575
           Q MI  WMP VF+F L  F +GL++YW  +N I+  QQ +IM+ HG +  +   ++S+F 
Sbjct: 538 QQMIFAWMPWVFMFMLGGFASGLVVYWIANNTITFTQQYLIMRSHGYKPDVFGNIKSSFK 597

Query: 576 KNYNSQ 581
           K+  ++
Sbjct: 598 KSPKAE 603


>gi|297182643|gb|ADI18801.1| preprotein translocase subunit yidc [uncultured SAR11 cluster
           bacterium HF4000_37C10]
          Length = 560

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 216/560 (38%), Positives = 329/560 (58%), Gaps = 19/560 (3%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD---RA 62
           N  +AI LS +++  W  F+  P +E    E    Q  K       S   V +     R 
Sbjct: 5   NVLMAIVLSTLVLVFWATFFEPPPVERQIAED---QVTKSEELSSPSIEKVELSKKIARD 61

Query: 63  QALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFA 122
             +    RV+++N ++ GSI+L+GA  DD+  + Y   + S+  ++  L+P ++   Y+ 
Sbjct: 62  DTIDSVARVKIENNNIKGSISLQGAIIDDIIFKNYKESLESDQKVI-FLNPKSSDEGYYI 120

Query: 123 ELDYVSTANN-IELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFK 181
           E  + S +N  ++LP  NT+W +   K+LTP  PI L + N   ++F + I LD+ YLFK
Sbjct: 121 ETGWASNSNEKLKLPLDNTIWKVKGNKVLTPNKPIVLEWDNNEGLIFTKKIELDDKYLFK 180

Query: 182 IVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSS 241
           I   + N S     F P  +I R+        + + EGFI +  D    E K  D E   
Sbjct: 181 ISQGIKNTSNKSYEFFPYAQITRNYKPDVIPIYILHEGFIGMFDD----ELKEEDYEDVE 236

Query: 242 ISNF--HESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPG 299
              F  + S  WLGI+DKYW +  +P K   F S+F  + DG  +Y+A F   E T+L  
Sbjct: 237 DEKFIINSSKGWLGITDKYWLTAIVPEKGKKFKSEFLSI-DG--KYKANFIIKEATVLSS 293

Query: 300 K-SITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVG 358
             SIT     F  AKE   I  Y + L I +F++ IDWGWFYFI KP+F ++ YF+ L G
Sbjct: 294 NASITNEINAFVMAKEVAVIDDYAEKLGIEKFDLTIDWGWFYFITKPLFFVIEYFFKLTG 353

Query: 359 NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQL 418
           NFG+AI++ T  V+++FFPLA   + S A MK +QP++  L+E  K    + LQ+ M+ L
Sbjct: 354 NFGVAIIILTALVRIVFFPLANYSFRSMAKMKILQPEMIRLKELHKDDKTK-LQQEMMAL 412

Query: 419 YKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFG 478
           YK   +NP++GC P+L+QIP FFA+YK++ +++EMR  PF+GWI+DL+A DPT+IF LFG
Sbjct: 413 YKREKVNPVSGCLPVLIQIPFFFAVYKMLYVTIEMRQQPFFGWIQDLSARDPTSIFNLFG 472

Query: 479 ILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGL 538
           ++P+  P F+ +G+WPI+M L+MF+Q K++P P D  QA I  ++P+     L+ FP+GL
Sbjct: 473 LIPWDPPTFLMIGVWPILMGLTMFLQQKLNPTPPDPMQAKIFMFLPIFLTIILAPFPSGL 532

Query: 539 IIYWSWSNVISIVQQAVIMK 558
           ++YW+ SNV+++ QQ VI++
Sbjct: 533 VVYWTVSNVLTMAQQWVIIR 552


>gi|126734531|ref|ZP_01750277.1| inner membrane protein oxaA, putative [Roseobacter sp. CCS2]
 gi|126715086|gb|EBA11951.1| inner membrane protein oxaA, putative [Roseobacter sp. CCS2]
          Length = 607

 Score =  405 bits (1041), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 217/597 (36%), Positives = 337/597 (56%), Gaps = 25/597 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPN--QVDN-SYAAVLI 58
           ++N N  +A  LS  ++ AW   +  P    ++   +  QT+  P     D  + AA   
Sbjct: 3   DQNKNLILATVLSFAVIVAWTTLFP-PEDLPVDPATETAQTLDDPTLPAADPVNPAATTP 61

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
            +  +  + +PRV ++     GSI+L+G + DDL L  Y   +  ++ +V LL P     
Sbjct: 62  TEAPEPAADAPRVAIETGEFSGSISLQGGRIDDLALTNYRETIDEDAEVVRLLKPVGEPG 121

Query: 119 AYFAELDYVSTA--NNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE 176
           AYFA   + +T   +   +P  +T+W L SG  LTP +P+ L + N    +F   I++D+
Sbjct: 122 AYFASFGWTATDGIDASAVPGPDTIWALESGDTLTPNSPVTLSWDNGAGQIFRTEIAVDD 181

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
            ++F    +V N +   I   P G + RH +P    N F + EG +  + D  L E  Y 
Sbjct: 182 AFMFTFAQSVENATSTAISARPYGLLRRHGEPDDLKNFFILHEGMVR-MTDGELEETGYD 240

Query: 236 DI--------EKSSISNFHESNS-WLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQ 286
           DI        E++       S S W+G +D YW +  IP +   F S  KY  D    YQ
Sbjct: 241 DITEYAVDPRERTQAERLDVSESGWIGYTDHYWMTTLIPEQGVPFRSTSKYF-DVRDLYQ 299

Query: 287 AKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPM 346
           A+      T+  G++ T T  LFAGAKE+  I +YE +  +  F   IDWGWF+F+ KP+
Sbjct: 300 AEAVMPIETVAAGETATVTTRLFAGAKEWEAIRNYENEGGVGGFLDSIDWGWFFFLTKPI 359

Query: 347 FMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQS 406
           F L+ Y    +GN G +I+  TV +K++  PLA K YVS A MK +QP++++L+E+    
Sbjct: 360 FALLHYLNIFIGNMGWSILALTVILKIIVLPLAYKSYVSMAKMKELQPEMEKLKERTGDD 419

Query: 407 PPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLA 466
             Q +Q+ M++LYK + +NP AGC PILLQIP+FF++YKVI +++E+RHAP+ GWI+DL+
Sbjct: 420 -KQAMQQGMMKLYKDNKVNPAAGCLPILLQIPIFFSLYKVIFVTIELRHAPWIGWIRDLS 478

Query: 467 AADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMIL 520
           A DP++   LFG+LP+  P        + +GI PI++ +SM++Q K++P P D  Q MI 
Sbjct: 479 APDPSSFINLFGLLPYAAPEPGSILALIFIGILPILLGVSMWLQQKLNPAPTDPTQQMIF 538

Query: 521 NWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
            WMP VF+F L SF +GL++YW  +NVI+ +QQ  IM+ HGA+  +   ++++  K 
Sbjct: 539 AWMPWVFMFMLGSFASGLVLYWIANNVITFIQQYAIMRSHGAKPDVFGNIKASLKKR 595


>gi|85705859|ref|ZP_01036955.1| putative inner membrane protein translocase component YidC
           [Roseovarius sp. 217]
 gi|85669447|gb|EAQ24312.1| putative inner membrane protein translocase component YidC
           [Roseovarius sp. 217]
          Length = 611

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 219/600 (36%), Positives = 340/600 (56%), Gaps = 30/600 (5%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNER-----KNIQTVKQPNQVDNSYAAV 56
           ++N N   A ALS +++  W  F ++P  E    +         Q+V  P     + A  
Sbjct: 3   DQNKNLIFATALSFLVILVW--FVMFPPPESPAVDPNAPVPSATQSVPAPVADSTADATT 60

Query: 57  LIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNT 116
                      +PR+ +  PSL G+I+L+G + DDL L+ Y   +   S IV LL+P  +
Sbjct: 61  TQTAAPATEPDAPRLNIDTPSLQGTISLQGGRIDDLFLKNYRETIDPASDIVRLLAPVGS 120

Query: 117 KNAYFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISL 174
           +  Y+A   +   A     ++P SNT+W + SG+ LTPT+PI L + N   ++F R +S+
Sbjct: 121 EAPYYALYGWAPGAGLTADQVPGSNTLWQIESGETLTPTSPITLSWDNGAGLIFRRELSV 180

Query: 175 DEHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVLGDKSLVEQK 233
           DE ++F +  +V N     +  +P G + RH +P      F + EG I  + D +L E K
Sbjct: 181 DEDFMFSVRQSVENTGASAVSLAPYGILARHGRPADLKKFFILHEGLIG-MADGTLSEIK 239

Query: 234 YSDIEK----------SSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
           Y D+E+          + ++   E N W+G +D YW +  IP+    F S  K+      
Sbjct: 240 YDDVEEYPFNAREGAPAEVTQVTE-NGWIGFTDHYWMTTLIPASGNPFKSVSKF-DPQRG 297

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
            +Q +      T+ PG++ +    LFAGAKE+ TI  Y+ +  + RF   IDWGWF+F+ 
Sbjct: 298 IFQTETVQPTQTVEPGQTASADTRLFAGAKEWATIRAYQNEQGVDRFLDSIDWGWFFFLT 357

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           KP+F  + + + ++GN G AI+  T+ +K L  PLA K YVS A MK +QP++++++E  
Sbjct: 358 KPIFAALHWLHAIIGNMGWAIIALTLLIKALVLPLAYKSYVSMAKMKELQPQMEKIKETA 417

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
                Q LQK M++LYK   +NP AGC PILLQIP+FF++YKVI ++LE+RHAP+  WIK
Sbjct: 418 GDD-RQKLQKEMMELYKREKVNPAAGCLPILLQIPIFFSLYKVIFVTLELRHAPWVAWIK 476

Query: 464 DLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQA 517
           DL+A D ++++ L+GILP+  P        + +GI P+ + +SM++Q K++P P D  Q 
Sbjct: 477 DLSAPDTSSLYNLWGILPWAAPEPGSVLALIFIGILPLCLGVSMWLQQKLNPSPTDPTQK 536

Query: 518 MILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           MI  WMP VF+F L SF +GL+IYW  +NVI+  QQ VIM+ HG +  +   + S+F + 
Sbjct: 537 MIFAWMPWVFMFMLGSFASGLVIYWIANNVITFSQQYVIMRSHGHKPDVFGNILSSFKRK 596


>gi|149203002|ref|ZP_01879973.1| putative inner membrane protein translocase component YidC
           [Roseovarius sp. TM1035]
 gi|149143548|gb|EDM31584.1| putative inner membrane protein translocase component YidC
           [Roseovarius sp. TM1035]
          Length = 611

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 203/529 (38%), Positives = 319/529 (60%), Gaps = 23/529 (4%)

Query: 68  SPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYV 127
           +PR+ +  PSL G+I+L+G + DD+ L+ Y   +   S IV L++P   +  Y+A   + 
Sbjct: 72  APRLTIDTPSLKGTISLQGGRIDDIFLKNYRETIDPASEIVRLMAPVGNETPYYALYGWA 131

Query: 128 STANNI--ELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDT 185
             A     ++P +NT+W + SG+ LT +TP+ L + N   ++F R +S+DE ++F +  +
Sbjct: 132 PGAGLTPDQVPGANTLWQVESGEKLTTSTPVTLSWDNGAGLIFRRELSVDEDFMFSVRQS 191

Query: 186 VTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEK----- 239
           V N     +  +P G + RH +P    N F + EG I ++ D +L E  Y D+E+     
Sbjct: 192 VENTGATAVSLAPYGILARHGRPADLKNFFILHEGLI-MMADGTLSEIDYDDVEEYPFNA 250

Query: 240 -----SSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
                + ++   E N W+G +D YW +  IP+  +SF +  K+       YQ +      
Sbjct: 251 REGAPAEVTQVTE-NGWIGFTDHYWMTTLIPAAGSSFKAVAKF-DPQRGIYQTEAVQPTQ 308

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
           T+ PG++ +    LFAGAKE+ TI HY+ +  + RF   IDWGWF+F+ KP+F ++ +  
Sbjct: 309 TVEPGQTASAETRLFAGAKEWATIRHYQNEQGVDRFLDSIDWGWFFFLTKPIFAVLHWLN 368

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
            L+GN G AI+  T+ +K L  PLA K YVS A MK++QP++++++E       Q LQK 
Sbjct: 369 ALIGNMGWAIIALTLLIKALVLPLAYKSYVSMAKMKDLQPQMEKIKETAGDD-RQKLQKE 427

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           M++LYK   +NP AGC PILLQIP+FF++YKVI ++LE+RHAP+ GWIKDL+A DP+++F
Sbjct: 428 MMELYKREKVNPAAGCLPILLQIPIFFSLYKVIFVTLELRHAPWVGWIKDLSAPDPSSLF 487

Query: 475 TLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFV 528
            L+G+LP+  P        + +GI P+ + +SM++Q K++P P D  Q MI  WMP VF+
Sbjct: 488 NLWGVLPWAAPEPGSIMALIFIGILPLALGISMWLQQKLNPSPTDPTQKMIFAWMPWVFM 547

Query: 529 FALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           F L SF +GL+IYW  +NVI+  QQ +IM+  G +  +   + S F + 
Sbjct: 548 FMLGSFASGLVIYWIANNVITFSQQYMIMRSQGYKPDVFGNITSGFKRE 596


>gi|83854933|ref|ZP_00948463.1| putative inner membrane protein translocase component YidC
           [Sulfitobacter sp. NAS-14.1]
 gi|83842776|gb|EAP81943.1| putative inner membrane protein translocase component YidC
           [Sulfitobacter sp. NAS-14.1]
          Length = 604

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 222/596 (37%), Positives = 340/596 (57%), Gaps = 28/596 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQ---VDNSYAAV-- 56
           ++N N   A  LS I++  W   +  P  E + +     Q     +    V +S  A   
Sbjct: 3   DQNKNLIFATVLSFIVILGWFLLFPPPETETITDPAATQQVTDATSTEAIVPSSAGAADN 62

Query: 57  ---LIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSP 113
                D+   AL  +PR+ ++   + GSI+L G + DDL+L+ Y+  +  +SPIV+LLSP
Sbjct: 63  VTDASDEATAALEEAPRIPVETARISGSISLLGGRVDDLHLKDYNTTIEKDSPIVSLLSP 122

Query: 114 SNTKNAYFAELDYVSTANNI--ELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERT 171
           + T +AY+A   +   A     ++P  NT+W L  G+ L+  TP+ L + N    LF RT
Sbjct: 123 AGTPDAYYALYGWAPGAGIAPEQVPGPNTLWTLSQGETLSVETPVTLTWDNDAGQLFSRT 182

Query: 172 ISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHK-PQTATNTFGVQEGFIAVLGDKSLV 230
           IS+DE+Y+FKI   V N S + +  +P G I RH  P  A N F + EG +A + +  L+
Sbjct: 183 ISIDENYMFKIEQKVENTSENTVSLAPYGLIARHGIPSDAQNFFILHEGLVA-MNNGELL 241

Query: 231 EQKYSDIEKSSISNFHES-------NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
           E  + DI +  + N   S       N W+G +  Y+ +  IP  E       KYL     
Sbjct: 242 ETAWDDIPELDVVNGVPSKRIDGVTNGWIGFTGHYFMTNLIPDPEQPTRLTVKYLPRTEI 301

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
            +Q +      T+  G++ T T  LFAGAKE+  +  YE    + +F   IDWGWF+F+ 
Sbjct: 302 -FQTESVMPTQTVASGQTATVTTQLFAGAKEWEILRDYEAQ-GVYKFIDSIDWGWFFFLT 359

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           KP+F ++ +   L+GN G+AI+  T+ +K L FPLA K YVS A MK +QP++++L+ K 
Sbjct: 360 KPIFWVLHHLNLLIGNMGVAIIGLTLLIKALLFPLAYKSYVSMAKMKELQPQMEKLK-KD 418

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
                Q LQ+ M++LYK   +NP AGC PILLQIP+FF++YKVI ++LE+RHAPF+G  +
Sbjct: 419 AGDDRQKLQQGMMELYKREKVNPAAGCLPILLQIPIFFSLYKVIFVTLELRHAPFFGPFQ 478

Query: 464 DLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQA 517
           DL+A DPT+IF  +G+LP+  P        + +GI P+++ +SMF+Q K++P P D  Q 
Sbjct: 479 DLSAPDPTSIFNFYGLLPWAAPEAGTVLALVFIGILPLLLGISMFLQQKLNPAPTDPTQQ 538

Query: 518 MILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRST 573
           MI  WMP VF+F L  F +GL++YW  +N I+  QQ +IM+  G +  ++  ++ +
Sbjct: 539 MIFAWMPWVFMFMLGGFASGLVVYWIANNTITFTQQYLIMRSQGYKPDILGNIKGS 594


>gi|296775679|gb|ADH42956.1| preprotein translocase subunit YidC [uncultured SAR11 cluster alpha
           proteobacterium H17925_23J24]
          Length = 569

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 216/565 (38%), Positives = 329/565 (58%), Gaps = 19/565 (3%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD----- 60
           N   AIALS  +++ W   +  P+IEE     ++    K+    D     V   D     
Sbjct: 5   NVIFAIALSFAVLFGWSVIFETPKIEEQAKLEQSENYQKEDAASDAPSVNVEKKDLPIVS 64

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           R  A+  + R+  +N +++GSI LKGA  DD+  + Y+  + S+   VT L+P  T   Y
Sbjct: 65  RNDAIKSTNRINFENENVVGSITLKGALIDDITFKKYNETLGSDKK-VTYLNPQETNEGY 123

Query: 121 FAELDYV-STANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYL 179
           F E  +  S   +I LPN +T+W +     L+  +P+ + +KN + I F + I LD  +L
Sbjct: 124 FIETGWAASNVEDIGLPNKDTLWKVKGNNKLSTGSPVIMEWKNKSGITFRKKIELDSKFL 183

Query: 180 FKIVDTVTNNSIDQIRFSPRGRIMR-HKP----QTATNTFGVQEGFIAVLGDKSLVEQKY 234
           F++   + N S   +   P  +I R  KP     + + T  + +GFI V  +   +++  
Sbjct: 184 FRVTQEIQNKSGSIVELYPYAQITRNQKPVLQAGSMSGTLILHDGFIGVFNED--LKEYD 241

Query: 235 SDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANE- 293
            D  K      +  + WLGI+DK+W +  +P K  SF  +F Y S+    ++A + AN+ 
Sbjct: 242 YDDIKDKKKEHNAESGWLGITDKFWITALVPEKNQSFRGEFVYKSES---FKANYIANKP 298

Query: 294 ITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYF 353
           I + P  S  +T  +F  AKE   I  Y +  +I +F++ IDWGW YF+ KP+F +++Y 
Sbjct: 299 IVVQPSSSKASTTKIFVAAKEVKVIDGYAEAESINKFDLTIDWGWLYFLTKPLFFIINYL 358

Query: 354 YNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQK 413
           + L  NFGIAI+L T  V+LLFFPLA   + S A MK +QP++  L+E  K    + LQ+
Sbjct: 359 FELTKNFGIAIILVTAAVRLLFFPLANYSFRSMAKMKILQPELLRLKEVHKGDKVK-LQQ 417

Query: 414 AMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNI 473
            M+ LY+   +NPL+GC PIL+QIP FFAIYK++ ISLEMRH PF+GWIKDL+A DPT+I
Sbjct: 418 EMMALYRREKVNPLSGCLPILIQIPFFFAIYKMLLISLEMRHQPFFGWIKDLSAQDPTSI 477

Query: 474 FTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSS 533
           F +FG++P+  P F+ +G WPI+M  +M++Q K++P P D  QA I  + P+     L+ 
Sbjct: 478 FNIFGLIPWDPPSFLIIGAWPIMMGATMYLQQKLNPTPPDPIQAKIFLFFPLFLTIILAP 537

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMK 558
           FPAGL++YW+ +NV++I QQ VIMK
Sbjct: 538 FPAGLVVYWTINNVLTIAQQWVIMK 562


>gi|254512338|ref|ZP_05124405.1| 60 kDa inner membrane insertion protein [Rhodobacteraceae bacterium
           KLH11]
 gi|221536049|gb|EEE39037.1| 60 kDa inner membrane insertion protein [Rhodobacteraceae bacterium
           KLH11]
          Length = 607

 Score =  401 bits (1031), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 215/605 (35%), Positives = 340/605 (56%), Gaps = 35/605 (5%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYP-------RIEEMNNERKNIQTVKQPNQVDNSYA 54
           ++N N  +A  LS +++  W   +  P       + E    E   +QT      V    A
Sbjct: 3   DQNKNLILATVLSFLVIIVWFVLFPPPEPTPGEEQAEIAVLEGDEVQTPSASGTVGEVTA 62

Query: 55  AVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPS 114
           A    + A     +PRV++  P L GS++L G + D+L L+ Y + +   +PIV LL+P 
Sbjct: 63  AT---EEALPEEQAPRVQIDTPRLKGSLSLSGGRIDELFLKDYKVSIEEGAPIVELLAPV 119

Query: 115 NTKNAYFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTI 172
            T++AY+A   +   A     ++P  NTVW L  G++L    P+ LV++N N + F R I
Sbjct: 120 GTESAYYALYGWAPAAGLAGADVPGPNTVWALEQGEVLGVDAPVTLVWENGNGLTFRRMI 179

Query: 173 SLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFI---AVLG--DK 227
           S+D+ Y+F +  +V N +  ++  +P G + RH      +  G++  FI    V+G  D 
Sbjct: 180 SVDQDYMFTVTQSVENGTQSEVGMAPYGILARHGIGEDGDLPGLKNFFILHEGVIGMSDG 239

Query: 228 SLVEQKYSDIEKSSISNFHES---------NSWLGISDKYWASVFIPSKETSFHSQFKYL 278
           +L E  Y D+    I     +         + W+G +D YW +  IP   ++F +  KY 
Sbjct: 240 TLTEVDYGDVRDFDIDPIERAQAEVYQVNQDGWIGFTDHYWMTTLIPEPGSAFKAAAKYD 299

Query: 279 SDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGW 338
           S     YQ +     +T+ PG++   T  LFAGAKE+ TI  Y+ +  + +F   IDWGW
Sbjct: 300 SR-RKIYQTETVLPTVTVAPGETTEVTTRLFAGAKEWETIREYQAE-GVQKFIDSIDWGW 357

Query: 339 FYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDE 398
           F+F+ KP+F L+     L+GN G +I+  T+ +K + FPLA K YVS A MK +QP+++ 
Sbjct: 358 FFFLTKPIFWLLHNINALIGNMGWSIIGLTLIIKAILFPLAYKSYVSMAKMKELQPQMEA 417

Query: 399 LREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF 458
           L+E       Q +Q+ M++LYK   +NP AGC PIL+QIP+FF++YKVI +++E+R AP+
Sbjct: 418 LKEAAGDDR-QKMQQGMMELYKKEKVNPAAGCLPILMQIPIFFSLYKVIFVTIELRQAPW 476

Query: 459 WGWIKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPA 512
           +G  +DL+A DPT+I  LFG+LPF  P        + +GI P+++ +SM++Q K++P P 
Sbjct: 477 FGPFQDLSAPDPTSIMNLFGLLPFAGPQPDTFLALIFIGILPLLLGISMWLQQKLNPAPT 536

Query: 513 DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRS 572
           D  QAMI  WMP VF+F L SF +GL++YW  +N I+  QQ +IM+  G +  +   ++S
Sbjct: 537 DPTQAMIFAWMPWVFMFMLGSFSSGLVVYWIANNTITFTQQYLIMRSQGYKPDVFGNIKS 596

Query: 573 TFSKN 577
            F + 
Sbjct: 597 GFKRT 601


>gi|294085069|ref|YP_003551829.1| 60 kDa inner membrane insertion protein [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292664644|gb|ADE39745.1| 60 kDa inner membrane insertion protein [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 592

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 214/587 (36%), Positives = 342/587 (58%), Gaps = 36/587 (6%)

Query: 4   NWNYFVAIALSVIIVYAWQNFYVYPRIEEM-----------------------NNERKNI 40
           N N  +AIALS+++++ WQ F + P++E+                        +++  ++
Sbjct: 5   NRNLILAIALSMVVLFGWQMFVIKPQLEQEAAQQELLAAQAQAEAALQASQQADSDTPSV 64

Query: 41  QTVKQPN-QVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHL 99
                 N  V+N   +  I D A+    +PR+ +  P + GSI++ GA+ DD+ L  Y  
Sbjct: 65  AQSSGSNVAVNNGAVSGGISD-AKPQDTAPRILIDAPLITGSISVMGARIDDVVLTDYKE 123

Query: 100 DVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLV 159
                S  +T L  +++   +F E  + S+  N  +P ++T+W   +  +L+P  P+ L 
Sbjct: 124 TQDPESKNITFLHKASSSQPFFVEFGWSSSDANQPMPRADTLWQ-TNKDVLSPGAPVTLR 182

Query: 160 FKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEG 219
           + N   + F R IS+++ YL    D+V +     I   P G + RH     +  + + EG
Sbjct: 183 WDNGQGLTFIRQISINDDYLISYDDSVQSTLDAAITLFPYGLVRRHGTPPTSGIYILHEG 242

Query: 220 FIAVLGDKSLVEQKYSDIEKSSISNF----HESNSWLGISDKYWASVFIPSKETSFHSQF 275
            + V  D++L E+ YSD+  +          ++  W+G++DKYW +  +P + T +   F
Sbjct: 243 PLGVF-DETLQEEDYSDLRDAEQGKIAVTPSKAGGWIGLTDKYWLAALLPDQNTRYDFSF 301

Query: 276 KYLSDGHARYQAKF-SANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLI 334
           + L+    RYQ  +  +  + + P  S++    +FAGAK    +  Y +DL IP F++ I
Sbjct: 302 QSLAGSGERYQVDYIDSKGLVLAPNTSVSAKGRVFAGAKIVKLLDQYREDLGIPNFDLAI 361

Query: 335 DWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQP 394
           D+GWFYF+ KP F  +++   L+GNFG+A +  TV VK++FFPLA K Y S   M+ + P
Sbjct: 362 DFGWFYFLTKPFFYAINWLNELLGNFGLATIAFTVVVKVVFFPLANKSYQSMGKMRLLAP 421

Query: 395 KIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMR 454
           KI +LRE+F +     L K M+ LYK   +NP AGC P+LLQIPVFFA+YKV+ +++EMR
Sbjct: 422 KIQQLRERFGED-KMALNKEMMALYKAEKVNPAAGCLPVLLQIPVFFALYKVLFVTIEMR 480

Query: 455 HAPFWGWIKDLAAADPTNIFTLFGILPF---YLPGFMHVGIWPIIMSLSMFIQMKMSPPP 511
           HAPF+GWI DL+A DPT+IF +FG+LPF   +LP F+ +G WPI+M +SMF+QM+++P P
Sbjct: 481 HAPFFGWITDLSAPDPTSIFNVFGLLPFSVDFLPPFLQLGAWPIMMGVSMFLQMRLNPAP 540

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
            D  QA +   MP+ F F L++FPAGL+IYW+W+N++S+ QQ  IM+
Sbjct: 541 PDPIQAKVFQLMPIFFTFLLATFPAGLVIYWTWNNLLSMGQQWYIMR 587


>gi|94495881|ref|ZP_01302460.1| 60 kDa inner membrane insertion protein [Sphingomonas sp. SKA58]
 gi|94424573|gb|EAT09595.1| 60 kDa inner membrane insertion protein [Sphingomonas sp. SKA58]
          Length = 568

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 209/568 (36%), Positives = 322/568 (56%), Gaps = 18/568 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNF--YVYPRIEEMNNERKNIQTVKQ-----PNQVDNSY 53
           M+   N  +A+ L+  I++ W     Y +P     N     I+  KQ     P+    + 
Sbjct: 1   MDDKKNIILAVLLTAAILFGWPYISNYFFP---TANPPATKIEGGKQVPVARPDADPAAD 57

Query: 54  AAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSP 113
           +   I DRA  L  SPR+ ++   L GSINLKGA+ DD+ L  Y   ++ +SP V L SP
Sbjct: 58  SPAAIRDRALVLRESPRIPIRTAKLTGSINLKGARIDDIVLPTYKETIAKDSPAVRLYSP 117

Query: 114 SNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTIS 173
           S T++AYFA   +      +  P+ NT+W    G  LTPT+P+ L + N    LFE  +S
Sbjct: 118 SGTQDAYFAGFGW--QGEGLRAPDRNTLWT-AQGSALTPTSPVTLSWNNGAGQLFEIRLS 174

Query: 174 LDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQK 233
           +D++Y+      V+N     +   P   I R       +T+ +  G + V    +  +  
Sbjct: 175 VDDNYMITAAQKVSNTGTGTVGVKPYAYISRTGIPKDPDTWTIHVGPMGVFNGAANYDVN 234

Query: 234 YSDIEKS-SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSAN 292
           Y D++K  S+ +F     W+G +DKYW S  +P+ +  F  QF+       +YQA  +  
Sbjct: 235 YKDLDKGPSVQSFQSKGGWIGFTDKYWLSALVPAADADFAGQFR--KGAGTQYQADVALG 292

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
              + PGK++T T  LF GAKE  T+  Y+ D  +P F+  IDWGWFY+  KP+F L+ +
Sbjct: 293 SNMVAPGKAVTQTQRLFVGAKEVKTLEAYQ-DAGVPLFDRAIDWGWFYWFEKPIFALLHW 351

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
            +  +GNFG+AI+  T  V+ + FP+A++Q+ S A M+ +QPK+  L+EK K    Q LQ
Sbjct: 352 LFEHIGNFGVAIICLTFVVRAIMFPIAQRQFSSMAAMRALQPKMKALQEKHKDDK-QQLQ 410

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
             M++LYK   +NPLAGC PI +QIP+FFA+YKV+ +++EMRH PF  WIKDL+A DP +
Sbjct: 411 MKMMELYKQEKVNPLAGCLPIFIQIPIFFALYKVLMLTIEMRHQPFVLWIKDLSAPDPLH 470

Query: 473 IFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALS 532
           I  LFG+L F  P F+ +G+  +++ +SM+ Q K++P   D  Q  I+  MP + +F ++
Sbjct: 471 ILNLFGLLDFTPPAFLGIGVLALLLGISMYFQFKLNPTQMDPMQQQIMGIMPWMMMFIMA 530

Query: 533 SFPAGLIIYWSWSNVISIVQQAVIMKMH 560
            F AGL++YW  +N +S+ QQ  + + H
Sbjct: 531 PFAAGLLVYWITNNCLSMAQQWWLYRKH 558


>gi|167644608|ref|YP_001682271.1| putative inner membrane protein translocase component YidC
           [Caulobacter sp. K31]
 gi|254772764|sp|B0T872|OXAA_CAUSK RecName: Full=Inner membrane protein oxaA
 gi|167347038|gb|ABZ69773.1| 60 kDa inner membrane insertion protein [Caulobacter sp. K31]
          Length = 630

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 219/621 (35%), Positives = 330/621 (53%), Gaps = 54/621 (8%)

Query: 3   RNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERK-----NIQTVKQPNQV--DNSYAA 55
           +N   F+  A +++I Y  Q   + P+ ++   E +       Q   QP      +    
Sbjct: 7   KNTLMFLVCAFAILIGY--QFLVMGPQQKQREAELRAKKAAEAQVAVQPGMTIGADGTPQ 64

Query: 56  VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSN 115
            L   R +A + SPR+ +  P+L GSI LKGA+ DDL L+ Y      NSP V L  P  
Sbjct: 65  PLKLSRDEAKAQSPRIAVDTPALSGSIALKGARIDDLWLKRYTQTADKNSPPVELFRPEG 124

Query: 116 TKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD 175
            ++A+FA+  +   A    LP   TVW    G++L PTTP+ L + N   ++F RTIS+D
Sbjct: 125 AEHAWFADFGWAGIAGMTGLPTPQTVWTAAPGQVLRPTTPVVLTYDNGQGLVFTRTISVD 184

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHK-PQTATNTFG----VQEGFIAVLGDKSLV 230
              +F + DTV N     +  +P   + R   P    +  G    V EG I VLG    V
Sbjct: 185 ADAMFTVADTVRNQGGAAVALAPYASVQRQGIPTEGPHGLGKTQIVYEGGIGVLGGIDGV 244

Query: 231 E---------QKYSDIEKSS--ISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLS 279
           E          KY   +K      N      W+G++DKYW +  +P +      +F+   
Sbjct: 245 EGGKYILQNKAKYPKWKKDKPLQDNLQSKGGWIGMTDKYWLAALVPQQSEMIKGRFQVKP 304

Query: 280 -DGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDL------------- 325
             G   Y++ F+    ++  G ++T T  LFAGAK  P +  Y+                
Sbjct: 305 VSGVDVYESAFTGAPKSLAAGATVTNTTRLFAGAKTVPLLTRYQYGGKPVVWWEFWNRPA 364

Query: 326 -AIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYV 384
             IP F+  +DWG F  I +P+F ++  FY +VGNFG+AIML TV +KL+ FPLA K Y 
Sbjct: 365 NVIPNFDKAVDWGMFEVITRPIFNVLEIFYKMVGNFGVAIMLLTVALKLILFPLADKSYE 424

Query: 385 STANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIY 444
           S A MK I P++++L+ K K  P +  Q+ M+ LY    INP+ GC P+L+QIP+F+++Y
Sbjct: 425 SMAKMKKIAPEVEKLKVKNKDDPAK-QQQEMMALYAKEKINPMMGCVPMLIQIPIFYSLY 483

Query: 445 KVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPF----------YLPGFMHVGIWP 494
           KV+++++EMRHAPF+GWI DL+A DP+    LFG++ +          +L G +H+G+WP
Sbjct: 484 KVLTVTIEMRHAPFFGWITDLSARDPSTFMNLFGLIHWDPATAPLIGAFLSGPLHIGVWP 543

Query: 495 IIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQA 554
           ++   +M++   M+PP  D  Q  I  + P+VF F LS F  GL+IYW WSNV++I+QQ 
Sbjct: 544 LLYGFTMWLTTAMNPPAGDPIQQKIFQFFPIVFTFTLSQFAVGLVIYWCWSNVLTILQQY 603

Query: 555 VIMKMHGAE---IGLIDRLRS 572
           +IM  +  +     L++RLR 
Sbjct: 604 IIMHRYKVDNPIDQLVNRLRG 624


>gi|84515675|ref|ZP_01003036.1| putative inner membrane protein translocase component YidC
           [Loktanella vestfoldensis SKA53]
 gi|84510117|gb|EAQ06573.1| putative inner membrane protein translocase component YidC
           [Loktanella vestfoldensis SKA53]
          Length = 605

 Score =  398 bits (1023), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 209/600 (34%), Positives = 332/600 (55%), Gaps = 31/600 (5%)

Query: 2   ERNWNYFVAIALSVIIVYAW------QNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAA 55
           E+N N  +A  LS  ++  W      +   V P  +           +  P   D +  A
Sbjct: 3   EQNRNLILATLLSFAVIMTWTLLFPPEEIAVDPAAQVATQSVDPTVPLADPVTPDATSPA 62

Query: 56  VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSN 115
           ++     Q      R+ ++ P L GSI++ G + DDL L  Y   +  ++PIV LL P  
Sbjct: 63  IV----EQTAPDVARIAIETPELTGSISMLGGRIDDLALTDYRETLDEDAPIVRLLRPVG 118

Query: 116 TKNAYFAELDYVSTA--NNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTIS 173
             +AYFA   + +T   +   +P  +T+W++ +G+ LTP+TP+ LV+ N    +F   IS
Sbjct: 119 ELDAYFAAFGWTATDGIDPAAVPGPDTIWSVETGETLTPSTPVTLVWDNGAGQIFRTEIS 178

Query: 174 LDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVLGDKSLVEQ 232
           +D+ ++F    ++ N   + +   P G + RH +P  A   F + EG +  + D  L E 
Sbjct: 179 VDDLFMFSFAQSIQNVGTETVSARPYGLVRRHGEPSDAKRFFILHEGLVR-MSDGELEET 237

Query: 233 KYSDIEKSSISNFH---------ESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
            YS+I   +              + + W+G +D +W +  IP+  T F S  KY  +   
Sbjct: 238 SYSNITDHTFDERERTLADRIDVQQSGWIGYTDHFWMTTLIPATGTPFRSTSKYF-EARD 296

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
            YQ +       +  G++ T T  LFAGAKE+  I HYE +  + RF   IDWGWF+F+ 
Sbjct: 297 LYQVEAVMPPSVVPAGETATVTIRLFAGAKEWEAITHYENETGVDRFIDSIDWGWFFFLT 356

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           KP+F L+     ++GN G +I+  T+ +K L  PLA K YVS A MK +QP++++L+E+ 
Sbjct: 357 KPIFWLLHNLNIIIGNMGWSILALTLILKALVLPLAYKSYVSMARMKELQPEMEKLKERA 416

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
                Q +Q+ M++LYK + +NP AGC PILLQIP+FF++YKVI +++E+RHAP+ GWI 
Sbjct: 417 GDD-RQAMQQGMMKLYKENTVNPAAGCLPILLQIPIFFSLYKVIFVTIELRHAPWIGWID 475

Query: 464 DLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQA 517
           DL+A DP+++  LFG+LP+  P        + +G+ PI++ +SM++Q K++P P D  Q 
Sbjct: 476 DLSAPDPSSLINLFGLLPYAAPDPGSILSLIFIGLLPILLGISMWMQQKLNPAPTDPTQQ 535

Query: 518 MILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           MI  WMP VF+F L  F +GL++YW  +N I+ VQQ  IM+ HGA+  +   ++S   + 
Sbjct: 536 MIFAWMPWVFMFMLGGFASGLVLYWIANNCITFVQQYAIMRSHGAKPDVFGNIKSGLKRK 595


>gi|126728217|ref|ZP_01744033.1| putative inner membrane protein translocase component YidC
           [Sagittula stellata E-37]
 gi|126711182|gb|EBA10232.1| putative inner membrane protein translocase component YidC
           [Sagittula stellata E-37]
          Length = 600

 Score =  398 bits (1023), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 219/605 (36%), Positives = 352/605 (58%), Gaps = 37/605 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPR---IEEMNNERKNIQTVKQ-------PNQVDN 51
           E+N N F+A ALS +++  W  F ++P    +E+ N   +  QT          P     
Sbjct: 3   EQNKNLFLATALSFVVILVW--FILFPPQDPVEDPNAPAEVSQTADPATGVAAVPEAAPG 60

Query: 52  SYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLL 111
           + AA    +   A+  +PR+ L    L GSI+L G + DDL L+ Y + + S+  IV + 
Sbjct: 61  TEAAAPAGEPVDAVDDAPRLPLDTARLEGSISLTGGRLDDLRLKDYTVSLDSDE-IVQVF 119

Query: 112 SPSNTKNAYFAELDYVSTA--NNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFE 169
               + +AY+    +      +  E+P +NT W++ +G+ LT  TP+ L + + + ++F 
Sbjct: 120 HRVGSSDAYYTLYGWAPGGGLSMDEVPGANTPWSVETGETLTTETPVTLRWDSPSGLIFR 179

Query: 170 RTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVLGDKS 228
           RTI++DE+Y+F +  T+ N S   +  +P G + RH +PQ     F + EG I+++ D  
Sbjct: 180 RTIAVDENYMFTVTQTIENASDASVSLAPYGVLARHGEPQNVKKFFILHEGGISMI-DGE 238

Query: 229 LVEQKYSDIEKSSISN--FHESNSWLGISDKYWASVFIPS----KETSFHSQFKYLSDGH 282
           L E  Y D + +        E+  W G +D YW S  IP+    K ++FH+Q   +    
Sbjct: 239 LTETDYDDFQTAGQHQDVTMETAGWTGFTDHYWMSTLIPTQPGTKVSTFHNQSNDI---- 294

Query: 283 ARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFI 342
             YQ       +T+ PG++   ++ LFAGAKE+ TI  Y+K+  + RF   IDWGWF+F+
Sbjct: 295 --YQTTARMPTMTVAPGETQQVSSKLFAGAKEWETIREYQKN-GVDRFIDSIDWGWFFFL 351

Query: 343 AKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREK 402
            KP+F ++ + + ++GN GIAI+  T+ +K+L FPLA K Y S A MK +QP++++L+E+
Sbjct: 352 TKPIFAVLHWLHGVIGNMGIAIIGLTILLKILLFPLAYKSYASMAKMKELQPEMEKLKER 411

Query: 403 FKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWI 462
                 + LQK M+ LYK   +NP AGC PILLQIP+FF++YKVI ++LE+RHA F+G  
Sbjct: 412 AGDDR-EKLQKEMMALYKKEKVNPAAGCLPILLQIPIFFSLYKVIFVTLELRHANFFGPF 470

Query: 463 KDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQ 516
           +DL+A DPT+++ LFG+LP+  P        + +GI PI++ +SM++Q K++P PAD  Q
Sbjct: 471 RDLSAPDPTSLYNLFGLLPWAAPEAGSILALVFIGILPILLGISMWLQQKLNPAPADPTQ 530

Query: 517 AMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSK 576
            MI  WMP VF+F L  F +GL++YW  +N I+  QQ +IM+ HG    ++  ++ +F +
Sbjct: 531 QMIFAWMPWVFMFMLGGFASGLVVYWITNNTITFTQQYLIMRSHGYHPNVLGNIKGSFKR 590

Query: 577 NYNSQ 581
               +
Sbjct: 591 GKKDE 595


>gi|83941456|ref|ZP_00953918.1| putative inner membrane protein translocase component YidC
           [Sulfitobacter sp. EE-36]
 gi|83847276|gb|EAP85151.1| putative inner membrane protein translocase component YidC
           [Sulfitobacter sp. EE-36]
          Length = 604

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 219/596 (36%), Positives = 338/596 (56%), Gaps = 28/596 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQ---VDNSYAAV-- 56
           ++N N   A  LS I++  W   +  P  E + +     Q     +    V +S  A   
Sbjct: 3   DQNKNLIFATVLSFIVILGWFVLFPPPETETITDPAATQQVTDATSTEAVVPSSAGAADN 62

Query: 57  ---LIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSP 113
                D+   AL  +PR+ ++   + GSI+L G + DDL+L+ Y+  +  ++PIV+LLSP
Sbjct: 63  VTDASDEATAALEEAPRIPVETARISGSISLLGGRVDDLHLKDYNTTIEDDAPIVSLLSP 122

Query: 114 SNTKNAYFAELDYVSTANNI--ELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERT 171
           + T +AY+A   +   A     ++P  NT+W L  G+ L+  TP+ L + N    LF RT
Sbjct: 123 AGTPDAYYALYGWAPGAGIAPEQVPGPNTLWTLSQGETLSVETPVTLTWDNDAGQLFSRT 182

Query: 172 ISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHK-PQTATNTFGVQEGFIAVLGDKSLV 230
           IS+DE+Y+FKI   V N S + +  +P G I RH  P  A N F + EG +A + +  L+
Sbjct: 183 ISIDENYMFKIEQKVENTSENSVSLAPYGLIARHGIPSDAQNFFILHEGLVA-MNNGELL 241

Query: 231 EQKYSDIEKSSISNFHES-------NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
           E  + DI +    N   S       N W+G +  Y+ +  IP          KYL     
Sbjct: 242 ETAWDDIPELDAVNGVPSKRIDGVTNGWIGFTGHYFMTNLIPDPAQPTRLSVKYLPRTEI 301

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
            +Q +      T+  G++ T T  LFAGAKE+  +  YE    + +F   IDWGWF+F+ 
Sbjct: 302 -FQTESVMPTQTVARGQTATVTTQLFAGAKEWEILRDYEAQ-GVYKFIDSIDWGWFFFLT 359

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           KP+F ++ +   L+GN G+AI+  T+ +K L FPLA K YVS A MK +QP++++L+ K 
Sbjct: 360 KPIFWVLHHLNLLIGNMGVAIIGLTLLIKALLFPLAYKSYVSMAKMKELQPQMEKLK-KD 418

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
                Q LQ+ M++LYK   +NP AGC PIL+QIP+FF++YKVI ++LE+RHAPF+G  +
Sbjct: 419 AGDDRQRLQQGMMELYKREKVNPAAGCLPILMQIPIFFSLYKVIFVTLELRHAPFFGPFQ 478

Query: 464 DLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQA 517
           DL+A DPT+IF  +G+LP+  P        + +GI P+++ +SMF+Q K++P P D  Q 
Sbjct: 479 DLSAPDPTSIFNFYGLLPWAAPEAGTVLALVFIGILPLLLGISMFLQQKLNPAPTDPTQQ 538

Query: 518 MILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRST 573
           MI  WMP VF+F L  F +GL++YW  +N I+  QQ +IM+  G +  ++  ++ +
Sbjct: 539 MIFAWMPWVFMFMLGGFASGLVVYWIANNTITFTQQYLIMRSQGYKPDILGNIKGS 594


>gi|86135820|ref|ZP_01054399.1| putative inner membrane protein translocase component YidC
           [Roseobacter sp. MED193]
 gi|85826694|gb|EAQ46890.1| putative inner membrane protein translocase component YidC
           [Roseobacter sp. MED193]
          Length = 602

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 219/584 (37%), Positives = 334/584 (57%), Gaps = 30/584 (5%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFY----VYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           ++N N  +AIALS +++  W  F+    V P  E +  E               +  A  
Sbjct: 3   DQNKNLILAIALSSLVLLGWMYFFPPPEVTPAPEAVATETAPADGTASSPSAAVAADAAT 62

Query: 58  IDDRAQA-LSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSP-IVTLLSPSN 115
                +A  S +PR+ +++  + GSI+L+G + DDL L+ Y   +++++P IV  LSP  
Sbjct: 63  SQPSEEASASDAPRISIESDRITGSISLQGGRIDDLALKDYR--ITNDAPEIVQFLSPVG 120

Query: 116 TKNAYFAELDYV--STANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTIS 173
            ++AY+A   +   S     ++P +NT+W   +   LTP + + L + N   + F RTI+
Sbjct: 121 QQDAYYALYGWAPGSGLGAEDVPGANTLWTAPADAELTPDSSVTLTWDNGKGLTFNRTIA 180

Query: 174 LDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVLGDKSLVEQ 232
           +DE Y+F I  +VTN S   +  +P G + RH +P    N F + EG +  + D  L E 
Sbjct: 181 VDEDYMFAITQSVTNASGGAVSLAPYGTLARHGEPADMKNFFILHEGVVG-MADGELAEL 239

Query: 233 KYSDI-------EKSSISNFHE--SNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
            YSD+          S S   +  S+ W+G +D YW S  IP+   +F S  KY  +   
Sbjct: 240 DYSDVADFDVDPRDGSRSEVKQVASDGWIGFTDHYWMSTLIPAPGQAFRSSVKY-DERRD 298

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
            YQ       +T+  G++   T  LF+GAKE+ TI  YEK   I  F   IDWGWF+F+ 
Sbjct: 299 IYQTDVVLPTMTLADGETSEVTTQLFSGAKEWATIRAYEKG-GIAGFLDSIDWGWFFFLT 357

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           KP+F ++ +   L+GN G AI+  TV +K++ FPLA K Y S A MK +QP++++L+E+ 
Sbjct: 358 KPIFAVLHWLNALIGNMGWAIIALTVLIKIIVFPLAYKSYASMAKMKELQPEMEKLKERA 417

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
                Q  QK +++LYK   +NP AGC PIL+QIP+FF++YKVI ++LE+RHAPF+G  +
Sbjct: 418 GDDR-QKQQKEIMELYKREKVNPAAGCLPILIQIPIFFSLYKVIFVTLELRHAPFFGPFQ 476

Query: 464 DLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQA 517
           DL+A DPT+I  LFG+LPF  P        + +GI P+++ +SM++Q K++P P D  Q 
Sbjct: 477 DLSAPDPTSIMNLFGLLPFAGPTPDSIMALVFIGILPLLLGISMWLQQKLNPAPTDPTQQ 536

Query: 518 MILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHG 561
           MI  WMP VF+F L  F +GL++YW  +N I+  QQ +IM+ HG
Sbjct: 537 MIFAWMPWVFMFMLGGFASGLVVYWIANNTITFTQQYLIMRSHG 580


>gi|294675902|ref|YP_003576517.1| inner membrane protein OxaA [Rhodobacter capsulatus SB 1003]
 gi|294474722|gb|ADE84110.1| inner membrane protein OxaA [Rhodobacter capsulatus SB 1003]
          Length = 615

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 212/547 (38%), Positives = 304/547 (55%), Gaps = 41/547 (7%)

Query: 68  SPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYV 127
           +PRV +  P+L GSI+L GA+FDDL+L+ YH  +   SP+V LL+P    +   A+  YV
Sbjct: 65  APRVTIDTPALTGSISLLGARFDDLSLKHYHEKLDPASPLVRLLAPVGGSDLNAAKPYYV 124

Query: 128 -------STANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF 180
                  +     ++P   T+W   +G  LTP TP+ L + N   + F RTI++D  YLF
Sbjct: 125 VQGWSALAGVTAAQVPGPKTLWTAPAGAKLTPETPLVLTWDNGAGLTFTRTIAVDPQYLF 184

Query: 181 KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI--- 237
            + D VTN     +  +P G I RH        + + EG +  + +  L E KY  I   
Sbjct: 185 TVTDAVTNTGAAAVSIAPWGIIARHGIPAGNRVYVLHEGAVR-MTNGELQEIKYKKITDL 243

Query: 238 -----EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSAN 292
                E  +     ++  W G +DKYW +  IP     F S  KY+      YQ +    
Sbjct: 244 DALEGEGQADVRSADTGGWAGFTDKYWMTTLIPDT-ARFTSVVKYVPSADL-YQTETRQP 301

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLA----------------IPRFEMLIDW 336
            + I  G S + T  LFAGAKE+  I  Y+ D                  I RF   IDW
Sbjct: 302 AVEIAAGASTSVTMRLFAGAKEWEAIAQYQNDPGMFDRLFGDKIDPTQPQITRFVDSIDW 361

Query: 337 GWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKI 396
           GW+YF+ KPMF L+ + + ++GN G AI+  TV +KL+ FPLA+  Y+S A MK IQP +
Sbjct: 362 GWYYFLTKPMFRLLHWLHAVLGNMGWAIIALTVIIKLIVFPLARTSYISMAKMKEIQPAM 421

Query: 397 DELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHA 456
           + L+E+ K    Q LQ+ M++LYK   INP AGC PILLQIP+FF++YKVI +++E+ HA
Sbjct: 422 EALKERTKDDK-QALQRGMMELYKREKINPAAGCLPILLQIPIFFSLYKVIYVTIELYHA 480

Query: 457 PFWGWIKDLAAADPTNIFTLFGILPFYLPG------FMHVGIWPIIMSLSMFIQMKMSPP 510
           P+ GWIKDL+A DP++I  LFG+LP+  P          +G+ PI++ +SM+ Q K++P 
Sbjct: 481 PWIGWIKDLSAPDPSSILNLFGLLPYATPEPGSLLFIFSLGVLPILLGISMWFQQKLNPA 540

Query: 511 PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL 570
           P D  QA I  WMP +F+F L  F +GL++YW  +NVI+ +QQ  IM +HG    L   +
Sbjct: 541 PTDPSQAAIFAWMPWIFMFMLGGFASGLVLYWIANNVITFIQQYSIMSLHGKRPDLFGNI 600

Query: 571 RSTFSKN 577
            + F K 
Sbjct: 601 IAGFRKK 607


>gi|260427287|ref|ZP_05781266.1| inner membrane protein OxaA [Citreicella sp. SE45]
 gi|260421779|gb|EEX15030.1| inner membrane protein OxaA [Citreicella sp. SE45]
          Length = 607

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 213/605 (35%), Positives = 346/605 (57%), Gaps = 37/605 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEE-MNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           ++N N  +A  LS +++  W  F ++P  EE   ++++ + T         + +     +
Sbjct: 3   DQNKNLLIATGLSFVVILIW--FLLFPPPEEPAVDQQEPVATAPVEGDAATTPSTATPTE 60

Query: 61  RAQALSMSPRVE--------LKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLS 112
             +  + +P+ E        +    L GSI+L G + D+L L+ Y + +  +SP V +L 
Sbjct: 61  GTEGTATAPQAETADAPRLPIDTARLGGSISLTGGRIDELILKDYTVTIDEDSPKVQILE 120

Query: 113 PSNTKNAYFAELDYVSTANNIE---LPNSNTVWNLISGKILTPTTPIKLVFKNANNILFE 169
           P  T +AY+A   + +  N +E   +P +NT W + SG  LT  +P+ L + +   + F 
Sbjct: 121 PVGTGHAYYALYGW-APGNGLEPADVPGANTEWQVESGSSLTVDSPVTLRWDSPAGLTFR 179

Query: 170 RTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVLGDKS 228
           RT+++D++++F +  +V N     +  +P G + RH +P      F + EG +A + D  
Sbjct: 180 RTVAVDKNFMFTVTQSVENTGEASVSAAPYGIVARHGEPVGRKKFFVLHEGVVA-MADGK 238

Query: 229 LVEQKYSDI----------EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYL 278
           L E  YSD+           ++ ++   E N W+G +D YW +  IPS+ T+F    KY 
Sbjct: 239 LNEIDYSDMPDMDMVASEGARADVTQVAE-NGWIGFTDHYWMTTLIPSQGTAFKQVAKY- 296

Query: 279 SDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGW 338
            +G   YQ +     +T+ PG++   T  L+AGAKE+ TI  YE D  + RF   IDWGW
Sbjct: 297 DEGRDIYQTEAVLPTVTLAPGETQQVTTQLYAGAKEYETIRGYE-DAGVDRFIDSIDWGW 355

Query: 339 FYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDE 398
           F+F+ KP+F L+ + + L+GN G +I+  T+ +K + FPLA K YVS A MK +QP++++
Sbjct: 356 FFFLTKPIFWLLHHLHGLIGNMGWSIIALTITLKAILFPLAFKSYVSMAKMKELQPEMEK 415

Query: 399 LREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF 458
           L+E+      Q LQ+ M+QLYK   +NP +GC PILLQIP+FF++YKVI ++ E+R AP+
Sbjct: 416 LKERAGDDR-QKLQQEMMQLYKKEKVNPASGCLPILLQIPIFFSLYKVIFVAFELRQAPW 474

Query: 459 WGWIKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPA 512
           +G  +DL+  DPT+++ LFG+LP+  P        + VGI PI++ +SMF+Q K++P PA
Sbjct: 475 FGPFQDLSTPDPTSLYNLFGLLPWAAPEPGSTLALIFVGILPILLGISMFLQQKLNPAPA 534

Query: 513 DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRS 572
           D  Q MI  WMP VF+F L  F +GL++YW  +N I+  QQ +IM+  G    +   ++S
Sbjct: 535 DPTQKMIFAWMPWVFMFMLGGFASGLVVYWITNNTITFTQQYLIMRSQGYTPDVFGNIKS 594

Query: 573 TFSKN 577
            F K 
Sbjct: 595 GFKKT 599


>gi|209542536|ref|YP_002274765.1| 60 kDa inner membrane insertion protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209530213|gb|ACI50150.1| 60 kDa inner membrane insertion protein [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 589

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 205/571 (35%), Positives = 328/571 (57%), Gaps = 23/571 (4%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQAL 65
            + VA  LS +++  ++  Y  P+       ++  QT +Q    D + A   +   +   
Sbjct: 5   RFIVATLLSAMVLVGFE--YFMPKQAHHEVAQQAAQTSRQTPPTDAARAPAPVAGASSQP 62

Query: 66  SMSP------RVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNA 119
             +P      R+ +  P + GSI+L GA+ DD+ LR YH  V+  SP V +L P + +  
Sbjct: 63  VSTPAPQAETRLAIDAPKVAGSIDLLGARLDDMVLRDYHETVAKGSPQVRILEPGHDQQP 122

Query: 120 YFAELDYVS-TANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHY 178
            + E+ +++     + +P++ TVW+  + K LT   P+ L + N   + F+  +S+D HY
Sbjct: 123 NYVEIGWMNLPGGQVRVPDATTVWSADAPK-LTSDRPVTLSWDNGAGVTFQIVVSIDAHY 181

Query: 179 LFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIE 238
           +F I   + N S   +   P  R+ R    T T  + V EG I+V+ D  L E  Y  + 
Sbjct: 182 MFGIEQRIVNRSAQPVSLYPYARVDRAYTPTETGGYLVHEGPISVI-DGRLDESSYKSLR 240

Query: 239 KSSISNFHES------NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR-YQAKFSA 291
             +    + S        W GI+DKYW +  IP + T+    + Y ++G A  YQ  F A
Sbjct: 241 TGATPPGNLSWTKGGQGGWAGITDKYWLTAVIPQQGTAVTGSYGYQANGGAGVYQVGFIA 300

Query: 292 NEITIL-PGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLM 350
              T++ PG +  T + +FAGAKE   +  Y+  L IP F   +D+GWF F+ +P+F ++
Sbjct: 301 QAATVVAPGTTGATVSHVFAGAKEVNLLEQYQSSLHIPDFWKAVDFGWFAFLTRPIFYVL 360

Query: 351 SYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQV 410
            +   L+GNFG+A+M  T+ VK LFFPLA +Q+ S A M+ +QPK+ ELRE++K S    
Sbjct: 361 DWLNTLLGNFGLALMAFTLLVKALFFPLATRQFRSMAKMRQLQPKVQELRERYK-SDQMA 419

Query: 411 LQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADP 470
           L + M+ LYK   +NP AGC P+++QIPVF+++YK + I++EMRHAPF+GWI DL+A D 
Sbjct: 420 LNQNMMALYKAEGVNPAAGCLPMVVQIPVFWSLYKDLYITIEMRHAPFFGWIHDLSAPDL 479

Query: 471 TNIFTLFGILPF---YLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVF 527
           TN+F LFG++P+    L  ++ +G+WPI+   +MF+Q K++P P D  Q  +   MPV+F
Sbjct: 480 TNLFNLFGLIPWDPNVLSPYLQLGVWPILFGATMFLQQKLNPAPTDPAQQRMFQMMPVLF 539

Query: 528 VFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
            F ++  PAGL+IY+ W+N++++ QQ VI +
Sbjct: 540 TFFMARQPAGLVIYYCWNNLLTVAQQMVIQR 570


>gi|83950483|ref|ZP_00959216.1| inner membrane protein YidC, putative [Roseovarius nubinhibens ISM]
 gi|83838382|gb|EAP77678.1| inner membrane protein YidC, putative [Roseovarius nubinhibens ISM]
          Length = 599

 Score =  395 bits (1014), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 200/524 (38%), Positives = 313/524 (59%), Gaps = 16/524 (3%)

Query: 70  RVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYV-- 127
           RV ++ PS+ GSI+L+G + D+L L  Y   +   + IVTLL+P+ + + Y+A   +   
Sbjct: 77  RVAVETPSVTGSISLRGGRLDELALNNYRESLDPGAEIVTLLNPTGSASPYYALFGWAPG 136

Query: 128 STANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVT 187
           +  N+  +P +NT+W++ SG+ LTP +P+ L+++N   + F R IS+D  Y+F I  TV 
Sbjct: 137 TGLNSDSVPGANTLWSVESGETLTPESPVTLLWENGQGLTFRREISVDAKYMFTIRQTVE 196

Query: 188 NNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFH 246
           N        +P G I RH +P    N F + EG +  + D  L E  Y D E +      
Sbjct: 197 NTGDAAPVLAPYGIIARHGEPADLKNFFILHEGAVQ-MADGELNEIDYDDFEGAGNHTPL 255

Query: 247 E--SNSWLGISDKYWASVFIPSKETSFH-SQFKYLSDGHARYQAKFSANEITILPGKSIT 303
           +  +N W G +D YW +  IP  ET F  S F+        YQ       IT+ PG++  
Sbjct: 256 KVATNGWTGFTDHYWMTTLIPRGETGFDLSTFQ--DPRRNIYQTTVKQPAITLEPGQTAE 313

Query: 304 TTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIA 363
            T  LFAGAKE+ TI +Y+    + +F   IDWGWF+F+ KP+F L+ +    +GN G +
Sbjct: 314 ATTQLFAGAKEWETIRNYQNKGGVDKFLDSIDWGWFFFLTKPIFALLHWLNQQIGNMGWS 373

Query: 364 IMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHN 423
           I+  T+ +KL+  PLA K YVS A MK +QP++++++E+      Q LQK M+ LYK   
Sbjct: 374 IIALTLIIKLVLLPLAYKSYVSMAKMKELQPQMEKIKERAGDD-RQALQKEMMALYKKEK 432

Query: 424 INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY 483
           +NP +GC PILLQIP+FF++YKVI ++LE+RHAP+ GWI+DL+A DP++++ L+G+LP+ 
Sbjct: 433 VNPASGCLPILLQIPIFFSLYKVIFVTLELRHAPWIGWIRDLSAPDPSSLYNLWGLLPWN 492

Query: 484 LP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAG 537
            P        + +GI P+++ +SM++Q K++P P D  Q M+  WMP +F+F L SF +G
Sbjct: 493 APEPGSLLALIFIGILPLLLGISMWLQQKLNPAPTDPTQKMVFAWMPWIFMFMLGSFASG 552

Query: 538 LIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ 581
           L++YW  +N I+  QQ  IM+  G +  +   ++S F +   + 
Sbjct: 553 LVVYWIANNTITFTQQYAIMRSQGYKPDVFGNIKSGFKRTRKTD 596


>gi|88658314|ref|YP_507580.1| putative inner membrane protein translocase component YidC
           [Ehrlichia chaffeensis str. Arkansas]
 gi|88599771|gb|ABD45240.1| inner-membrane protein, 60 kDa [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 579

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 213/567 (37%), Positives = 341/567 (60%), Gaps = 27/567 (4%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPRIEEMNNE-RKNIQTVKQPNQVDNSYAAVLIDDRAQA 64
           N  +A+ LSV+I+  W+  ++Y +     +    N  +     ++D+++       R++ 
Sbjct: 6   NLILAVILSVLIMMGWR--FIYDKFFTTQHAIEDNTSSDAMIPEIDDNFIH---KTRSEV 60

Query: 65  LSMSP--RVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFA 122
           +  +   R++L N  + GSI+LKGAQFDDL  + YH+    NS  + LLSP  T+N YF 
Sbjct: 61  IESNTNIRIKLSNEKMNGSISLKGAQFDDLIFKNYHVTPDKNSEGIVLLSPEETENVYFI 120

Query: 123 ELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKI 182
           E  ++   + I +P  +++WN      L+P  PI L + N   ++F+  I+LD  Y+FKI
Sbjct: 121 EFGWIDPQHKITVPTHSSIWNS-DQSTLSPNNPITLTWDNKQGVVFKIKITLDNDYMFKI 179

Query: 183 VDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGD-------KSLVEQKYS 235
              VTNN+   I   P GRI R K     + +   EG +   G+       K++ ++K  
Sbjct: 180 EQMVTNNTDSIINLIPYGRINRSKHTAEKSYWISHEGAVGSFGNTLKEWTYKAITKEKNI 239

Query: 236 DIEKSSISNFHESNSWLGISDKYWASVFIP--SKETSFHSQFKYLS-DGHARYQAKFSAN 292
            I++  I++    N W+GI DKYW +  IP  S++++ +   K+   +   R+Q  FS +
Sbjct: 240 KIQQQDIND--NQNQWIGIGDKYWFTALIPNVSQKSNLNFHVKHAKHNSKDRFQVDFSHD 297

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
                P  ++T+ N+LFAGAKE   +  Y+ +L I  F+  +D+G  YFI KP+F+L+ Y
Sbjct: 298 NYIAHPNNTVTSINYLFAGAKELKLLDTYKDNLNISLFDKAVDFGVLYFITKPVFLLLEY 357

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
           F N++GNFG+AI+L T+ +KL+ FPL+ K YVS   ++++QP I  ++E +K    + + 
Sbjct: 358 FNNVIGNFGLAILLLTIVIKLIMFPLSHKSYVSMLKLRHLQPDIVRIKELYKNDNDK-MS 416

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           K +  ++K +N+NP++G  P+L+QIPVFFA+YKV+ +++EMRHAPF+ WIKDL++ D  N
Sbjct: 417 KEISAIFKKNNVNPMSGFVPVLIQIPVFFALYKVLFVTIEMRHAPFYLWIKDLSSFDTAN 476

Query: 473 IFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKM---SPPPADKGQAMILNWMPVVFVF 529
           I T+FG+L F  P  + +GI P+I+ ++M IQ K+   S    DK QA  + ++P +F+F
Sbjct: 477 ILTIFGLLKFNPP--ICIGILPVILGITMIIQQKLNNHSSLNQDKTQANFMKFLPYIFIF 534

Query: 530 ALSSFPAGLIIYWSWSNVISIVQQAVI 556
             SSFPAGLIIYW  SN I+IVQQ +I
Sbjct: 535 IFSSFPAGLIIYWICSNSITIVQQLII 561


>gi|119383628|ref|YP_914684.1| putative inner membrane protein translocase component YidC
           [Paracoccus denitrificans PD1222]
 gi|166975878|sp|A1B0E4|OXAA_PARDP RecName: Full=Inner membrane protein oxaA
 gi|119373395|gb|ABL68988.1| protein translocase subunit yidC [Paracoccus denitrificans PD1222]
          Length = 635

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 221/622 (35%), Positives = 333/622 (53%), Gaps = 54/622 (8%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYV-YPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           + N N  +A+ LS +++  W  F+   P     +    + Q   QP     +    +   
Sbjct: 3   DNNRNLILAMVLSALVMLVWSIFFAPEPVPPAQDTPAASTQGTAQPEAGGPATPGAVPQG 62

Query: 61  RAQALSMSP----------RVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTL 110
            A  L  +           RV +++ SL G+I+L G + DDL L GY   + + SP V L
Sbjct: 63  AAPELEAAAASSDPSANAGRVAIESSSLAGTISLAGGRIDDLELTGYRETLDTRSPFVRL 122

Query: 111 LSPSNTKNAYFAELDYVSTANNIEL-----------------------PNSNTVWNLISG 147
           LSP+  +    AE   V+     EL                       P   TVW + SG
Sbjct: 123 LSPT-AQTTVQAEGSPVAPGGGAELAVQKPYYAVYGWMPAAGTDPALVPGPATVWEVESG 181

Query: 148 KILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKP 207
             L P  P+ L + N    +F RT  LD+ +LF +  T+ N        +P G + RH  
Sbjct: 182 AKLGPGQPVTLRWDNGAGQIFRRTYELDDKFLFTVTQTLENTGTAPFSAAPYGILARHGK 241

Query: 208 QTATNTFGVQEGFIAVLGDKSLVEQKYSDIEK---------SSISNFHESNSWLGISDKY 258
               N F + EG + +  D  L+E+KY D+ K         + +    E N W+G +DKY
Sbjct: 242 PDTQNFFVLHEGAVGMT-DGKLLEKKYKDMTKLDPLPGEGPAELVEVQE-NGWIGFTDKY 299

Query: 259 WASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTI 318
           W +   P+   SF +  KY + G   YQ +      T+ PG + T++++LFAGAK +  I
Sbjct: 300 WMTTLAPAPGQSFTAVAKY-APGADIYQTEARMPVQTVAPGATGTSSSYLFAGAKVWEVI 358

Query: 319 HHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPL 378
           + Y+ +  I RF   IDWGWFYF+ KP+F L+ + + ++GN G AI+  T  +KLL FPL
Sbjct: 359 NGYQTNPGIDRFVDSIDWGWFYFLTKPIFRLLHWLHGMIGNMGWAIIALTFVLKLLVFPL 418

Query: 379 AKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIP 438
           A+K Y+S A MK +QP+++ ++E+         QK +++LYK   +NP AGC P+LLQIP
Sbjct: 419 ARKSYISMAKMKELQPQMEAIKERTGDD-RMKFQKEVMELYKREKVNPAAGCLPVLLQIP 477

Query: 439 VFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPG---FMHVGIWP- 494
           +FFA+YKVI +++E+RHAP+ GWI+DLAA DP++++ LFG+LP+  PG   F+H    P 
Sbjct: 478 IFFALYKVIFVTIELRHAPWIGWIRDLAAPDPSSLWNLFGLLPWAAPGQGSFLHSFTLPV 537

Query: 495 --IIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQ 552
             I++ +SM++Q K++P P D  Q MI  WMP VF+F L  F +GL++YW  +N I+I+Q
Sbjct: 538 LAILLGVSMWMQQKLNPAPTDPAQKMIFAWMPWVFMFMLGGFASGLVLYWITNNTITIIQ 597

Query: 553 QAVIMKMHGAEIGLIDRLRSTF 574
           Q  IM MHG        +RS+ 
Sbjct: 598 QYTIMSMHGHRPDFFGNIRSSL 619


>gi|68171979|ref|ZP_00545283.1| 60 kDa inner membrane protein [Ehrlichia chaffeensis str. Sapulpa]
 gi|67998597|gb|EAM85346.1| 60 kDa inner membrane protein [Ehrlichia chaffeensis str. Sapulpa]
          Length = 585

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 213/567 (37%), Positives = 341/567 (60%), Gaps = 27/567 (4%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPRIEEMNNE-RKNIQTVKQPNQVDNSYAAVLIDDRAQA 64
           N  +A+ LSV+I+  W+  ++Y +     +    N  +     ++D+++       R++ 
Sbjct: 12  NLILAVILSVLIMMGWR--FIYDKFFTTQHAIEDNTSSDAMIPEIDDNFIH---KTRSEV 66

Query: 65  LSMSP--RVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFA 122
           +  +   R++L N  + GSI+LKGAQFDDL  + YH+    NS  + LLSP  T+N YF 
Sbjct: 67  IESNTNIRIKLSNEKMNGSISLKGAQFDDLIFKNYHVTPDKNSEGIVLLSPEETENVYFI 126

Query: 123 ELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKI 182
           E  ++   + I +P  +++WN      L+P  PI L + N   ++F+  I+LD  Y+FKI
Sbjct: 127 EFGWIDPQHKITVPTHSSIWNS-DQSTLSPNNPITLTWDNKQGVVFKIKITLDNDYMFKI 185

Query: 183 VDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGD-------KSLVEQKYS 235
              VTNN+   I   P GRI R K     + +   EG +   G+       K++ ++K  
Sbjct: 186 EQMVTNNTDSIINLIPYGRINRSKHTAEKSYWISHEGAVGSFGNTLKEWTYKAITKEKNI 245

Query: 236 DIEKSSISNFHESNSWLGISDKYWASVFIP--SKETSFHSQFKYLS-DGHARYQAKFSAN 292
            I++  I++    N W+GI DKYW +  IP  S++++ +   K+   +   R+Q  FS +
Sbjct: 246 KIQQQDIND--NQNQWIGIGDKYWFTALIPNVSQKSNLNFHVKHAKHNSKDRFQVDFSHD 303

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
                P  ++T+ N+LFAGAKE   +  Y+ +L I  F+  +D+G  YFI KP+F+L+ Y
Sbjct: 304 NYIAHPNNTVTSINYLFAGAKELKLLDTYKDNLNISLFDKAVDFGVLYFITKPVFLLLEY 363

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
           F N++GNFG+AI+L T+ +KL+ FPL+ K YVS   ++++QP I  ++E +K    + + 
Sbjct: 364 FNNVIGNFGLAILLLTIVIKLIMFPLSHKSYVSMLKLRHLQPDIVRIKELYKNDNDK-MS 422

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           K +  ++K +N+NP++G  P+L+QIPVFFA+YKV+ +++EMRHAPF+ WIKDL++ D  N
Sbjct: 423 KEISAIFKKNNVNPMSGFVPVLIQIPVFFALYKVLFVTIEMRHAPFYLWIKDLSSFDTAN 482

Query: 473 IFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKM---SPPPADKGQAMILNWMPVVFVF 529
           I T+FG+L F  P  + +GI P+I+ ++M IQ K+   S    DK QA  + ++P +F+F
Sbjct: 483 ILTIFGLLKFNPP--ICIGILPVILGITMIIQQKLNNHSSLNQDKTQANFMKFLPYIFIF 540

Query: 530 ALSSFPAGLIIYWSWSNVISIVQQAVI 556
             SSFPAGLIIYW  SN I+IVQQ +I
Sbjct: 541 IFSSFPAGLIIYWICSNSITIVQQLII 567


>gi|73666922|ref|YP_302938.1| putative inner membrane protein translocase component YidC
           [Ehrlichia canis str. Jake]
 gi|72394063|gb|AAZ68340.1| protein translocase subunit yidC [Ehrlichia canis str. Jake]
          Length = 579

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 222/573 (38%), Positives = 339/573 (59%), Gaps = 39/573 (6%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPR-------IEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           N  +A+ LSV+I+  W+  ++Y +       IE+  N    I       ++D+S+     
Sbjct: 6   NLILAVILSVLIMTGWR--FIYDKFFTTQHIIEDNTNSDTMIP------EIDDSFTH--- 54

Query: 59  DDRAQALSMSP--RVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNT 116
             RA+ +  +   R+ L N  + GSI+LKGAQFDDL  + YH+   SNS  + LLSP  T
Sbjct: 55  KTRAEIIGSNTDIRLNLSNKKIHGSISLKGAQFDDLIFKNYHVTPDSNSDGIILLSPEET 114

Query: 117 KNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE 176
           +  YF E  ++   + I LPN +++WN      L+P  P  L + N   I+F+  I+LD 
Sbjct: 115 EGVYFIEFGWIDPQHKITLPNHSSIWNS-DQPTLSPNNPATLTWDNKEGIIFKIRITLDN 173

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
            Y+FKI   VTNN+   +   P GRI R K  T  + +   EG +    + +L E  Y  
Sbjct: 174 DYMFKIEQMVTNNTNSIVNLIPYGRINRSKHTTEKSYWISHEGAVGSFSN-TLKEWTYKT 232

Query: 237 IEKS------SISNFHESNSWLGISDKYWASVFIPS----KETSFHSQFKYLSDGHARYQ 286
           I K       S     + N W+GI DKYW +  IP+     + +FH +     +   R+Q
Sbjct: 233 ITKEKNIRIQSQDRNDDQNQWIGIGDKYWFTALIPNVLQKSKVNFHVKHAK-HNSEDRFQ 291

Query: 287 AKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPM 346
             FS +     P K++T+T++LFAGAKE   +  Y+ +L I  F+  +D+G  YFI KP+
Sbjct: 292 VDFSHDNYIAHPNKTVTSTSYLFAGAKELKLLDKYKDNLNIALFDKAVDFGVLYFITKPV 351

Query: 347 FMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQS 406
           F+L+ YFY+ +GNFG+AI+L TV +KL+ FPL+ K YVS   +K +QP I +++E  K  
Sbjct: 352 FLLLEYFYDAIGNFGLAILLLTVVIKLIMFPLSYKAYVSMLKLKYLQPDILKIKELHKND 411

Query: 407 PPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLA 466
             + + K +  ++K +N+NP++G  PIL+QIPVFFA+YKV+ +++EMRHAPF+ WIKDL+
Sbjct: 412 NDK-MSKEISAIFKKNNVNPMSGFVPILIQIPVFFALYKVLFVTIEMRHAPFYLWIKDLS 470

Query: 467 AADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPA---DKGQAMILNWM 523
           + D  N+ T+FG+L F +P  + +GI P+I+ ++M IQ K++   +   DK QA  + ++
Sbjct: 471 SFDTANVLTMFGLLKFNVP--ICIGILPVILGITMVIQQKLNNSNSLNQDKVQANFMKFL 528

Query: 524 PVVFVFALSSFPAGLIIYWSWSNVISIVQQAVI 556
           P +F+F  SSFPAGLIIYW  SN I+I+QQ +I
Sbjct: 529 PYIFIFIFSSFPAGLIIYWICSNSITIIQQLII 561


>gi|296115059|ref|ZP_06833701.1| 60 kDa inner membrane insertion protein [Gluconacetobacter hansenii
           ATCC 23769]
 gi|295978396|gb|EFG85132.1| 60 kDa inner membrane insertion protein [Gluconacetobacter hansenii
           ATCC 23769]
          Length = 719

 Score =  392 bits (1007), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 200/510 (39%), Positives = 302/510 (59%), Gaps = 17/510 (3%)

Query: 68  SPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYV 127
            PR+ +    + GSINL+GA+ DDL L+ YH  V   SP+V +L P     +   E+ ++
Sbjct: 62  DPRLAINTGRVGGSINLRGARLDDLVLKDYHETVKPGSPLVRILDPRQDPQSNLVEVGWL 121

Query: 128 STANN-IELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTV 186
           + A   + +P++ TVW+      LT   P+ L + N    +FE  +++D++Y+F +   V
Sbjct: 122 NIAGGQVRVPDATTVWSADQAS-LTQDQPVTLRWDNGQGQVFELVVAIDQNYMFSVTQKV 180

Query: 187 TNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSIS--- 243
            N +   +   P  R+ R      T  + V EG I+V+ D  L E  Y  +   +I    
Sbjct: 181 HNQAAGPVSLYPYSRVDRAYTPVETGGYLVHEGPISVI-DGRLDESSYKSVRNGTIPPGN 239

Query: 244 ---NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD-GH-ARYQAKFSANEITIL- 297
              N   +  W GI+DKYW +  IP +++     + Y+ + GH   YQ  F+A    ++ 
Sbjct: 240 TSWNKPGTGGWSGITDKYWLTAVIPQQDSLVTGSYGYVPEAGHEGVYQVGFTARTPEVIA 299

Query: 298 PGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLV 357
           PG    T   +FAGAKE P +  YE  L IP F   +D+GWF F+  P+F ++ +   L+
Sbjct: 300 PGGDGVTETHVFAGAKEVPLLEKYEASLHIPSFWKAVDFGWFAFLTHPIFTVLDWLNTLL 359

Query: 358 GNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQ 417
           GNFG+A+M  T+ VK LFFPLA KQ+ S   M+ +QPKI  LRE++K      L + MI 
Sbjct: 360 GNFGLALMAFTLVVKGLFFPLATKQFRSMGKMRQLQPKIKALRERYKDD-QMALNQHMIA 418

Query: 418 LYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLF 477
           LYK   +NP +GC P+LLQIPVF+ +YKV+ +++EMRHAPF+GWI DL+AADPTNIFTLF
Sbjct: 419 LYKEEKVNPASGCLPMLLQIPVFWCLYKVLFVTIEMRHAPFFGWIHDLSAADPTNIFTLF 478

Query: 478 GILPF---YLPGFMHVGIWPIIMSLSMFIQMKMSP-PPADKGQAMILNWMPVVFVFALSS 533
           G++P+   ++  F  +G+WPI   L+MF Q K++P P AD  Q  +   MP++F F ++ 
Sbjct: 479 GLIPWDPTHISTFFQLGLWPIAFGLTMFAQQKINPAPAADPAQQKMFQLMPILFTFFMAR 538

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
            P+GL+IY+ W+N++++ QQAVI +   AE
Sbjct: 539 QPSGLVIYYCWNNLLTMAQQAVIQRRVNAE 568


>gi|189183736|ref|YP_001937521.1| putative inner membrane protein translocase component YidC
           [Orientia tsutsugamushi str. Ikeda]
 gi|189180507|dbj|BAG40287.1| 60 kD inner-membrane protein [Orientia tsutsugamushi str. Ikeda]
          Length = 567

 Score =  392 bits (1006), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 217/563 (38%), Positives = 336/563 (59%), Gaps = 11/563 (1%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSY---AAVLIDDRA 62
           N  +AI LS+ I+  W  FY  PR+ +M+N +K      + +  +      +A+ I D+ 
Sbjct: 8   NLILAITLSLAIILGWHFFYEKPRLIKMSNAQKEKIEYNKRSSTNKHLLHESALKIKDKV 67

Query: 63  QALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFA 122
             +  S RV++    L GSI+LKG +FDDL L GY  DV  NSP V LLSPS T  AYFA
Sbjct: 68  DIIDYSTRVKIMTNKLHGSISLKGLRFDDLILVGYKQDVLENSPDVELLSPSETATAYFA 127

Query: 123 ELDYVSTAN-NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFK 181
           E+ +    N + + PNS+T+W      IL         + N +N+ F  ++S+D++Y+F 
Sbjct: 128 EVGWYCAKNADSDFPNSDTLWQ-TDKSILQANDTTTFTWTNKHNVQFIVSVSIDDNYMFT 186

Query: 182 IVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI-EKS 240
           I  ++ NNS  Q+     G I R+  +   N+  + +G IA + D  L E  Y+ + EK 
Sbjct: 187 INQSIVNNSKQQLAVQFHGLIHRNLAENE-NSANIFQGPIASI-DSYLNEVTYNKLKEKK 244

Query: 241 SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKF-SANEITILPG 299
            I        WLGISDKYW + FIP  +  + + F Y   G  +YQ  F S  E+    G
Sbjct: 245 HIDYNLNVVHWLGISDKYWLTSFIPDVKYRYSTSFMYGKAGFEKYQVSFLSPKEVVNSDG 304

Query: 300 KSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGN 359
            S++  + LF GAKE   + +Y K   I  F+  ID+GWFY + KP+F  +S+FY   GN
Sbjct: 305 GSLSVVHHLFLGAKEVKLLDYYAKKYNIKLFDRAIDFGWFYILTKPLFYTLSFFYKYCGN 364

Query: 360 FGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLY 419
           FG++I++ T+ +K++ F  + + Y S   M+++QP+I  L+E +     ++ Q+ M  LY
Sbjct: 365 FGVSILIVTILIKIMMFSFSNRSYSSMKKMRDLQPRIQRLQELYGDDKIKLHQEIM-ALY 423

Query: 420 KTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGI 479
           K   ++        L+Q+P+FF++YKV+ +++EMRHAPF+ WIKDL+A DPT IF LFG+
Sbjct: 424 KKEKVSLAGSFLQSLIQLPIFFSLYKVLHVTIEMRHAPFFIWIKDLSALDPTCIFNLFGL 483

Query: 480 LPFYLPGFMHVGIWPIIMSLSMFIQMKMS-PPPADKGQAMILNWMPVVFVFALSSFPAGL 538
           LPF++P F+++G WPI+ S +M +Q K++  P AD  QA +L +MP++ +   ++FPAGL
Sbjct: 484 LPFHVPWFLNIGAWPILTSATMMLQQKINPAPAADPAQAQVLKFMPLILLIVFNNFPAGL 543

Query: 539 IIYWSWSNVISIVQQAVIMKMHG 561
           +IYW+W+N++SIVQQ +I K++ 
Sbjct: 544 LIYWTWNNILSIVQQFIINKINN 566


>gi|114765427|ref|ZP_01444542.1| putative inner membrane protein translocase component YidC
           [Pelagibaca bermudensis HTCC2601]
 gi|114542270|gb|EAU45300.1| putative inner membrane protein translocase component YidC
           [Roseovarius sp. HTCC2601]
          Length = 611

 Score =  391 bits (1005), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 217/605 (35%), Positives = 338/605 (55%), Gaps = 35/605 (5%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKN---IQTVKQPNQVDNSYAAVLI 58
           ++N N  +A  LS +++  W  F ++P  EE   ++     ++TV+       S A    
Sbjct: 3   DQNKNLLIATGLSFVVILVW--FLLFPPPEEQLQDQAGPNAVETVEGDTATTPSAAPSAT 60

Query: 59  ---DDRAQALSMS-----PRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTL 110
               D A A + +     PRV +    L GSI+L G + D+L L+ Y + +  +SP V +
Sbjct: 61  TGGGDTAAAPAQAETVDAPRVAIDTDRLGGSISLTGGRIDELILKDYTVTLDEDSPNVQI 120

Query: 111 LSPSNTKNAYFAELDYV--STANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILF 168
           L P    N Y+A   +   S     ++P +NT W L SG  L+  +P+ L + +   ++F
Sbjct: 121 LEPVGGGNPYYALYGWAPGSGLGLDDVPGANTAWELESGDSLSVDSPVTLRWDSPAGLVF 180

Query: 169 ERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVLGDK 227
            RTIS+DE ++F +  +V N     +  +P G I RH +P    N F + EG +A+  D 
Sbjct: 181 RRTISIDEDFMFSVTQSVENAGEGTVSAAPYGIIARHGEPADLKNFFVLHEGVVAI-ADG 239

Query: 228 SLVEQKYSDIEKSSISNFHES---------NSWLGISDKYWASVFIPSKETSFHSQFKYL 278
            L E  YSD+    ++    +         N W+G +D YW +  IP +   F    KY 
Sbjct: 240 KLSEIGYSDMPDMDVNQSEGARAEVTQVTENGWIGFTDHYWMTTLIPQQGAPFKQAAKY- 298

Query: 279 SDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGW 338
            +    YQ +     +T+ PG++   T  LFAGAKE+ TI  YE D  + RF   IDWGW
Sbjct: 299 DERRDIYQTEAVLPTMTLAPGETQEVTTQLFAGAKEYETIRDYE-DAGVVRFIDSIDWGW 357

Query: 339 FYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDE 398
           F+F+ KP+F ++   + L+GN G +I+  T+ +K + FPLA K YVS A MK +QP++++
Sbjct: 358 FFFLTKPIFWMLHQIHLLIGNMGWSIIGLTLIIKAILFPLAYKSYVSMAKMKELQPEMEK 417

Query: 399 LREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF 458
           L+EK      Q LQ+ M+ LYK   +NP +GC PILLQIP+FF++YKVI ++ E+RHAP+
Sbjct: 418 LKEKAGDDR-QKLQQEMMALYKKEKVNPASGCLPILLQIPIFFSLYKVIFVAFELRHAPW 476

Query: 459 WGWIKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPA 512
           +G  +DL+  DPT++F LFG+LP+  P        + +GI P+++ +SM++Q K++P PA
Sbjct: 477 FGPFQDLSTPDPTSLFNLFGLLPWAAPAPGTTLALVFIGILPLLLGISMWLQQKLNPAPA 536

Query: 513 DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRS 572
           D  Q MI  WMP VF+F L  F +GL++YW  +N I+  QQ +IM+  G +  +   + S
Sbjct: 537 DPTQKMIFAWMPWVFMFMLGGFASGLVVYWITNNTITFTQQYLIMRSQGYKPDVFGNIVS 596

Query: 573 TFSKN 577
            F + 
Sbjct: 597 GFKRK 601


>gi|254450534|ref|ZP_05063971.1| 60 kD inner-membrane protein [Octadecabacter antarcticus 238]
 gi|198264940|gb|EDY89210.1| 60 kD inner-membrane protein [Octadecabacter antarcticus 238]
          Length = 593

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 211/582 (36%), Positives = 331/582 (56%), Gaps = 31/582 (5%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQT--------VKQPNQVDNSY 53
           ++N N  +A ALS I++  W   +  P + E     +   T         + P QV    
Sbjct: 3   DQNKNIILATALSFIVILTWFVLFPPPEVAEQAPTTEITTTDGTTLGVDAQIPEQVGE-- 60

Query: 54  AAVLIDDRAQ-ALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLS 112
            AVL    A+  ++ +PR+ + + SL GS++L G + DDL+L+GY   +  ++ +V LLS
Sbjct: 61  VAVLAPLSAEDVIADAPRLVIDSESLTGSLSLTGGRIDDLSLKGYRETLKPDADLVRLLS 120

Query: 113 PSNTKNAYFAELDYVST--ANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFER 170
           P  T + Y+A   +V+   A   ++P ++T W + SG+ L+P + + LV+ N   + F +
Sbjct: 121 PIGTDSPYYALHGWVAAVGATADQVPGASTQWQIESGETLSPGSDVTLVWGNGAGLTFRK 180

Query: 171 TISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLV 230
           T ++DE +LF +  TV N +  +I   P G + RH        F   EG +  + D S+ 
Sbjct: 181 TFAVDEEFLFTVTQTVENTTGAEIALRPYGLVARHGEPDQIGFFIQHEGVVR-MSDGSME 239

Query: 231 EQKYSDI-----EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARY 285
           E  Y D+     E+S I      N W+G SD+YW +  IP+    F S  K+ +D    Y
Sbjct: 240 EINYDDMPDLTTEESRIE--VTENGWIGFSDQYWMTALIPTPGRDFRSTAKFAND---IY 294

Query: 286 QAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKP 345
           Q +     IT+ PG + +     FAGA+E+  I  Y+ DL I RF   IDWGWF+F+ KP
Sbjct: 295 QIETVYPMITVAPGATASADTQFFAGAQEWEVIRSYQNDLGIDRFLDSIDWGWFFFLTKP 354

Query: 346 MFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQ 405
           +F ++ +   L+GN G +I+  T  +K L  PLA K YVS A M+ +QP++ +L+E    
Sbjct: 355 IFAMLHWLNGLIGNMGWSIICLTFVIKALLLPLAYKSYVSMAKMRELQPEMAKLKEAAGD 414

Query: 406 SPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDL 465
              + LQK M+ LYK + +NP +GC PIL+QIP+FF++YKVI +++E+RHAP+ GW+ DL
Sbjct: 415 D-REKLQKGMMSLYKENKVNPASGCLPILMQIPIFFSLYKVIFVTIELRHAPWIGWVNDL 473

Query: 466 AAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMI 519
           +A D + ++ LFG+LP+  P          +G+ PI++ +SM++Q K++P P D  Q MI
Sbjct: 474 SAPDTSTLYNLFGLLPWGAPEPDSILALAFIGVMPIVLGISMWLQQKLNPAPTDATQKMI 533

Query: 520 LNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHG 561
             WMP VF+F L  F +GL++YW  +N I+ +QQ  IM+  G
Sbjct: 534 FAWMPWVFMFMLGGFASGLVLYWIANNSITFMQQYAIMRSQG 575


>gi|57239041|ref|YP_180177.1| putative inner membrane protein translocase component YidC
           [Ehrlichia ruminantium str. Welgevonden]
 gi|57161120|emb|CAH58031.1| putative integral membrane protein [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 575

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 225/586 (38%), Positives = 344/586 (58%), Gaps = 45/586 (7%)

Query: 6   NYFVAIALSVIIVYAW----QNFYVYPRIEE------MNNERKNIQTVKQPNQVDNSYAA 55
           N   A+ LSV+I+  W    + F+    + E      M  E  N+ T +  N+       
Sbjct: 6   NLVFAVVLSVLIMMGWRLVYEKFFTVQHVVEDEDSSSMIPEIDNVLTYRSRNE------- 58

Query: 56  VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSN 115
             I D  Q L    RV+L N  + GSI+LKGAQ DDL  + YH+   S+S  + LLSP N
Sbjct: 59  --IIDSTQNL----RVKLSNKEINGSISLKGAQLDDLVFKNYHITPDSSSDGIILLSPEN 112

Query: 116 TKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD 175
           T+  YF E  ++   + I +PN  + W      +L+P   + L + N   ++F+  ++LD
Sbjct: 113 TEGVYFIEFGWIDPQHKIVVPNQLSTWTS-DKSVLSPNNTVTLTWDNQQGVIFQIKVTLD 171

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
           ++Y+FKI   + NN+ + +   P GRI R +  T  + +   EG +   G  +L E  Y 
Sbjct: 172 DYYMFKIEQIIINNTDNVVNLIPYGRINRARHTTEKSYWISHEGAVGSFG-YTLKEWTYK 230

Query: 236 DIEKS---SISNFH-ESNSWLGISDKYWASVFIPS-----KETSFHSQF-KYLSDGHARY 285
           +I K     IS  + + N W+GI+DKYW +  IP+      + SFH +  KY  +   R+
Sbjct: 231 NIIKERNIKISQQNTDDNQWVGIADKYWFTALIPNILQKKSKLSFHVKHGKY--NNEDRF 288

Query: 286 QAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKP 345
           Q  FS +  +  P K+ ++T++LFAGAKE   +  Y+KDL I  F+  +D+G  YFI KP
Sbjct: 289 QVDFSHDSYSAYPNKTASSTSYLFAGAKELKLLDKYKKDLNISLFDKAVDFGILYFITKP 348

Query: 346 MFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQ 405
           +F+L+ YFY+L+GNFG+AI+L T+ +KL+ FPL+ K YVS   +K +QP+I +++E +K 
Sbjct: 349 VFLLLEYFYDLIGNFGLAILLLTIVIKLIMFPLSYKSYVSMFKLKYLQPEILKIKELYKN 408

Query: 406 SPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDL 465
              + + K +  L+K ++++P++G  PIL+QIPVFFA+YKV+ +++EMRHAPF+ W+KDL
Sbjct: 409 DNTK-MSKEVSLLFKKNDVSPMSGFIPILIQIPVFFALYKVLFVTIEMRHAPFYLWVKDL 467

Query: 466 AAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKM-----SPPPADKGQAMIL 520
           +  D  N+ TLFG+L F  P  + +GI P+I+ ++M IQ KM     S    DK QA  +
Sbjct: 468 SNFDTANVLTLFGLLNFNPP--ICIGILPVILGITMIIQQKMNTSTHSSQDQDKIQASFI 525

Query: 521 NWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGL 566
            ++P VF+F  SSFP GLIIYW  SN I+I+QQ +I    G +  L
Sbjct: 526 KFLPYVFIFIFSSFPTGLIIYWICSNSITIIQQLIIKAYIGRKFNL 571


>gi|254488170|ref|ZP_05101375.1| 60 kD inner-membrane protein [Roseobacter sp. GAI101]
 gi|214045039|gb|EEB85677.1| 60 kD inner-membrane protein [Roseobacter sp. GAI101]
          Length = 616

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 214/597 (35%), Positives = 336/597 (56%), Gaps = 34/597 (5%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI--- 58
           ++N N  +A  LS I++  W  F ++P  E          +   P  V    AAV     
Sbjct: 3   DQNKNLIIATVLSFIVILGW--FLLFPPPEPNTPLDGTEISATAPTDVTTPDAAVPAGTA 60

Query: 59  ---------DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVT 109
                    + RA +L  +PRV ++   L GSI+L G + DDL L+ Y   +  ++PIVT
Sbjct: 61  LPATTADPEETRADSLEQAPRVPVETSRLTGSISLLGGRIDDLRLKDYRTTIEDDAPIVT 120

Query: 110 LLSPSNTKNAYFAELDYVSTANNI--ELPNSNTVWNLISGKILTPTTPIKLVFKNANNIL 167
           LLSP+ T +AY+A   + + A     ++P  NT+W+L SG  L+  +P+ + + N    +
Sbjct: 121 LLSPAGTDDAYYALYGWAAGAGIAPEQVPGPNTLWSLASGDTLSVGSPVTMTWDNGAGQV 180

Query: 168 FERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHK-PQTATNTFGVQEGFIAVLGD 226
           F R IS+DE+++F++  +V N S   +  +P G I RH  P  A N F + EG +A + +
Sbjct: 181 FSRVISVDENFMFEVEQSVQNTSETSVTLAPYGIIARHGIPTDAQNFFILHEGMVA-MNN 239

Query: 227 KSLVEQKYSDI-EKSSISNFHE------SNSWLGISDKYWASVFIPSKETSFHSQFKYLS 279
             L+E  + DI +   +           +N W+G +  Y+ +  IP          KYL 
Sbjct: 240 GELIETGWEDIPDLDPVGGVPSKRIDGVTNGWIGFTGHYFMTNLIPDPAQQSRLTAKYLP 299

Query: 280 DGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWF 339
                +Q +       I  G S + +  LFAGAKE+  +  YE    + +F   IDWGWF
Sbjct: 300 RTDI-FQTEAVLPTQVIAAGSSASVSTQLFAGAKEWEALRDYEA-AGVYKFVDSIDWGWF 357

Query: 340 YFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDEL 399
           +F+ KP+F ++ +   L+GN G+AI+  T+ +K L FPLA K YVS A MK +QP++++L
Sbjct: 358 FFLTKPIFWVLHHLNILIGNMGVAIIGLTLLIKALLFPLAYKSYVSMAKMKELQPQMEKL 417

Query: 400 REKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFW 459
           ++       Q LQ+ M++LYK   +NP AGC PI++QIP+FF++YKVI ++LE+RHAPF+
Sbjct: 418 KKDAGDDR-QKLQQGMMELYKREKVNPAAGCLPIIMQIPIFFSLYKVIFVTLELRHAPFF 476

Query: 460 GWIKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPAD 513
           G  +DL+A DPT+IF  +G+LP+ +P        + +GI P+++ +SMF+Q K++P P D
Sbjct: 477 GPFQDLSAPDPTSIFNFYGLLPWGVPEAGSVMALIFIGILPLLLGISMFLQQKLNPAPTD 536

Query: 514 KGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL 570
             Q MI  WMP VF+F L  F +GL++YW  +N I+  QQ +IM+  G +  L+  +
Sbjct: 537 PTQQMIFAWMPWVFMFMLGGFASGLVVYWIANNTITFTQQYLIMRSQGYKPDLLGNI 593


>gi|162147919|ref|YP_001602380.1| inner membrane protein oxaA [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161786496|emb|CAP56078.1| putative inner membrane protein oxaA [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 572

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 199/540 (36%), Positives = 315/540 (58%), Gaps = 21/540 (3%)

Query: 37  RKNIQTVKQPNQVDNSYAAVLIDDRAQALSMSP------RVELKNPSLIGSINLKGAQFD 90
           ++  QT +Q    D + A   +   +     +P      R+ +  P + GSI+L GA+ D
Sbjct: 17  QQAAQTSRQTPPTDAARAPAPVAGASSQPVSTPAPQAETRLAIDAPKVAGSIDLLGARLD 76

Query: 91  DLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVS-TANNIELPNSNTVWNLISGKI 149
           D+ LR YH  V+  SP V +L P + +   + E+ +++     + +P++ TVW+  + K 
Sbjct: 77  DMVLRDYHETVAKGSPQVRILEPGHDQQPNYVEIGWMNLPGGQVRVPDATTVWSADAPK- 135

Query: 150 LTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT 209
           LT   P+ L + N   + F+  +S+D HY+F I   + N S   +   P  R+ R    T
Sbjct: 136 LTSDRPVTLSWDNGAGVTFQIVVSIDAHYMFGIEQRIVNRSAQPVSLYPYARVDRAYTPT 195

Query: 210 ATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHES------NSWLGISDKYWASVF 263
            T  + V EG I+V+ D  L E  Y  +   +    + S        W GI+DKYW +  
Sbjct: 196 ETGGYLVHEGPISVI-DGRLDESSYKSLRTGATPPGNLSWTKGGQGGWAGITDKYWLTAV 254

Query: 264 IPSKETSFHSQFKYLSDGHAR-YQAKFSANEITIL-PGKSITTTNFLFAGAKEFPTIHHY 321
           IP + T+    + Y ++G A  YQ  F A   T++ PG +  T + +FAGAKE   +  Y
Sbjct: 255 IPQQGTAVTGSYGYQANGGAGVYQVGFIAQAATVVAPGTTGATVSHVFAGAKEVNLLEQY 314

Query: 322 EKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKK 381
           +  L IP F   +D+GWF F+ +P+F ++ +   L+GNFG+A+M  T+ VK LFFPLA +
Sbjct: 315 QSSLHIPDFWKAVDFGWFAFLTRPIFYVLDWLNTLLGNFGLALMAFTLLVKALFFPLATR 374

Query: 382 QYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFF 441
           Q+ S A M+ +QPK+ ELRE++K S    L + M+ LYK   +NP AGC P+++QIPVF+
Sbjct: 375 QFRSMAKMRQLQPKVQELRERYK-SDQMALNQNMMALYKAEGVNPAAGCLPMVVQIPVFW 433

Query: 442 AIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPF---YLPGFMHVGIWPIIMS 498
           ++YK + I++EMRHAPF+GWI DL+A D TN+F LFG++P+    L  ++ +G+WPI+  
Sbjct: 434 SLYKDLYITIEMRHAPFFGWIHDLSAPDLTNLFNLFGLIPWDPNVLSPYLQLGVWPILFG 493

Query: 499 LSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
            +MF+Q K++P P D  Q  +   MPV+F F ++  PAGL+IY+ W+N++++ QQ VI +
Sbjct: 494 ATMFLQQKLNPAPTDPAQQRMFQMMPVLFTFFMARQPAGLVIYYCWNNLLTVAQQMVIQR 553


>gi|58578983|ref|YP_197195.1| putative inner membrane protein translocase component YidC
           [Ehrlichia ruminantium str. Welgevonden]
 gi|58417609|emb|CAI26813.1| 60 kD inner-membrane protein [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 575

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 225/586 (38%), Positives = 343/586 (58%), Gaps = 45/586 (7%)

Query: 6   NYFVAIALSVIIVYAW----QNFYVYPRIEE------MNNERKNIQTVKQPNQVDNSYAA 55
           N   A+ LSV+I+  W    + F+    + E      M  E  N+ T +  N+       
Sbjct: 6   NLVFAVVLSVLIMMGWRLVYEKFFTVQHVVEDEDSSSMIPEIDNVLTYRSRNE------- 58

Query: 56  VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSN 115
             I D  Q L    RV+L N  + GSI LKGAQ DDL  + YH+   S+S  + LLSP N
Sbjct: 59  --IIDSTQNL----RVKLSNKEINGSILLKGAQLDDLVFKNYHITPDSSSDGIILLSPEN 112

Query: 116 TKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD 175
           T+  YF E  ++   + I +PN  + W      +L+P   + L + N   ++F+  ++LD
Sbjct: 113 TEGVYFIEFGWIDPQHKIVVPNQLSTWTS-DKSVLSPNNTVTLTWDNQQGVIFQIKVTLD 171

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
           ++Y+FKI   + NN+ + +   P GRI R +  T  + +   EG +   G  +L E  Y 
Sbjct: 172 DYYMFKIEQIIINNTDNVVNLIPYGRINRARHTTEKSYWISHEGAVGSFG-YTLKEWTYK 230

Query: 236 DIEKS---SISNFH-ESNSWLGISDKYWASVFIPS-----KETSFHSQF-KYLSDGHARY 285
           +I K     IS  + + N W+GI+DKYW +  IP+      + SFH +  KY  +   R+
Sbjct: 231 NIIKERNIKISQQNTDDNQWVGIADKYWFTALIPNILQKKSKLSFHVKHGKY--NNEDRF 288

Query: 286 QAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKP 345
           Q  FS +  +  P K+ ++T++LFAGAKE   +  Y+KDL I  F+  +D+G  YFI KP
Sbjct: 289 QVDFSHDSYSAYPNKTASSTSYLFAGAKELKLLDKYKKDLNISLFDKAVDFGILYFITKP 348

Query: 346 MFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQ 405
           +F+L+ YFY+L+GNFG+AI+L T+ +KL+ FPL+ K YVS   +K +QP+I +++E +K 
Sbjct: 349 VFLLLEYFYDLIGNFGLAILLLTIVIKLIMFPLSYKSYVSMFKLKYLQPEILKIKELYKN 408

Query: 406 SPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDL 465
              + + K +  L+K ++++P++G  PIL+QIPVFFA+YKV+ +++EMRHAPF+ W+KDL
Sbjct: 409 DNTK-MSKEVSLLFKKNDVSPMSGFIPILIQIPVFFALYKVLFVTIEMRHAPFYLWVKDL 467

Query: 466 AAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKM-----SPPPADKGQAMIL 520
           +  D  N+ TLFG+L F  P  + +GI P+I+ ++M IQ KM     S    DK QA  +
Sbjct: 468 SNFDTANVLTLFGLLNFNPP--ICIGILPVILGITMIIQQKMNTSTHSSQDQDKIQASFI 525

Query: 521 NWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGL 566
            ++P VF+F  SSFP GLIIYW  SN I+I+QQ +I    G +  L
Sbjct: 526 KFLPYVFIFIFSSFPTGLIIYWICSNSITIIQQLIIKAYIGRKFNL 571


>gi|58617041|ref|YP_196240.1| putative inner membrane protein translocase component YidC
           [Ehrlichia ruminantium str. Gardel]
 gi|58416653|emb|CAI27766.1| 60 kD inner-membrane protein [Ehrlichia ruminantium str. Gardel]
          Length = 575

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 224/586 (38%), Positives = 344/586 (58%), Gaps = 45/586 (7%)

Query: 6   NYFVAIALSVIIVYAW----QNFYVYPRIEE------MNNERKNIQTVKQPNQVDNSYAA 55
           N   A+ LSV+I+  W    + F+    + E      M  E  N+ T +  N+       
Sbjct: 6   NLVFAVVLSVLIMMGWRLVYEKFFTVQHVVEDEDSSSMIPEIDNVLTYRSRNE------- 58

Query: 56  VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSN 115
             I D  Q L    RV+L N  + GSI+LKGAQ DDL  + YH+   ++S  + LLSP N
Sbjct: 59  --IIDSTQNL----RVKLSNKEINGSISLKGAQLDDLVFKNYHITPDNSSDGIILLSPEN 112

Query: 116 TKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD 175
           T+  YF E  ++   + I +PN  + W      +L+P   + L + N   ++F+  ++LD
Sbjct: 113 TEGVYFIEFGWIDPQHKIVVPNQLSTWTS-DKSVLSPNNTVTLTWNNQQGVIFQIKVTLD 171

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
           ++Y+FKI   + NN+ + +   P GRI R +  T  + +   EG +   G  +L E  Y 
Sbjct: 172 DYYMFKIEQIIINNTDNVVNLIPYGRINRARHTTEKSYWISHEGAVGSFG-YTLKEWTYK 230

Query: 236 DIEKS---SISNFH-ESNSWLGISDKYWASVFIPS-----KETSFHSQF-KYLSDGHARY 285
           +I K     IS  + + N W+GI+DKYW +  IP+      + SFH +  KY  +   R+
Sbjct: 231 NIIKERNIKISQQNTDDNQWVGIADKYWFTALIPNILQKKSKLSFHVKHGKY--NNEDRF 288

Query: 286 QAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKP 345
           Q  FS +  +  P K+ ++T++LFAGAKE   +  Y+KDL I  F+  +D+G  YFI KP
Sbjct: 289 QVDFSHDSYSAYPNKTASSTSYLFAGAKELKLLDKYKKDLNISLFDKAVDFGILYFITKP 348

Query: 346 MFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQ 405
           +F+L+ YFY+L+GNFG+AI+L T+ +KL+ FPL+ K YVS   +K +QP+I +++E +K 
Sbjct: 349 VFLLLEYFYDLIGNFGLAILLLTIVIKLIMFPLSYKSYVSMFKLKYLQPEILKIKELYKN 408

Query: 406 SPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDL 465
              + + K +  L+K ++++P++G  PIL+QIPVFFA+YKV+ +++EMRHAPF+ W+KDL
Sbjct: 409 DNTK-MSKEVSLLFKKNDVSPMSGFIPILIQIPVFFALYKVLFVTIEMRHAPFYLWVKDL 467

Query: 466 AAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKM-----SPPPADKGQAMIL 520
           +  D  N+ TLFG+L F  P  + +GI P+I+ ++M IQ KM     S    DK QA  +
Sbjct: 468 SNFDTANVLTLFGLLNFNPP--ICIGILPVILGITMIIQQKMNTSTHSSQDQDKIQASFI 525

Query: 521 NWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGL 566
            ++P VF+F  SSFP GLIIYW  SN I+I+QQ +I    G +  L
Sbjct: 526 KFLPYVFIFIFSSFPTGLIIYWICSNSITIIQQLIIKAYIGRKFNL 571


>gi|254439216|ref|ZP_05052710.1| 60Kd inner membrane protein [Octadecabacter antarcticus 307]
 gi|198254662|gb|EDY78976.1| 60Kd inner membrane protein [Octadecabacter antarcticus 307]
          Length = 590

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 205/575 (35%), Positives = 327/575 (56%), Gaps = 20/575 (3%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEE----MNNERKNIQTVKQPNQVDNSYAAVL 57
           ++N N  +A ALS I++  W   +  P + E          +  T+    QV    A + 
Sbjct: 3   DQNKNLILATALSFIVILIWFVLFPPPDVTEPAPTAEVTSTDGTTLGVDAQVPTQVAVLP 62

Query: 58  IDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTK 117
                 A++ +PR+ + + +L GS++L G + DDL+L+ Y + + S++ +V LLSP  T+
Sbjct: 63  PLSAEDAIADAPRIMIDSENLTGSLSLTGGRIDDLSLKDYRVTLDSDADLVRLLSPIGTE 122

Query: 118 NAYFAELDYVST--ANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD 175
             Y+A   +V+   A   ++P ++T W L SG  L P + I L++ N   + F +T ++D
Sbjct: 123 APYYALNGWVAAVGATADQVPGASTQWQLESGDTLEPGSDITLIWDNGAGLTFRKTFAVD 182

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
           E++LF +  TV N++  +I   P G + RH        F   EG +  + D S+ E  Y 
Sbjct: 183 ENFLFTVTQTVENSTGAEIALRPYGLVARHGEPDQIGFFIQHEGVVR-MSDGSMEEINYG 241

Query: 236 DIEKSSISNFH---ESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSAN 292
           D+   +        E N W+G SD+YW +  IP+    F S  K+ ++    YQ +    
Sbjct: 242 DMPDLTSDEGRIEVEENGWIGFSDQYWMTALIPTPGRDFRSTAKFANN---IYQIETVYP 298

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
             T+  G + +     FAGA+E+  I  Y+ DL I RF   IDWGWF+F+ KP+F ++ +
Sbjct: 299 LTTVASGATASAETQFFAGAQEWVVIRSYQDDLGIDRFLDSIDWGWFFFLTKPIFAVLHW 358

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
              L+GN G +I+  T  +K L  PLA K YVS A M+ +QP++ +L+E       + LQ
Sbjct: 359 LNGLIGNMGWSIICLTFVIKALLLPLAYKSYVSMAKMRELQPEMAKLKEAAGDDR-EKLQ 417

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           K M+ LYK + +NP +GC PIL+QIP+FF++YKVI +++E+RHAP+ GWI DL+A D + 
Sbjct: 418 KGMMSLYKENKVNPASGCLPILMQIPIFFSLYKVIFVTIELRHAPWIGWINDLSAPDTST 477

Query: 473 IFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVV 526
           ++ LFG+LP+  P        + +G+ PI++ +SM++Q K++P P D  Q MI  WMP V
Sbjct: 478 LYNLFGLLPWGAPAPDSILALVFIGVMPIVLGISMWLQQKLNPAPTDPTQKMIFAWMPWV 537

Query: 527 FVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHG 561
           F+F L SF +GL++YW  +N I+ +QQ  IM+  G
Sbjct: 538 FMFMLGSFASGLVLYWIANNTITFMQQYAIMRSQG 572


>gi|56695446|ref|YP_165794.1| putative inner membrane protein translocase component YidC
           [Ruegeria pomeroyi DSS-3]
 gi|81676422|sp|Q5LW11|OXAA_SILPO RecName: Full=Inner membrane protein oxaA
 gi|56677183|gb|AAV93849.1| inner membrane protein YidC, putative [Ruegeria pomeroyi DSS-3]
          Length = 609

 Score =  388 bits (997), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 218/611 (35%), Positives = 350/611 (57%), Gaps = 39/611 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQT-----VKQPNQVDNSYAAV 56
           ++N N  +A ALS +++  W  F ++P  E+       I T     V+ P        A 
Sbjct: 3   DQNKNLILATALSFLVILVW--FILFPPPEQTEAPATEIATTNGTAVQTPTAAATEGGAG 60

Query: 57  ---LIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSP 113
               +D  A   + +PRV++  P L GS++L G + D+L+L+ Y + +  ++ IV +L+P
Sbjct: 61  EVPALDSAAPTQAEAPRVQIDTPRLKGSVSLLGGRIDELSLKDYRVSLDEDAEIVEMLTP 120

Query: 114 SNTKNAYFAELDYVSTA--NNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERT 171
           + + +AY+A   +   A  N  ++P   T W+L SG  L+  TP+ L + N + + F RT
Sbjct: 121 AGSTSAYYALYGWAPGAGLNAADVPGPLTEWSLESGDTLSVGTPVTLSWSNGSGVTFRRT 180

Query: 172 ISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQ------EGFIAVLG 225
           +++DE Y+F +  +V N S   I  +P G + RH      +  G++      EG +A + 
Sbjct: 181 LAVDEDYMFTVTQSVENGSAAPIGAAPYGILARHGIGEDADLPGLKNFFILHEGVVA-MN 239

Query: 226 DKSLVEQKYSDIEKSSISN---------FHESNSWLGISDKYWASVFIPSKETSFHSQFK 276
           D +L E  Y D+ K  I            ++S+ W+G +D YW +  IP   T+F S  K
Sbjct: 240 DGTLSEIDYKDVRKFDIDPNEGAQAEVFQNKSDGWIGFTDHYWMATLIPGSGTAFKSAAK 299

Query: 277 YLSDGHAR-YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLID 335
           Y  D   + YQA+     +++ PG+S   T  LFAGAKE+ +I  Y++D  + +F   ID
Sbjct: 300 Y--DARRKIYQAETVLPTMSVAPGESAEVTTRLFAGAKEWESIRAYQQD-GVQKFLDSID 356

Query: 336 WGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPK 395
           WGWF+F+ KP+F L+     L+GN G +I+  T+ +K + FPLA K YVS A MK +QP+
Sbjct: 357 WGWFFFLTKPIFWLLHQINGLIGNMGWSIIGLTLIIKAIVFPLALKSYVSMAKMKELQPQ 416

Query: 396 IDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRH 455
           ++ L+E       Q +Q+ M++LYK   +NP AGC PILLQIP+FF++YKVI +++E+R 
Sbjct: 417 MEALKEAAGDDR-QKMQQGMMELYKKEKVNPAAGCLPILLQIPIFFSLYKVIFVTIELRQ 475

Query: 456 APFWGWIKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSP 509
           AP++G  +DL+  DPT+I   FG LP+  P        + +GI P+++ +SM++Q K++P
Sbjct: 476 APWFGPFRDLSMPDPTSIMNFFGWLPWAGPEAGSLTATILIGILPLLLGISMWLQQKLNP 535

Query: 510 PPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDR 569
            P D  QAMI  WMP VF+F L SF +GL++YW  +N I+  QQ +IM+ HG +  +   
Sbjct: 536 APTDPTQAMIFAWMPWVFMFMLGSFASGLVVYWIANNTITFTQQYIIMRSHGYKPDVFGN 595

Query: 570 LRSTFSKNYNS 580
           ++S F++   +
Sbjct: 596 IKSGFARRAKA 606


>gi|304322173|ref|YP_003855816.1| 60 kDa inner membrane insertion protein [Parvularcula bermudensis
           HTCC2503]
 gi|303301075|gb|ADM10674.1| 60 kDa inner membrane insertion protein [Parvularcula bermudensis
           HTCC2503]
          Length = 589

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 200/591 (33%), Positives = 337/591 (57%), Gaps = 26/591 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLID- 59
           M+RN    +A+ LS ++++ ++   + P+       ++  Q +    Q+D + A      
Sbjct: 1   MDRN--VIIALVLSTLLLFGYEALVLGPKRAAYLEAQEKAQAIAA-EQMDPADAGETFLP 57

Query: 60  ------DRAQALSM-SPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLS 112
                  R QAL+  + R+ ++ P+L GS+NL+G  FDDL L+ Y   ++++SP + LLS
Sbjct: 58  GTERSLSREQALAEGTARLPIETPTLSGSVNLEGLLFDDLILKTYRATLAADSPPIVLLS 117

Query: 113 PSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTI 172
           P       F     +S      + +    W    G +LTP TP+ +V +   +I +  T+
Sbjct: 118 PRTATTPQFMRAG-LSIGG---VSDRTARWQAPEGAVLTPKTPV-IVTRQEGDIQYRATL 172

Query: 173 SLDEHYLFKIVDTVTNNSIDQIRFSPRGRI-MRHKPQTATNTFGVQEGFIAVLGDKSLVE 231
           ++DE ++F++   VTN S + +   P G    R  P    N   + EG I V+ D  L++
Sbjct: 173 AVDEQFMFRVTYEVTNGSGETVVAQPYGAAYQRGIPADLQNFMILFEGPIGVV-DHRLMD 231

Query: 232 QKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSA 291
           +KY  +          S  W+GI+DKYW S  IP ++T F ++          ++A +  
Sbjct: 232 RKYKKLLSGGGIEDRGSGGWVGITDKYWLSAAIPPQDTPFKAELDVTDGAIPLFRASYLL 291

Query: 292 NEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMS 351
              +I PG +I T  +L+ G+KE   +  Y+  L I RF   +DWG F F+ +P+F +++
Sbjct: 292 ETQSIAPGATIRTEAYLYGGSKEVEVLRMYQDQLGIDRFVWAVDWGHFSFLTRPIFGILA 351

Query: 352 YFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVL 411
           +F  L GN+G+AI+L T+ +K + FPLA   Y S A MK +QP++ ++RE++     +  
Sbjct: 352 FFEGLTGNWGVAILLLTLVIKAVLFPLANMSYKSMAGMKKVQPELMKIRERYTDDKTKQ- 410

Query: 412 QKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPT 471
           Q+ M+ LYK H INP AGC P+L Q+P+F+A+YK + +++E+RH PF  +I DL+  DPT
Sbjct: 411 QQEMMALYKKHKINPAAGCLPVLAQMPIFYALYKTLFVTIELRHEPFL-YIPDLSEQDPT 469

Query: 472 NIFTLFGILPF------YLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPV 525
           ++F LFG+LPF       +  F+ +GI P++M  +MF+Q+K++PPP D  Q MI   MP+
Sbjct: 470 SVFNLFGLLPFDPTTVPLIGSFLGIGILPLLMGAAMFVQLKLNPPPPDPTQRMIFGLMPL 529

Query: 526 VFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSK 576
           +F+F  + F AGL++YW W+  +S++QQ +IMK  GA++ ++  ++ +F K
Sbjct: 530 IFMFIFAPFAAGLVLYWFWNTFLSVIQQYIIMKRQGADVDILGNIKQSFGK 580


>gi|163745583|ref|ZP_02152943.1| putative inner membrane protein translocase component YidC
           [Oceanibulbus indolifex HEL-45]
 gi|161382401|gb|EDQ06810.1| putative inner membrane protein translocase component YidC
           [Oceanibulbus indolifex HEL-45]
          Length = 623

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 213/610 (34%), Positives = 340/610 (55%), Gaps = 42/610 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIE---------EMNNERKNIQTVKQPNQV--- 49
           E+N N  +A ALS  ++  W  F ++P  E         EM+           P      
Sbjct: 3   EQNKNLILATALSFAVILVW--FLLFPPPEADPALENSVEMSQAEDGTSVPASPADTAAA 60

Query: 50  ---DNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSP 106
              DN   A     RA AL+ +PRV +    + GSI+L G + DDL L  Y   +  N+ 
Sbjct: 61  PGTDNGEGAAPQGRRA-ALADAPRVAIATDKVSGSISLMGGRIDDLKLNDYQTTLDENAE 119

Query: 107 IVTLLSPSNTKNAYFAELDYVSTANNI--ELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           +VTLLSP  + +AY+A   + + +      +P  +T+W L  G+ L   +P+ L + N  
Sbjct: 120 VVTLLSPEGSSDAYYALHGWAAGSGLAPDAVPGVDTLWTLSEGETLGVDSPVTLSWDNGA 179

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHK-PQTATNTFGVQEGFIAV 223
             +F RTIS+D  Y+F I  +VTNN    +  +P G I +H  P+   + F + EG ++ 
Sbjct: 180 GQIFNRTISVDNEYMFDITQSVTNNGDAPVNLAPFGMIAQHGLPEDLKSFFILHEGAVS- 238

Query: 224 LGDKSLVEQKYSDIEKSSISNF---------HESNSWLGISDKYWASVFIPSKETSFHSQ 274
           + +  L E  + DI ++ +++            +  W+G +D YW +V IP    +F   
Sbjct: 239 MANGELSEIDWDDIAEADVNSTWGRPAVVTEGVTEGWVGFTDHYWQAVLIPGAGEAFEQA 298

Query: 275 FKYLSDGHA-RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEML 333
             Y  D  A  Y+A       ++  G+S+++++  FAGAKE+ T+  Y+    + +F   
Sbjct: 299 LTY--DPRADTYRAFTRQPTRSVAAGESVSSSSKFFAGAKEWETLQDYQS-AGVAKFIDS 355

Query: 334 IDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQ 393
           IDWGWF+F+ KP+F L+     L+GN G+AI+  T+ +K L FPLA K YVS A MK +Q
Sbjct: 356 IDWGWFFFLTKPIFWLLHNLNQLIGNMGVAIIGLTLLIKALLFPLAYKSYVSMARMKELQ 415

Query: 394 PKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEM 453
           P++++L+++      Q +Q+ M++LYK + +NP AGC PIL+QIP+FF++YKVI +++E+
Sbjct: 416 PEMEKLKKEAGDDR-QKMQQGMMELYKKNKVNPAAGCLPILMQIPIFFSLYKVIFVTIEL 474

Query: 454 RHAPFWGWIKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKM 507
           RHAPF+G  +DL++ DPT+I  L+G+LP+  P        + +GI P+++ +SMF+Q K+
Sbjct: 475 RHAPFFGPFQDLSSPDPTSIMNLWGLLPYAAPEPGSMLALVFIGILPLLLGISMFLQQKL 534

Query: 508 SPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLI 567
           +P P D  Q MI  WMP VF+F L  F +GL++YW  +N I+  QQ +IM+  G +  L 
Sbjct: 535 NPAPTDPTQQMIFAWMPWVFMFMLGGFASGLVVYWIANNTITFTQQYLIMRSQGYKPDLW 594

Query: 568 DRLRSTFSKN 577
             +   F + 
Sbjct: 595 GNIAGGFKRT 604


>gi|329848429|ref|ZP_08263457.1| membrane protein insertase, YidC/Oxa1 family, N-terminal
           domain-containing protein [Asticcacaulis biprosthecum
           C19]
 gi|328843492|gb|EGF93061.1| membrane protein insertase, YidC/Oxa1 family, N-terminal
           domain-containing protein [Asticcacaulis biprosthecum
           C19]
          Length = 624

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 216/595 (36%), Positives = 330/595 (55%), Gaps = 45/595 (7%)

Query: 3   RNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSY------AAV 56
           RN  YF  +  S+++++ +Q F   P+ ++   +R         +             A 
Sbjct: 9   RNMIYF--LIASMVLLFGYQYFVTGPQQKKAQEQRAVAAAQASASSSSAVAAGLPVTGAA 66

Query: 57  LIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNT 116
            +  R QA++ +PRV++  PSL GS++LKGA  DDL L+ Y     + SP V LL P+ +
Sbjct: 67  AVMTREQAIAAAPRVKIDTPSLRGSLSLKGALVDDLYLKSYKETTKAGSPDVELLRPAGS 126

Query: 117 KNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE 176
             AY+ +  Y+   N   LP++NT+WNL SG +L+P  P+ L   N   ++F RT+S+D+
Sbjct: 127 DRAYYVQSGYIGQ-NIPGLPDANTMWNLQSGNVLSPGKPVVLTHDNGAGLMFTRTLSIDD 185

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHK-PQTATNTFGVQEGFIAVLGDKSLVEQ--- 232
           +Y+  + + V N     + FSP   ++R   P     T  V EG IA   +K    +   
Sbjct: 186 NYMITVAEAVANTGAGPVAFSPYSTVIRFDMPAGLDRTGVVHEGAIATFPNKIEAGKIDR 245

Query: 233 ------KYSDI----EKSSISNFHESNSWLGISDKYWASVFIPSKE--TSFHSQFKYLSD 280
                 KY D+    EK    +      W G++DKYW +  IP+++    F +Q   + +
Sbjct: 246 YKTQSLKYKDMAKEPEKKVFKDVASVGGWFGLTDKYWMAAVIPAQDQPVRFTTQAN-VQN 304

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
               Y+A +    +T+ PG++  + + +FAGAK    +  YE DL IPRF    DWG   
Sbjct: 305 NKPIYRAGYLDETVTVAPGQTWQSQSHIFAGAKLNSQLQAYENDLKIPRFGYATDWGSLQ 364

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQ----PKI 396
           F+  PM+ L+   Y  +GNFG AI+  TV VK++F+PLA K Y S   MK +Q    PK+
Sbjct: 365 FLTYPMYWLLDKLYGFLGNFGFAILALTVIVKIVFYPLAHKAYESMTKMKQVQDRLKPKL 424

Query: 397 DELREKFKQSPPQVLQKAMIQLYKTHNINPLA---GCWPILLQIPVFFAIYKVISISLEM 453
           D ++ +F    PQ  Q+A ++LY+   +NP+A   GC P+LLQIPVF+A+YKV+ +++EM
Sbjct: 425 DAIKSRFPDD-PQKQQEATMKLYQDEKVNPMAGLGGCLPMLLQIPVFWALYKVLILAIEM 483

Query: 454 RHAPFWGWIKDLAAADPTNIFTLFGILPF----------YLPGFMHVGIWPIIMSLSMFI 503
           RHAPF+GWIKDL+A DPT+   LFG+LPF           L G +H+G+  I+  LSM++
Sbjct: 484 RHAPFFGWIKDLSAPDPTSFVNLFGLLPFEPATVPLIGGILAGPLHLGVVAILYGLSMWL 543

Query: 504 QMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIM 557
             +M+P    D  Q  +L +MPV+  F ++    GLIIYW WSN+++I QQ  IM
Sbjct: 544 SQQMTPTANVDPMQKKMLAFMPVILTFFMAQVAVGLIIYWIWSNILTIFQQWTIM 598


>gi|149913108|ref|ZP_01901642.1| 60 kDa inner membrane insertion protein [Roseobacter sp. AzwK-3b]
 gi|149813514|gb|EDM73340.1| 60 kDa inner membrane insertion protein [Roseobacter sp. AzwK-3b]
          Length = 604

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 228/614 (37%), Positives = 347/614 (56%), Gaps = 48/614 (7%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
           ++N N  +A ALS +++  W  F ++P  E     +++  T +  +QVD S  A L    
Sbjct: 3   DQNKNLILATALSFVVILVW--FVLFPPPEP---PQQDATTPEAASQVDGSATAPLTATA 57

Query: 62  AQALSMSP------------RVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVT 109
               + +             RV +  PSL GSI+LKG + D L+L+ Y   +   S  VT
Sbjct: 58  PATGATAGTPAPEAEEPEAPRVAISTPSLDGSISLKGGRIDQLSLKNYRETLEPGSDTVT 117

Query: 110 LLSPSNTKNAYFAELDYVS----TANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANN 165
           LLSP  T +AY+A   +      TA  +  P +NTVW + SG  L+P TP+ LV+ N   
Sbjct: 118 LLSPIGTDSAYYALFGWAPGQGLTAETV--PGANTVWKVESGDQLSPETPVTLVWDNQQG 175

Query: 166 ILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVL 224
           + F R IS+D+ ++F +  +V N   D    +P G + RH +P    N F + EG I ++
Sbjct: 176 LTFRREISVDDKFMFTVTQSVENTGADTPSLAPYGILARHGEPVDLKNFFILHEGGIRMV 235

Query: 225 GDKSLVEQKYSDIEKSSISNFHES-----NSWLGISDKYWASVFIPSKETSFHSQFKYLS 279
            D  L E  Y D E +S    HE+     + W G +D YW +  IPS   +  + F+   
Sbjct: 236 -DGQLSEIDYDDFEPAS---NHETLTVNESGWTGFTDHYWMTTLIPSMAGAQVTTFQ--D 289

Query: 280 DGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWF 339
                YQ     N  T+ PG+S T T  LFAGAKE+ TI +Y+ +  I RF   IDWGWF
Sbjct: 290 TRRNIYQTTVRKNTETVAPGQSATVTTRLFAGAKEWETIRNYQNEDGIDRFLDSIDWGWF 349

Query: 340 YFIAKPMFMLMSYF------YNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQ 393
           +F+ KP+F ++ +         + G+ G AI+  T+ +K L  PLA K YVS A MK +Q
Sbjct: 350 FFLTKPIFAVLHWLNVTLAGMGIAGSMGWAIIGLTLLIKALLLPLAYKSYVSMAKMKELQ 409

Query: 394 PKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEM 453
           P++++++E       Q LQK MI+LYK   +NP +GC PILLQIP+FF++YKVI ++LE+
Sbjct: 410 PQMEKIKESAGNDR-QKLQKEMIELYKKEKVNPASGCLPILLQIPIFFSLYKVIFVTLEL 468

Query: 454 RHAPFWGWIKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKM 507
           RHAP+ GWI DL+A DP++++ L+GILP+  P        + +GI P+++ +SM++Q K+
Sbjct: 469 RHAPWIGWIDDLSAPDPSSLYNLWGILPWAAPEPGSIIALIFIGILPLLLGISMWLQQKL 528

Query: 508 SPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLI 567
           +P P D  Q MI  WMP VF+F L SF +GL++YW  +N+I+  QQ +IM+  G +  ++
Sbjct: 529 NPAPTDPTQQMIFAWMPWVFMFMLGSFASGLVVYWIANNMITFAQQYLIMRSQGYKPDVL 588

Query: 568 DRLRSTFSKNYNSQ 581
             + S+  +   ++
Sbjct: 589 GNILSSMKRKPKTE 602


>gi|190570482|ref|YP_001974840.1| 60 kDa inner-membrane protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019241|ref|ZP_03335048.1| 60 kDa inner-membrane protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190356754|emb|CAQ54113.1| 60 kDa inner-membrane protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995350|gb|EEB55991.1| 60 kDa inner-membrane protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 569

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 219/573 (38%), Positives = 344/573 (60%), Gaps = 18/573 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M    N  +A  LS++I+  W    +Y      +  + +I+ ++   +  N  A ++  +
Sbjct: 1   MSEAKNLILATILSILIIVLWH--IIYDNFLNTSQSQPSIENIEHI-ESSNDLAPMIYQN 57

Query: 61  RAQAL--SMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
           R++ +  +   RV L N  L GSI+LKGA+FDDL L  YHL+ SS+SP V LLSP+ +K+
Sbjct: 58  RSEIINSTREQRVNLTNNMLEGSISLKGARFDDLILTNYHLEPSSSSPQVVLLSPAESKD 117

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHY 178
            YFAE  ++     I++P+S TVW   + K+      + L + N N ILF   ISLD++Y
Sbjct: 118 VYFAEFGWLDPNEKIKVPDSKTVWQ--ADKL--NQKEVNLFWDNENGILFRMKISLDDNY 173

Query: 179 LFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIE 238
           +FK+   + NN+ D +   P G+I R +     + +   EG +    +K L E  Y DI 
Sbjct: 174 MFKVEQIIENNTKDNVVLVPYGKINRKRDNINESYWISHEGVLGAFNNK-LEEWTYKDIS 232

Query: 239 KSSISNFHESN-SWLGISDKYWASVFIPSKETSFHSQFKYLS-DGHARYQAKFSANEITI 296
           K  +     S  SW G +DKYW +  IP K    +   K+ + +   ++Q  F      I
Sbjct: 233 KKRLIKASTSEKSWFGFADKYWFTAIIPEKSDQINVSIKHTNVNNIDKFQVDFVKPYKHI 292

Query: 297 LPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNL 356
           LPG S++T N+ FAGAK+   +  Y+  L IP F+  +D+G  YFI KP+F+L+ YF  +
Sbjct: 293 LPGASVSTLNYFFAGAKKLNLLDSYKDTLNIPLFDKAVDFGVLYFITKPVFLLLEYFNFV 352

Query: 357 VGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMI 416
           + NFG+AI+L T+ +KLL  PL+ + Y+S   +K++QP++  ++E +K    +   K  I
Sbjct: 353 LKNFGLAILLLTLVIKLLMLPLSNRSYISMFKVKSLQPELTRIKELYKNDSLKQ-HKETI 411

Query: 417 QLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTL 476
            L+K +N+NP++  +P+L+QIPVFFA+YKV+ +++EMRHAPF+ WIKDL+A+DPTNIFTL
Sbjct: 412 ALFKRNNVNPMSSIFPMLIQIPVFFALYKVLFVTIEMRHAPFYLWIKDLSASDPTNIFTL 471

Query: 477 FGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPP---PADKGQAMILNWMPVVFVFALSS 533
           FG+  +  P  + +GI PII   +M IQ K+S       D  Q  ++ ++P + VF  SS
Sbjct: 472 FGLFNYNFP--ISIGILPIIFGATMIIQQKLSEKDQTSKDDIQVNVMKFLPYISVFIFSS 529

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGL 566
           FPAGL+IYW +SN+I++VQQ++I  +   ++G+
Sbjct: 530 FPAGLVIYWIFSNIITLVQQSLIKLLLTRKVGM 562


>gi|148261132|ref|YP_001235259.1| 60 kDa inner membrane insertion protein [Acidiphilium cryptum JF-5]
 gi|326404533|ref|YP_004284615.1| inner membrane protein OxaA [Acidiphilium multivorum AIU301]
 gi|166975846|sp|A5G0F8|OXAA_ACICJ RecName: Full=Inner membrane protein oxaA
 gi|146402813|gb|ABQ31340.1| protein translocase subunit yidC [Acidiphilium cryptum JF-5]
 gi|325051395|dbj|BAJ81733.1| inner membrane protein OxaA [Acidiphilium multivorum AIU301]
          Length = 601

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 200/511 (39%), Positives = 299/511 (58%), Gaps = 23/511 (4%)

Query: 68  SPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDY- 126
            PR+ +  P L GS++L GA+ DDL L  YH  V   SP+V LLS + T  +Y+ +  + 
Sbjct: 78  GPRLAISTPLLRGSMSLVGARLDDLVLTRYHQTVKKTSPLVQLLSQAGTAKSYYVQFGWD 137

Query: 127 VSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTV 186
            +  +++++P  +TVW   SG  L+P  P+ L + N   + FE  +++D  YLF +   V
Sbjct: 138 AAPGSSLKVPGPDTVWT-SSGGDLSPAHPVTLSWNNGAGVTFELKLAVDRQYLFTVQQRV 196

Query: 187 TNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSI---- 242
            N+    +   P  RI R        +F + +G I V    +L E  Y  ++        
Sbjct: 197 INHGAAAVEVYPWSRIRRDFLPEEPGSFTLHKGPIGVF-HGTLHEMGYEGVKSGGKHPAA 255

Query: 243 -----SNFHESN--SWLGISDKYWASVFIPSKETSFHSQFKYLSD----GHARYQAKF-S 290
                + +  +N   W GI+ KYW +  IPS+       ++YL+D     H  YQ  + +
Sbjct: 256 GDAPGTAYQTTNLGGWAGITGKYWLTALIPSQGREVIGAYRYLADPGQPEHGGYQVDYMT 315

Query: 291 ANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLM 350
           A  +   PG + +TT  +FAGAK    + HYE    IP FE  ID+GWF+F+ KP+F+ +
Sbjct: 316 AKPVDAAPGATASTTTHVFAGAKVLSILSHYETQYRIPLFERAIDFGWFFFLTKPIFIAL 375

Query: 351 SYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQV 410
            Y   + GN G+AI++ T+ +KL+ FPL +  Y S A M+ I PK+  LRE++K    Q 
Sbjct: 376 DYLAGVFGNMGVAIIVFTIGLKLVLFPLVRTSYRSMARMRAITPKVQALRERYKDDQMQ- 434

Query: 411 LQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADP 470
            QK ++ LYK   +NP AGC P+L QIP+FF++YKVI IS+ MRHAPF  WI DL+A DP
Sbjct: 435 QQKEIMALYKAEGVNPAAGCLPMLPQIPIFFSLYKVIFISIGMRHAPFVLWIHDLSAEDP 494

Query: 471 TNIFTLFGILPFY---LPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVF 527
           TNIF LFG+LPF+   L  F+H+GI PIIM ++M+ Q +++PPP D  QA ++ +MPV+F
Sbjct: 495 TNIFNLFGLLPFHPSALSPFLHLGILPIIMGITMWGQQRLNPPPPDPTQAKMMQFMPVIF 554

Query: 528 VFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
            F L  F AGL++Y+  +N ++I+QQ  IM+
Sbjct: 555 TFMLGRFAAGLVLYYCVNNTLTILQQWTIMR 585


>gi|254460224|ref|ZP_05073640.1| 60 kDa inner membrane insertion protein [Rhodobacterales bacterium
           HTCC2083]
 gi|206676813|gb|EDZ41300.1| 60 kDa inner membrane insertion protein [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 601

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 215/614 (35%), Positives = 336/614 (54%), Gaps = 59/614 (9%)

Query: 2   ERNWNYFVAIALSVIIVYAW--------------------QNFYVYPRIEEMNNERKNIQ 41
           ++N N  +A ALS I++  W                    +   V P +   ++    + 
Sbjct: 3   DQNKNLILATALSFIVILVWFVLFPPPEPTPADPNAVISAEGDAVLPSVSAGDDADAGVN 62

Query: 42  TVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDV 101
           T           AA   ++  Q    +PR+ ++   L GSI+L G + D L L+ Y + +
Sbjct: 63  T-----------AAAQAEEPTQD---APRIAIETGRLKGSISLLGGRIDQLALKDYRVSL 108

Query: 102 SSNSPIVTLLSPSNTKNAYFAELDYVSTANNI--ELPNSNTVWNLISGKILTPTTPIKLV 159
             ++PIV LLSP   K+ Y+A   +   A     ++P  NT+W+  S   L+   P+ L 
Sbjct: 109 DDDAPIVDLLSPVGEKSPYYALYGWAPGAGLAFEQVPGPNTIWSAQSSGNLSVDAPVTLT 168

Query: 160 FKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQE 218
           + N N + F RTIS+DE+++F +  +V N     +  +P G + RH +PQ   N F + E
Sbjct: 169 WDNGNGLQFTRTISVDENFMFSVAQSVENTGAGTVSLAPYGILARHGEPQNLKNFFILHE 228

Query: 219 GFIAVLGDKSLVEQKYSDI----------EKSSISNFHESNSWLGISDKYWASVFIPSKE 268
           G +A + D  L E  YSD+           ++ ++   E   W+G +D+YW +  IP+  
Sbjct: 229 GVVA-MSDGELTEIDYSDMPDFDVNPNEGARAEVTQVAE-QGWVGFTDQYWMTTLIPAP- 285

Query: 269 TSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIP 328
            +F S  KY  D    YQ +       + PG + + T  LFAGAKE+ TI  YE    + 
Sbjct: 286 GAFKSTAKY-DDRRDIYQTEAVLPTQRLAPGATASATTQLFAGAKEWATIRDYET-AGVE 343

Query: 329 RFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTAN 388
            F   IDWGWF+F+ KP+F ++ Y   ++GN G AI+  T  +KL+ FPLA K  VS A 
Sbjct: 344 GFIDSIDWGWFFFLTKPIFAVLHYLNAMIGNMGWAIIGLTFLIKLILFPLAYKSNVSMAK 403

Query: 389 MKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVIS 448
           MK +QP++++++E       Q LQ+ M+ +YK   +NP +GC PIL+QIP+FF++YKVI 
Sbjct: 404 MKALQPQMEKIKESAGDDK-QKLQQDMMAMYKKEKVNPASGCLPILVQIPIFFSLYKVIF 462

Query: 449 ISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMF 502
           ++LE+RHAP+ GWIKDL+A DP++I  LFG+L F  P          +GI PI++ +SM+
Sbjct: 463 VTLELRHAPWIGWIKDLSAPDPSSILNLFGLLSFVPPEPGSILAIFSLGILPILLGISMW 522

Query: 503 IQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           +Q K++P P D  QAMI  WMP VF+F L +F +GL++YW  +N I+  QQ +IM+  G 
Sbjct: 523 MQQKLNPAPTDPTQAMIFAWMPWVFMFMLGTFASGLVVYWIANNTITFTQQYLIMRSQGV 582

Query: 563 EIGLIDRLRSTFSK 576
           +  +   +++ F +
Sbjct: 583 KPDVFGNIKAGFKR 596


>gi|254293247|ref|YP_003059270.1| hypothetical protein Hbal_0879 [Hirschia baltica ATCC 49814]
 gi|254041778|gb|ACT58573.1| 60 kDa inner membrane insertion protein [Hirschia baltica ATCC
           49814]
          Length = 600

 Score =  385 bits (988), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 215/596 (36%), Positives = 338/596 (56%), Gaps = 34/596 (5%)

Query: 6   NYFVAIALSVIIVYAWQNFYVY---------PRIEEMNNERKNIQTVKQPNQVDNSYAAV 56
           ++ + I L V+ V A   F+++          R+E          +V     VD + +A 
Sbjct: 10  SFMIGIGL-VLCVMALSQFFIWGPQQKAQEQARLEAQAQAAIAAPSVSS-GSVDTTASAA 67

Query: 57  LIDDRAQAL---SMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSP 113
            +D RA+ L   S   R++    S+ GSI+LKGA+ DDL+++  H +    +  V LLSP
Sbjct: 68  PVD-RAEILTDTSNGGRIDFDASSVDGSISLKGARLDDLSMK-RHFETIEKTEEVHLLSP 125

Query: 114 SNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTIS 173
             +K AY+A L +   A+   LP  +T+W   +G  LTP+TPI L ++    + F R I 
Sbjct: 126 QGSKGAYYAALGWRGDADR--LPGVSTLWKQTAGSTLTPSTPITLGYET-TQLSFSRKIE 182

Query: 174 LDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRH--KPQTATNTFGVQEGFIAVLGDKSLVE 231
           +D++Y+F   DTVTNNS + +   P G  MR    P      + + EG + + G+K L  
Sbjct: 183 VDDNYMFTYTDTVTNNSSETLSIRPFG-FMRQFGMPDDWKPFYILHEGAVGMAGNK-LKL 240

Query: 232 QKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDG-HARYQAKFS 290
           QKY +++K     +     W+G++ KYW + FIP++  +   Q K + DG    Y A   
Sbjct: 241 QKYKNLDKGKALAYTSQGGWIGLTQKYWMTAFIPAQTENVAVQSKVVMDGLRPTYVASIE 300

Query: 291 ANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDL----AIPRFEMLIDWGWFYFIAKPM 346
             +  I PG++ + +  +FAGAK    +  Y++      AIPRF   +DWG F+F  KP 
Sbjct: 301 GTDRAIEPGQTASYSQRIFAGAKRVEVLDAYQQGATGQEAIPRFTDAVDWGNFWFFTKPF 360

Query: 347 FMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQS 406
           F L+S+F +  GNFG+AI+  TV VKL FFP+  K Y S A M+ + P+++E+++K+   
Sbjct: 361 FWLLSHFNSWFGNFGLAILALTVIVKLAFFPIQNKAYASMAKMRKLMPQMEEIKKKWADD 420

Query: 407 PPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLA 466
             +  QK  ++LYK    NP +GC P++ Q+ VF+ +YK + ++LEMRH PF+GWIKDL+
Sbjct: 421 K-ERQQKETMELYKREKANPFSGCLPLIPQMFVFYGLYKTLFVTLEMRHEPFFGWIKDLS 479

Query: 467 AADPTNIFTLFGILPF---YLP--GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILN 521
           A DPT+   LFG LPF    LP  G + +G+ PI+   +M++   ++ PP D  Q M++ 
Sbjct: 480 APDPTSFLNLFGALPFDPSSLPLIGALSIGVLPILYGFTMWLLQNLNAPPPDPTQRMMMQ 539

Query: 522 WMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           ++P+VF F  + F AGL+IYW+WSN++SI QQ  IM+ +G E      +++ F K+
Sbjct: 540 FLPIVFTFIFAGFAAGLVIYWTWSNILSIAQQYYIMRKNGVETQFDKFIKAKFGKS 595


>gi|254421078|ref|ZP_05034802.1| 60Kd inner membrane protein [Brevundimonas sp. BAL3]
 gi|196187255|gb|EDX82231.1| 60Kd inner membrane protein [Brevundimonas sp. BAL3]
          Length = 599

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 211/536 (39%), Positives = 318/536 (59%), Gaps = 20/536 (3%)

Query: 56  VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSN 115
             + DR+QALS + RV +++ +L GS++L+G + DDL L  Y        P V L  P  
Sbjct: 63  TFVTDRSQALSTAARVPIQSGTLKGSLSLQGGRIDDLFLTDYKETQDKPEP-VELFRPQG 121

Query: 116 TKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD 175
            +NAYFA+  +        +P  NTVW L +G  LTPTTP+ L + N   + F R +S+D
Sbjct: 122 MQNAYFAQFGWTGPNVVGGVPGPNTVWRLTAGSTLTPTTPVTLTWDNGQGLRFTRLVSVD 181

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHK-PQTATNTFGVQEGFIAVLG---DKSLVE 231
           + Y+F I+DTV N     I  +P G + R   P  A ++  V EG I   G   D    +
Sbjct: 182 DRYVFSILDTVQNLGTQSITIAPYGSVQRQGVPPLAGSSHIVHEGAIGTFGKPGDYRTEQ 241

Query: 232 QKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLS-DGHARYQAKFS 290
           +KY D  K        +  WLGI+DKYW +  +P +  +  ++F+    +G  + +A   
Sbjct: 242 KKYKDWLKEPRIENASTGGWLGITDKYWLAALLPQQNEAVETEFRVRDVNGGQQLEANIL 301

Query: 291 ANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLM 350
               TI PG + T T  LFAG K    +  YE+ L +PRF   IDWG F+F+ +P+F ++
Sbjct: 302 GAARTIQPGGTATETQRLFAGVKRAEVLKTYEETLHLPRFVYAIDWGMFWFLTRPIFWIL 361

Query: 351 SYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQV 410
              Y LVG+FG+AI+  TV VKL+ FPLA   Y S + M+N+QPK++E+++KFK   PQ 
Sbjct: 362 ENVYGLVGSFGVAILALTVIVKLVMFPLANNAYASMSKMRNLQPKMEEIKKKFKDD-PQK 420

Query: 411 LQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADP 470
            Q+  + LY+   INP+AGC P++LQIPVF+A+YKV+++++EMRH PF G+I DL+A DP
Sbjct: 421 QQQETMALYQKEKINPVAGCLPLVLQIPVFYALYKVLTVTIEMRHQPFLGFIHDLSARDP 480

Query: 471 TNIFTLFGILPF----------YLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMIL 520
           + ++ LFG++P+           L G + +G+  +   L+M++Q  M+PP AD  Q  I 
Sbjct: 481 SVVWNLFGLIPWNPATLPLLGGLLVGPLGIGLLAVAYGLTMWLQTAMNPPAADPVQRQIF 540

Query: 521 NWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLID---RLRST 573
            +MP+VF F ++ F AGL++YW+WSN+++I+QQ  IM  + AE  + D   R+R T
Sbjct: 541 QFMPLVFTFIMAPFAAGLLVYWAWSNILTILQQYYIMHRYKAENPIDDFIARIRKT 596


>gi|255264683|ref|ZP_05344025.1| 60 kDa inner membrane insertion protein [Thalassiobium sp. R2A62]
 gi|255107018|gb|EET49692.1| 60 kDa inner membrane insertion protein [Thalassiobium sp. R2A62]
          Length = 601

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 210/600 (35%), Positives = 338/600 (56%), Gaps = 32/600 (5%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNN-----ERKNIQTVKQPNQVDNSYA-- 54
           ++N N  +A ALS +++  W  F ++P  E + +       ++I     P   D   A  
Sbjct: 3   DQNKNLILATALSFLVILVW--FVLFPPEEPVVDPITAETAQSIDGATVPT-ADTGIAPT 59

Query: 55  -AVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSP 113
                 ++    S +PR+ ++   L GSI+L G + DDL+L+ Y +++ +   +V LLSP
Sbjct: 60  TGEAEPEQEAEASDAPRIAIETEKLSGSISLLGGRLDDLSLKDYPIELDAEE-VVRLLSP 118

Query: 114 SNTKNAYFAELDYVSTANNIE--LPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERT 171
             T NAY+A   + +        +P  NT+W + SG  L  +  + L + N   + F R 
Sbjct: 119 VGTDNAYYALYGWAAAQGVAADAVPGPNTLWTVESGDTLNTSDAVTLAWDNGAGLTFRRE 178

Query: 172 ISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVE 231
           IS+DE Y+F I  +V N +  ++  +P G I RH        F + EG +  + D  L E
Sbjct: 179 ISVDEDYMFNITQSVENTTSTEVALAPYGFIARHGEPDTVGFFILHEGVVR-MSDGELQE 237

Query: 232 QKYSDIEKSSISNFHES---------NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGH 282
             Y+D+    I     +         N W+G +DKYW +  +P++ ++F S   Y +  +
Sbjct: 238 IDYNDMPDFDIDARRGAPAESIDVTENGWVGFTDKYWMTNIVPTQGSAFKSSAIY-NPRN 296

Query: 283 ARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFI 342
             YQ +      T+  G +   +  LFAGAKE+  I +Y+ D  I  F   IDWGWF+F+
Sbjct: 297 DIYQTEALMPTQTVAVGATAAVSTQLFAGAKEWEAIRNYQNDGGIDGFLDSIDWGWFFFL 356

Query: 343 AKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREK 402
            KP+F L+ +   ++GN G +I++ T+ +K +  PLA K YVS A MK +QP++++L+E 
Sbjct: 357 TKPIFALLHWLNGVIGNMGWSIIVLTLIIKAILLPLAYKSYVSMARMKELQPEMEKLKEA 416

Query: 403 FKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWI 462
                 Q LQ+ M++LYK + +NP +GC PILLQIP+FF++YKVI +++E+RHA + GWI
Sbjct: 417 -SGDDRQKLQQGMMKLYKDNKVNPASGCVPILLQIPIFFSLYKVIFVTIELRHAEWMGWI 475

Query: 463 KDLAAADPTNIFTLFGILPFYLPG------FMHVGIWPIIMSLSMFIQMKMSPPPADKGQ 516
           +DL+A DP++I  LFG+LPF  P        + +G+ PII+ +SM++Q K++P P D  Q
Sbjct: 476 RDLSAPDPSSILNLFGLLPFNTPESGSLLFILSLGVLPIILGISMWMQQKLNPAPTDPTQ 535

Query: 517 AMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSK 576
            MI  WMP VF+F L SF +GL++YW  +N I+  QQ +IM+  G +  +   +R++ S+
Sbjct: 536 KMIFAWMPWVFMFMLGSFASGLVLYWIANNTITFTQQYLIMRSQGVKPDVFGNIRASLSR 595


>gi|310816968|ref|YP_003964932.1| inner membrane protein oxaA, putative [Ketogulonicigenium vulgare
           Y25]
 gi|308755703|gb|ADO43632.1| inner membrane protein oxaA, putative [Ketogulonicigenium vulgare
           Y25]
          Length = 612

 Score =  382 bits (980), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 218/603 (36%), Positives = 330/603 (54%), Gaps = 36/603 (5%)

Query: 3   RNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVK------QPNQVDNSYAAV 56
           +N N  +A  LS++++  W  F+++P  E  N    + QT         P     S A  
Sbjct: 4   QNKNLILATVLSLVVIVVW--FFLFPP-EATNPTLTDEQTTSVATDGTLPVGGAGSTAGS 60

Query: 57  L--IDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPS 114
           L  I D   + + + RV ++ P L GSI+L G + DDL L  Y   +  +S  V LL P 
Sbjct: 61  LEAITDADASPATAARVGIETPRLSGSISLLGGRIDDLFLSDYQETIDEDSATVRLLRPV 120

Query: 115 NTKNAYFAELDYVSTANNIE---LPNSNTVWNLISG-KILTPTTPIKLVFKNANNILFER 170
             + AY+A   + + A  I    +P  +T+W+L S    LTP TP+ LV+ N    +F  
Sbjct: 121 GERGAYYASFGWAA-AQGIAPEAVPGPDTLWSLESANDTLTPETPVTLVWDNGAGQVFRT 179

Query: 171 TISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHK-PQTATNTFGVQEGFIAVLGDKSL 229
           T ++D  Y+F +  +V N     +   P G + RH  P+     F + EG I  + D  L
Sbjct: 180 TFAIDADYMFTVDQSVQNMGDAAVEMRPYGLVRRHGMPEGLREFFILNEG-IVRMADGRL 238

Query: 230 VEQKYSDIEK---------SSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
            E KYS +           + ++   ES  W+G +D YW +  IP +   F S  KYL  
Sbjct: 239 EEMKYSKMSDMNDAELGVPAEVAEAQESG-WIGFTDHYWMTTLIPEQGQPFRSVQKYLPS 297

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
               +Q +       +  G  +T +  LFAGAKE+ TI  Y+ +  +PRF   IDWGWFY
Sbjct: 298 -RDIFQVEAVMPRQDVAAGAEVTISTRLFAGAKEWATIREYQNEDGVPRFIDSIDWGWFY 356

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           F+ KP+F ++ +    +GN G +I+  T+ +K +  PLA K YVS A MK +QP++++L+
Sbjct: 357 FLTKPIFSVLHWLNQHIGNMGWSIIALTLILKAIVLPLAYKSYVSMARMKELQPELEKLQ 416

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
            + K    Q LQ  M++LYK + +NP +GC P+++QIP+FF++YKVI +++E+RHAP+ G
Sbjct: 417 ARHKDD-RQALQTGMMELYKKNKVNPASGCLPMIVQIPIFFSLYKVIFVTIELRHAPWIG 475

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPG------FMHVGIWPIIMSLSMFIQMKMSPPPADK 514
           W++DL+A DPT+I  LFG+LP+  P          +G+ PI + LSM++Q K++P P D 
Sbjct: 476 WLQDLSAPDPTSILNLFGLLPWGTPEIDSFFFIFSLGVLPIFLGLSMWLQQKLNPLPPDP 535

Query: 515 GQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTF 574
            Q MI  WMP VF+F L SF +GL++YW  +NVI+ VQQ  IM  HG    L   +   F
Sbjct: 536 TQRMIFAWMPWVFMFMLGSFSSGLVLYWIANNVITFVQQYSIMTYHGHRPDLFGNILGGF 595

Query: 575 SKN 577
            + 
Sbjct: 596 KRK 598


>gi|330993393|ref|ZP_08317328.1| Inner membrane protein oxaA [Gluconacetobacter sp. SXCC-1]
 gi|329759423|gb|EGG75932.1| Inner membrane protein oxaA [Gluconacetobacter sp. SXCC-1]
          Length = 578

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 186/506 (36%), Positives = 300/506 (59%), Gaps = 18/506 (3%)

Query: 68  SPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYV 127
            PRV +    + GS++L+GA+ DDL L+ YH  V + SP+V +L P   +     E+ + 
Sbjct: 54  DPRVAIDADRVHGSLDLRGARLDDLVLKNYHETVQNGSPLVRVLEPRGQEQPNLVEVGWA 113

Query: 128 S-TANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTV 186
           + +  ++ +P++NT+W       LT   P+ L + N    +F  T+++D++Y+F +   V
Sbjct: 114 NVSGGHVAVPDANTLWT-ADHDSLTQARPVTLSWDNGQGQVFSITVAIDQNYMFSVTQKV 172

Query: 187 TNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFH 246
           TN+  + +   P  R+ R      T  + V EG I+V+ D  L E  Y  + K ++   +
Sbjct: 173 TNHGGEPVSLYPFSRVERGYTPVETGGYLVHEGPISVI-DHRLDESSYKSLRKGAVPPGN 231

Query: 247 ------ESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA---RYQAKFSANE-ITI 296
                     W GI+DKYW +  IP +++     + Y   G+     Y   F+A   + +
Sbjct: 232 IAWTKAGQGGWAGITDKYWLAAVIPQQDSDVAGTYAYQGAGNGDKGTYDVGFTARAPLVV 291

Query: 297 LPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNL 356
             G   +T + +FAGAKE P +  YE  L IP F   +D+GWF F+ +P+F ++ +   +
Sbjct: 292 AAGGEASTASHVFAGAKEVPLLEKYESSLHIPDFWKAVDFGWFAFLTRPIFTVLDWLNTM 351

Query: 357 VGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMI 416
           +GNFG+A+M  T+ VK LFFPLA KQ+ S   M+ +QPKI  LRE++K      L + MI
Sbjct: 352 LGNFGLALMAFTLLVKALFFPLATKQFHSMGKMRQLQPKIKALRERYKDD-QMALNQQMI 410

Query: 417 QLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTL 476
            LYK   +NP +GC P+LLQIPVF+ +YK + +++EMRHAPF+GWI DL+A DPTN+FTL
Sbjct: 411 GLYKQEGVNPASGCLPMLLQIPVFWCLYKDLYVTIEMRHAPFFGWIHDLSAFDPTNLFTL 470

Query: 477 FGILPF---YLPGFMHVGIWPIIMSLSMFIQMKMSP-PPADKGQAMILNWMPVVFVFALS 532
           FG++P+    +   + +G+WPI   L+MF QM+++P P AD  Q  +  +MP++F F ++
Sbjct: 471 FGLIPWNPSVISPMLQLGLWPIAFGLTMFAQMRLNPTPTADPAQQKMFQFMPIIFTFFMA 530

Query: 533 SFPAGLIIYWSWSNVISIVQQAVIMK 558
             P+GL+IY+ W+N++++ QQ +I +
Sbjct: 531 RQPSGLVIYYCWNNLLTMAQQTLIQR 556


>gi|225630056|ref|YP_002726847.1| putative inner membrane protein translocase component YidC
           [Wolbachia sp. wRi]
 gi|225592037|gb|ACN95056.1| putative inner membrane protein translocase component YidC
           [Wolbachia sp. wRi]
          Length = 566

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 217/556 (39%), Positives = 341/556 (61%), Gaps = 23/556 (4%)

Query: 9   VAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQAL--S 66
           +A  LS++I+ +W+   +Y      N  +  I+ ++  N +    A ++  +R++ +  +
Sbjct: 9   LAAILSMLIMVSWR--IIYDNFFSTNQNQPLIEHIESFNDL----APIIHQNRSEIINST 62

Query: 67  MSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDY 126
              RV L N  + GSI+LKGA+FDDL L  YHL+ SS+SP V LLSP+ +K+ YFAE  +
Sbjct: 63  REQRVSLTNNMIKGSISLKGARFDDLILTNYHLEPSSSSPQVVLLSPAESKDVYFAEFGW 122

Query: 127 VSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTV 186
           +  +N I++P+S  VW   + K+      + L + N N ILF   I+LD++Y+FK+   V
Sbjct: 123 LDPSNKIKVPDSKAVWR--ADKL--NQKEVNLSWDNENGILFRMKINLDDNYMFKVEQVV 178

Query: 187 TNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSI--SN 244
            NN+ D +   P G+I R +     + +   EG +    +K L E  Y DI K  +  +N
Sbjct: 179 ENNTKDNVVLVPYGKINRKRDNINESYWISHEGVLGAFDNK-LEEWTYKDISKKHLIKAN 237

Query: 245 FHESNSWLGISDKYWASVFIPSKETSFHSQFKYL-SDGHARYQAKFSANEITILPGKSIT 303
             E N W G +DKYW +V IP K    +   K+  ++   ++Q  F  +  +ILPG S +
Sbjct: 238 TSEKN-WFGFADKYWLTVIIPEKSDKINVSIKHTNANDIDKFQVDFVKSYKSILPGASTS 296

Query: 304 TTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIA 363
             N+ FAGAK+   +  Y+  L IP F+  +D+G  YFI KP+F+L+ YF  ++ NFG+A
Sbjct: 297 NVNYFFAGAKKLNLLDSYKDTLNIPLFDKAVDFGVLYFITKPVFLLLEYFNFVLKNFGLA 356

Query: 364 IMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHN 423
           I+L T+ +KLL  PL+ + YVS   +K++QP++  ++E +K    +   K  I L+K +N
Sbjct: 357 ILLLTLVIKLLMLPLSNRSYVSMFKVKSLQPELTRVKELYKNDSLK-QHKETIALFKRNN 415

Query: 424 INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY 483
           +NP++  +P+L+QIPVFFA+YKV+ +++EMRHAPF+ WIKDL+A DPTNIFTLFG+  + 
Sbjct: 416 VNPMSSIFPMLIQIPVFFALYKVLFVTIEMRHAPFFLWIKDLSAPDPTNIFTLFGLFNYN 475

Query: 484 LPGFMHVGIWPIIMSLSMFIQMKMSPP---PADKGQAMILNWMPVVFVFALSSFPAGLII 540
            P  + +GI PII   +M IQ K+S       D  Q  ++ ++P + VF  SSFPAGL+I
Sbjct: 476 FP--ISIGILPIIFGATMIIQQKLSEKDQTSKDDIQVNVMKFLPYISVFIFSSFPAGLVI 533

Query: 541 YWSWSNVISIVQQAVI 556
           YW +SN+I+++QQ++I
Sbjct: 534 YWIFSNIITLIQQSLI 549


>gi|103485502|ref|YP_615063.1| putative inner membrane protein translocase component YidC
           [Sphingopyxis alaskensis RB2256]
 gi|98975579|gb|ABF51730.1| 60 kDa inner membrane insertion protein [Sphingopyxis alaskensis
           RB2256]
          Length = 584

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 194/493 (39%), Positives = 296/493 (60%), Gaps = 10/493 (2%)

Query: 65  LSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAEL 124
           L+   R+ ++ P++ GSINL GA+ DD+ L  Y   +  +SP V L +P  T  AYFA L
Sbjct: 82  LAEGQRIPIETPAIRGSINLVGARIDDITLTKYRQTIKKDSPAVRLFAPGGTPAAYFASL 141

Query: 125 DYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVD 184
            +  TA  I+LP + TVW   +G  LTPTTP+ L + N     F    S+D +YL     
Sbjct: 142 GW--TAQGIQLPGAGTVWT-ANGTKLTPTTPVTLSWTNTTGQTFRIEYSIDANYLITAKQ 198

Query: 185 TVTNNSIDQIRFSPRGRIMR-HKPQT--ATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS- 240
           TV N     +  S    I R  KP      +++ +  G    L  KS+ +  Y D+E++ 
Sbjct: 199 TVVNAGTAPVSLSSFALIDRLGKPTDPHEVDSWTIHVGPTGYLDGKSVFDIDYDDLEEAP 258

Query: 241 SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGK 300
           + S  + S  WLG +DKYW +  +P+K     +     S     YQ  F+ +   + PG+
Sbjct: 259 NRSVRYTSAGWLGFTDKYWLAAIVPAKGERVTAAIS--SPATNNYQTLFARDFTQVAPGQ 316

Query: 301 SITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF 360
            +T T+ +FAGAKE   +  Y+ D  I R    IDWGWF F   P+F L+ + +  VGNF
Sbjct: 317 QLTATSRIFAGAKEVEILETYQDDQGITRLSNAIDWGWFEFFEVPIFKLLHWLFEKVGNF 376

Query: 361 GIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYK 420
           G+AIM  T+ ++LL FP+A +Q+ S A M+ +QPK+  L+E++K   P+ +Q+ +++LYK
Sbjct: 377 GLAIMALTLIIRLLMFPIANRQFSSMAQMRVVQPKMKALQERYKDDKPR-MQQELMKLYK 435

Query: 421 THNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL 480
              INPLAGC PI++QIP+F+A+YKV+ +++EMRH PF  WIKDL+A DP +I  LFG+L
Sbjct: 436 DEKINPLAGCLPIVIQIPIFYALYKVLMLAIEMRHQPFILWIKDLSAPDPLHILNLFGLL 495

Query: 481 PFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLII 540
           PF  P  + +G+  +I+ ++M++Q +++P PAD  QA +   MP +F+F ++ F AGL++
Sbjct: 496 PFTPPSILAIGLLAVILGVTMWLQFRLNPAPADPVQAQVFKIMPWLFMFIMAPFAAGLLL 555

Query: 541 YWSWSNVISIVQQ 553
           YW  +N++SI QQ
Sbjct: 556 YWITNNILSIGQQ 568


>gi|332186329|ref|ZP_08388074.1| Inner membrane protein translocase component YidC, long form
           [Sphingomonas sp. S17]
 gi|332013697|gb|EGI55757.1| Inner membrane protein translocase component YidC, long form
           [Sphingomonas sp. S17]
          Length = 565

 Score =  379 bits (972), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 200/564 (35%), Positives = 314/564 (55%), Gaps = 15/564 (2%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQ---PNQVDNSYAAV-- 56
           E   N+ V   ++ +I++ W    +  +    N     I   KQ    N   N  A    
Sbjct: 3   EDRKNFVVFAVIAALILFGWP--LIQSKFFPSNPPATKIVDGKQVPVANSTANPTATTPS 60

Query: 57  LIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNT 116
            I DR   L+ +PRV +  P L GSINLKGA+ DDL L  Y   V+ +SP + LLSP+  
Sbjct: 61  AIRDRRVVLAETPRVAIDTPRLKGSINLKGARIDDLVLLDYKETVAKDSPPIRLLSPAGA 120

Query: 117 KNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE 176
           + AYFA   + +  + +  P ++TVW   S  +L P  P+ L   NA    F+ T+S+D+
Sbjct: 121 EGAYFAGFGWRT--DGLNPPAADTVWT-ASAPVLRPGQPVTLTAANATGQRFQITLSVDK 177

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
            Y+F +  TV N     +  +  G + R       +++ +  G ++V    +     + D
Sbjct: 178 DYMFTVQQTVANGGNAPVPVAAYGYVNRGI-SADPDSWTIHVGPMSVNDGTAHYGPNWKD 236

Query: 237 IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITI 296
           ++K+  + F  +  WLG +DKYW +  IP +  +F  QF+  +     YQA ++    T+
Sbjct: 237 LDKAP-TRFTTTGGWLGFTDKYWLATLIPDQSKAFDGQFR--AGAGQTYQADYTLQPQTL 293

Query: 297 LPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNL 356
            PG+ +T T   FAGAKE   +  Y       + +  +DWG+   + KP+F  + + + L
Sbjct: 294 APGRQVTQTTRFFAGAKEVALLDRYTDKEGATKLDYALDWGYLRVLEKPIFYYLDWLFRL 353

Query: 357 VGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMI 416
           VGNFG+AI+L TV ++ L FP+A++Q+ S A M+ +QPK+  L+E++K    ++ Q+ M 
Sbjct: 354 VGNFGVAIILLTVTIRALMFPIAQRQFASMAAMRAVQPKMKALQERYKDDKVRMQQEVM- 412

Query: 417 QLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTL 476
            LYK   +NPLAGC P L+QIP+F+A+YKV+ +++EMRH PF  WIKDL+A DP     L
Sbjct: 413 ALYKQEKVNPLAGCLPTLIQIPIFYALYKVLMLTIEMRHQPFVAWIKDLSAPDPLTPVNL 472

Query: 477 FGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPA 536
           FG+LPF  P F+ +G+ PI++ +SM+ Q KM+P P D  Q  +   +P V +F ++ F  
Sbjct: 473 FGLLPFTPPHFIAIGVVPILLGISMYFQFKMNPQPMDDAQKQVFAILPWVLMFVMAPFAV 532

Query: 537 GLIIYWSWSNVISIVQQAVIMKMH 560
           GL +YW  +N ISI+QQ ++   H
Sbjct: 533 GLQVYWITTNCISILQQRLLYARH 556


>gi|58698973|ref|ZP_00373828.1| 60 kd inner-membrane protein [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|58534513|gb|EAL58657.1| 60 kd inner-membrane protein [Wolbachia endosymbiont of Drosophila
           ananassae]
          Length = 549

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 209/514 (40%), Positives = 321/514 (62%), Gaps = 17/514 (3%)

Query: 51  NSYAAVLIDDRAQAL--SMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIV 108
           N  A ++  +R++ +  +   RV L N  + GSI+LKGA+FDDL L  YHL+ SS+SP V
Sbjct: 28  NDLAPIIHQNRSEIINSTREQRVSLTNNMIKGSISLKGARFDDLILTNYHLEPSSSSPQV 87

Query: 109 TLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILF 168
            LLSP+ +K+ YFAE  ++  +N I++P+S  VW   + K+      + L + N N ILF
Sbjct: 88  VLLSPAESKDVYFAEFGWLDPSNKIKVPDSKAVWR--ADKL--NQKEVNLSWDNENGILF 143

Query: 169 ERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKS 228
              I+LD++Y+FK+   V NN+ D +   P G+I R +     + +   EG +    +K 
Sbjct: 144 RMKINLDDNYMFKVEQVVENNTKDNVVLVPYGKINRKRDNINESYWISHEGVLGAFDNK- 202

Query: 229 LVEQKYSDIEKSSI--SNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYL-SDGHARY 285
           L E  Y DI K  +  +N  E N W G +DKYW +V IP K    +   K+  ++   ++
Sbjct: 203 LEEWTYKDISKKHLIKANTSEKN-WFGFADKYWLTVIIPEKSDKINVSIKHTNANDIDKF 261

Query: 286 QAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKP 345
           Q  F  +  +ILPG S +  N+ FAGAK+   +  Y+  L IP F+  +D+G  YFI KP
Sbjct: 262 QVDFVKSYKSILPGASTSNVNYFFAGAKKLNLLDSYKDTLNIPLFDKAVDFGVLYFITKP 321

Query: 346 MFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQ 405
           +F+L+ YF  ++ NFG+AI+L T+ +KLL  PL+ + YVS   +K++QP++  ++E +K 
Sbjct: 322 VFLLLEYFNFVLKNFGLAILLLTLVIKLLMLPLSNRSYVSMFKVKSLQPELTRVKELYKN 381

Query: 406 SPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDL 465
              +   K  I L+K +N+NP++  +P+L+QIPVFFA+YKV+ +++EMRHAPF+ WIKDL
Sbjct: 382 DSLK-QHKETIALFKRNNVNPMSSIFPMLIQIPVFFALYKVLFVTIEMRHAPFFLWIKDL 440

Query: 466 AAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPP---PADKGQAMILNW 522
           +A DPTNIFTLFG+  +  P  + +GI PII   +M IQ K+S       D  Q  ++ +
Sbjct: 441 SAPDPTNIFTLFGLFNYNFP--ISIGILPIIFGATMIIQQKLSEKDQTSKDDIQVNVMKF 498

Query: 523 MPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVI 556
           +P + VF  SSFPAGL+IYW +SN+I+++QQ++I
Sbjct: 499 LPYISVFIFSSFPAGLVIYWIFSNIITLIQQSLI 532


>gi|42520132|ref|NP_966047.1| putative inner membrane protein translocase component YidC
           [Wolbachia endosymbiont of Drosophila melanogaster]
 gi|42409869|gb|AAS13981.1| 60 kDa inner-membrane protein [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 569

 Score =  372 bits (954), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 211/555 (38%), Positives = 335/555 (60%), Gaps = 18/555 (3%)

Query: 9   VAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQAL--S 66
           +A  LS++I+ +W+   +Y      +  +  I+ ++      N  A ++  +R++ +  +
Sbjct: 9   LAAILSMLIMVSWR--IIYDNFFSTSQNQPLIENIEHIESF-NDLAPIIYQNRSEIINST 65

Query: 67  MSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDY 126
              RV L N  + GSI+LKGA+FDDL L  YHL+ SS+SP V LLSP+ +K+ YFAE  +
Sbjct: 66  REQRVSLTNNMIKGSISLKGARFDDLILTNYHLEPSSSSPQVVLLSPAESKDVYFAEFGW 125

Query: 127 VSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTV 186
           +  +N I++P+S  VW   + K+      + L + N N ILF   I+LD++Y+FK+   V
Sbjct: 126 LDPSNKIKVPDSKAVWR--ADKL--NQKEVNLSWDNENGILFRMKINLDDNYMFKVEQVV 181

Query: 187 TNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFH 246
            NN+ D +   P G+I R +     + +   EG +    +K L E  Y DI K  +    
Sbjct: 182 ENNTKDNVVLVPYGKINRKRDNINESYWISHEGVLGAFDNK-LEEWTYKDISKKHLIKAS 240

Query: 247 ESN-SWLGISDKYWASVFIPSKETSFHSQFKYLS-DGHARYQAKFSANEITILPGKSITT 304
            S  +W G +DKYW +  IP K    +   K+ + +   ++Q  F     +ILPG S++ 
Sbjct: 241 TSEKNWFGFADKYWLTAIIPEKSDKINVSIKHTNVNNTDKFQVDFVKPYKSILPGASVSN 300

Query: 305 TNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAI 364
            N+ FAGAK+   +  Y+  L IP F+  +D+G  YFI KP+F+L+ YF  ++ NFG+AI
Sbjct: 301 VNYFFAGAKKLNLLDSYKDTLNIPLFDKAVDFGVLYFITKPVFLLLEYFNFVLKNFGLAI 360

Query: 365 MLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNI 424
           +L T+ +KLL   L  + Y+S   +K++QP++  ++E +K    +   K  I L+K +N+
Sbjct: 361 LLLTLVIKLLMLSLFNRSYISMFKVKSLQPELTRIKELYKNDSLK-QHKETIALFKRNNV 419

Query: 425 NPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYL 484
           NP++  +P+L+QIPVFFA+YKV+ +++EMRHAPF+ WIKDL+A DPTNIFTLFG+  +  
Sbjct: 420 NPMSSIFPMLIQIPVFFALYKVLFVTIEMRHAPFFLWIKDLSAPDPTNIFTLFGLFNYNF 479

Query: 485 PGFMHVGIWPIIMSLSMFIQMKMSPP---PADKGQAMILNWMPVVFVFALSSFPAGLIIY 541
           P  + +GI PII   +M IQ K+S       D  Q  ++ ++P + VF  SSFPAGL+IY
Sbjct: 480 P--ISIGILPIIFGATMIIQQKLSEKDQTSKDDIQVNVMKFLPYISVFIFSSFPAGLVIY 537

Query: 542 WSWSNVISIVQQAVI 556
           W +SN+I+++QQ++I
Sbjct: 538 WIFSNIITLIQQSLI 552


>gi|85374954|ref|YP_459016.1| putative inner membrane protein translocase component YidC
           [Erythrobacter litoralis HTCC2594]
 gi|84788037|gb|ABC64219.1| preprotein translocase subunit [Erythrobacter litoralis HTCC2594]
          Length = 581

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 200/570 (35%), Positives = 311/570 (54%), Gaps = 18/570 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNF--YVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           M+   N  +A+ L  +++  W     Y YP+  E     +   TV       +S AA L 
Sbjct: 1   MDNQRNLLLAVVLCGVLIIGWDAAMNYFYPQPAEPIEAVEGSPTVASAPVAGSSTAATLD 60

Query: 59  DDRA--------QALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTL 110
           +  A         AL+   R+ +  P + GSINL GA+ DD+ L+ +   V  +S  V +
Sbjct: 61  NGAAAQGPVELSDALATPERIRIDAPRVEGSINLVGARIDDIELKDHRATVDEDSGPVQM 120

Query: 111 LSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFER 170
            +P NT   YFA+  +V     + LP S+TVW+   G+ LT   P+ L + N     F  
Sbjct: 121 FAPQNTDAQYFAQFGWV--GEGVSLPTSDTVWS-ADGETLTQGNPVTLSWDNGAGQQFRI 177

Query: 171 TISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLV 230
             S+D++Y+     T  N     +   P   I R     +T+T+    G + V GD +  
Sbjct: 178 RFSIDDNYMITAEQTAANTGGGPVVARPFATITRTSETASTDTWIAHSGPMGVFGDSADY 237

Query: 231 EQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFS 290
              Y D+      +      WLG SD Y+    +P  +    + F+ +  G   ++A   
Sbjct: 238 GPDYDDLADDGPYSGEGKARWLGFSDIYFLGALVPQADADPQTGFRPI--GENLFRADVI 295

Query: 291 ANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLM 350
               T+ PG  ++ T  LFAGAKE   +  YE D  I +F + IDWGWF +  KP+  L+
Sbjct: 296 YQPATVAPGNEVSRTTQLFAGAKESEILDQYE-DAGIDKFGLAIDWGWFRWFEKPLLWLL 354

Query: 351 SYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQV 410
           +  ++LVGNFG+AI+L TV ++ L FP+A+KQ+ S A MK +QPK+  ++EK+K    Q 
Sbjct: 355 NQLFDLVGNFGVAIILLTVIIRGLLFPIAQKQFGSMAAMKAVQPKMKAIQEKYKDDK-QK 413

Query: 411 LQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADP 470
            Q+ ++ LYK   +NPLAGC P+L+QIP+FFA+YKV+ +++EMRH PF  WI+DL+A DP
Sbjct: 414 QQQEIMALYKEEKVNPLAGCLPLLIQIPIFFALYKVLILAIEMRHQPFALWIEDLSAPDP 473

Query: 471 TNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFA 530
            +IF LFG+LPF +PG + +G   +++ ++M++  +M+ P  D  Q  I N MP V +F 
Sbjct: 474 AHIFNLFGLLPFEVPGLIAIGPLAVLLGVTMWLTFQMN-PVTDPIQRQIFNIMPWVLMFI 532

Query: 531 LSSFPAGLIIYWSWSNVISIVQQAVIMKMH 560
           ++ F AGL++YW+ SNV+++ QQ  +   H
Sbjct: 533 MAPFAAGLLLYWNTSNVLTLAQQRYLYSKH 562


>gi|87198602|ref|YP_495859.1| putative inner membrane protein translocase component YidC
           [Novosphingobium aromaticivorans DSM 12444]
 gi|87134283|gb|ABD25025.1| protein translocase subunit yidC [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 600

 Score =  363 bits (931), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 197/576 (34%), Positives = 309/576 (53%), Gaps = 25/576 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQN----FYVYP----------RIEEMNNERKNIQTVKQP 46
           M+   N  +A+ L+ I++  W      FY  P            E  N E+   +  ++ 
Sbjct: 1   MQNQRNLIMAVVLTGILLLGWDVAMRWFYPQPAQKPKVEAAASAEPANGEKP--KRTREG 58

Query: 47  NQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSP 106
              +    A+   D AQ L+   R+ +  P L GSINLKGA  DD+ L  +   V  NS 
Sbjct: 59  GLQNAGDIALEKKDLAQELAAGHRIAIDAPGLKGSINLKGALVDDVTLARHREGVDRNSA 118

Query: 107 IVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNI 166
            V L SP+ T   +FA++ +V     +  P++NT+W    G  LTP TP+ L + NA+  
Sbjct: 119 PVRLFSPAGTPAQHFAQIGWVG--EGVAAPDANTMWQ-ADGAKLTPQTPVTLRWTNASGQ 175

Query: 167 LFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGD 226
            +    ++D  Y+      V N     +   P   + R     + +T+ V  G I     
Sbjct: 176 TYSIRYAIDGDYMITATQGVANTGPAPVVVRPFALVNRTDKTASLDTWNVHSGPIGAFDG 235

Query: 227 KSLVEQKYSDIEKSSISN--FHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR 284
               +  YS + ++      F  + +W+G +D YW S  IP       + F+ L  G   
Sbjct: 236 SVNFDNNYSTVAEAEGGAIPFKGTANWIGFTDIYWLSALIPDANAKAEAAFRSL--GQGV 293

Query: 285 YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAK 344
           Y+A      ++I PGK+++ T  LFAG KE   +  YE    +  F + IDWGWF +  K
Sbjct: 294 YRADLIYPSVSIAPGKALSQTVRLFAGGKENAVLEKYEA-AGVTNFSLSIDWGWFRWFEK 352

Query: 345 PMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK 404
           P+F L+   +  VGNFG+AI+L T+ V+ + FP+A++Q+ S A M+ +QPK+  ++E++K
Sbjct: 353 PIFWLLDSIFKKVGNFGVAIILLTLIVRGVMFPIAQRQFASMAAMRALQPKMKAIQERYK 412

Query: 405 QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKD 464
               Q  Q+ +++LYK   +NPLAGC PI LQIPVFFA+YKV+ +++EMRH PF  WIKD
Sbjct: 413 DDK-QKQQQEIMELYKREKVNPLAGCLPIFLQIPVFFALYKVLVLTIEMRHQPFALWIKD 471

Query: 465 LAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMP 524
           L+A DP ++  LFG+LPF  P F+ +G+  I++ ++M++Q K+ P   D  Q  +  +MP
Sbjct: 472 LSAPDPLHVLNLFGLLPFDPPSFLGIGVLAILLGITMWLQFKLQPAAMDPAQQQVFAFMP 531

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMH 560
            + +F ++ F AGL+IYW  SN+++I QQ  +   H
Sbjct: 532 WIMMFVMAPFAAGLLIYWITSNLLTIAQQKYLYSRH 567


>gi|296283114|ref|ZP_06861112.1| putative inner membrane protein translocase component YidC
           [Citromicrobium bathyomarinum JL354]
          Length = 585

 Score =  360 bits (925), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 203/568 (35%), Positives = 317/568 (55%), Gaps = 15/568 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVY-----PRIEEMNNERKNIQTVKQPNQVDNSYAA 55
           M+   N  +A+ L  I++  ++    Y     P  E+++      Q V Q    + + AA
Sbjct: 1   MDNQRNLILAVVLCGILILGYEAAVTYYYPTPPETEQVDRATTAEQRVTQDTAQNPAIAA 60

Query: 56  VLID---DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLS 112
             ID   D  +ALS   RV +  P + GSINL GA+ DD+ L+ +   V  +S  V L +
Sbjct: 61  AAIDEAVDLDEALSAGNRVAIDAPRVEGSINLVGAKIDDIELKDHRATVDKDSGPVQLFA 120

Query: 113 PSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTI 172
           P+ T    FA+  +V      ++P ++TVW   SG+ LTP TPI L + NA    F   +
Sbjct: 121 PAGTPIQNFAQFGFV--GEGTQVPGADTVWQ-ASGEALTPDTPIDLRWDNAQGQRFRIRL 177

Query: 173 SLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ 232
           S+D++Y+     TV N     +  SP   I R     + +T+    G I   G       
Sbjct: 178 SIDDNYMITAEQTVANTGDAPVVVSPFATITRTSLTASKSTWISHSGPIGTFGGTVDYGP 237

Query: 233 KYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSAN 292
            Y D+ +  + +     +WLG +D YW    IP   ++  + F+ L D    ++A    N
Sbjct: 238 DYDDVVEQKVVSGAADPAWLGFTDIYWLGALIPEAGSAPDTGFRSLGDN--LFRADLIYN 295

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
             T+ PG+ IT T+ LFAGAKE   +  Y+ D  I +F + IDWGWF +  KP+  L+  
Sbjct: 296 PATLQPGRQITRTSRLFAGAKESGVLDAYQ-DAGIAQFGLAIDWGWFRWFEKPILWLLLQ 354

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
            +++VGNFG+AI+L T  V+ L FP+A+K + S A+MK IQP++ +L+EK K       Q
Sbjct: 355 IFSVVGNFGVAIILLTCIVRGLMFPIAQKGFSSMASMKAIQPEMKKLQEKHKDDK-VTQQ 413

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           + M +L+K   +NP+AGC P+LLQIPVFFA+YKV+ +++EMRH PF  WI+DL+A DP +
Sbjct: 414 QEMQKLFKERGVNPVAGCLPMLLQIPVFFALYKVLILAIEMRHQPFIFWIRDLSAPDPAH 473

Query: 473 IFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALS 532
           I  LFG+LPF +PG + +G   +++  +M++  +++P   D  Q  + + MP V +F +S
Sbjct: 474 ILNLFGMLPFEVPGMLALGPLALLLGFTMWLTFRLNPAAMDPVQQQVFSIMPWVMMFVMS 533

Query: 533 SFPAGLIIYWSWSNVISIVQQAVIMKMH 560
            F AGL++YW+ SN++++ QQ  +   H
Sbjct: 534 PFAAGLLLYWNTSNILTLAQQKYLYSKH 561


>gi|58040258|ref|YP_192222.1| putative inner membrane protein translocase component YidC
           [Gluconobacter oxydans 621H]
 gi|58002672|gb|AAW61566.1| 60 kD inner membrane protein OxaA [Gluconobacter oxydans 621H]
          Length = 575

 Score =  360 bits (924), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 193/510 (37%), Positives = 299/510 (58%), Gaps = 21/510 (4%)

Query: 70  RVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVST 129
           R+ +  P + GS+NLKGA  DDL L  Y   ++ +SP+V LL  + + +  F  + + + 
Sbjct: 67  RIPVTGPDVQGSLNLKGAVLDDLILMKYRETLAKDSPLVRLLDKAGSAHPTFVVIGWTNA 126

Query: 130 -ANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTN 188
             +N  LP+ NTVW   S + LTP  P+ L + N   ++F   I+LDEHY+F +  TV N
Sbjct: 127 PGSNARLPDLNTVWE-SSDETLTPDHPVTLHWDNGQGLVFSIQIALDEHYMFAVSQTVEN 185

Query: 189 NSIDQIRFSPRGRIMRH--KPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFH 246
           +S   +   P  R+ R    P+ A   F   EG IAV+G + + ++ Y ++ K +    H
Sbjct: 186 HSGQPVALVPFERVQRDYDAPEGA---FTAHEGPIAVIGGR-MQDESYKNLRKGADHPDH 241

Query: 247 ES------NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSA-NEITILPG 299
            S      N W GISDK+W +   P+  T   + F Y+      YQ   S  N   I+P 
Sbjct: 242 VSWSSTGTNGWDGISDKFWLTAVAPADGTPVAASFAYVPGTPGSYQVGMSTQNAQQIMPN 301

Query: 300 KSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGN 359
            SIT  + +FAGAK    +  Y K L IP  +  ID+GWF F+ +P+  L+ + Y  +GN
Sbjct: 302 GSITEKSHVFAGAKVVSLLQGYSKQLGIPDLDKAIDFGWFSFLTRPLLTLLHWLYLHLGN 361

Query: 360 FGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLY 419
           FG+A+M  T+ VK++ FPLA K   S+A M+ + PK+ E+REK K  P  + QK M  LY
Sbjct: 362 FGLALMALTLIVKIVLFPLASKAAQSSARMRLLAPKVKEIREKNKDDPMAMNQKVM-ALY 420

Query: 420 KTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGI 479
           +   ++P +GC P+L+Q P+FF +YK+++IS++ RHAPF+GWI DL+  DPTN+F LFG+
Sbjct: 421 REEKVSPASGCLPMLIQAPIFFCLYKILNISIDARHAPFFGWIHDLSMPDPTNVFNLFGL 480

Query: 480 LPF---YLPGFMHVGIWPIIMSLSMFIQMKMSPPPA--DKGQAMILNWMPVVFVFALSSF 534
           LPF   +   F+HV IW   + L+ ++  + +   A  D  QA ++ +MP+V+VF +S F
Sbjct: 481 LPFDPTHYSSFLHVSIWGTALGLTFWLLQRQTSSTASLDPAQARMMQFMPLVYVFFMSGF 540

Query: 535 PAGLIIYWSWSNVISIVQQAVIMKMHGAEI 564
           PA L++Y++W+N++++ QQ  I +  G  +
Sbjct: 541 PASLLVYYTWNNLLTVAQQMFIQRRTGLPV 570


>gi|88607700|ref|YP_505133.1| putative inner membrane protein translocase component YidC
           [Anaplasma phagocytophilum HZ]
 gi|88598763|gb|ABD44233.1| inner membrane protein, 60 kDa [Anaplasma phagocytophilum HZ]
          Length = 568

 Score =  355 bits (911), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 196/570 (34%), Positives = 320/570 (56%), Gaps = 29/570 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQP-NQVDN--SYAAVL 57
           M    N  +A+  SV I+  W+  Y+Y     +    + +Q  +    +VD+   YA+  
Sbjct: 1   MSEVRNLILAVVASVAIMLGWK--YIYGEFFAVKTVPEGVQESESLIPEVDDIVDYASY- 57

Query: 58  IDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTK 117
               + AL   PRVELKN  L  S++L+GA  DD +L  Y + +  NS  V L+SP  T 
Sbjct: 58  ----SDALKQVPRVELKNSKLAASVSLRGALIDDASLVKYRVSLDKNSENVLLMSPEGTV 113

Query: 118 NAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEH 177
           +    E  +V   + +++P  +TVW L  G   +      + + N   ++F    S+D+ 
Sbjct: 114 SDSMVEFGWVDPKHVLKVPGRDTVWALEDG---SDEQNFTIRWDNGEGLIFRLKFSVDQD 170

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           Y+  +   V NN+   +  +  GRI R   +++ + +   EG I   G   L E  Y ++
Sbjct: 171 YMLTVAQEVINNTDVNVHLAHYGRINRAHSKSSKSFWISHEGAIGSFG-HGLKEWTYKNL 229

Query: 238 EK------SSISNFHESNSWLGISDKYWASVFIPSK----ETSFHSQFKYLSDGHARYQA 287
           E+      S ++      SW+G +DKYW +  IPS     + +F +Q  Y  +G +R+Q 
Sbjct: 230 EEAGSIRLSGVTREDGGRSWIGFADKYWFTALIPSASEQGKLAFRTQRVY-REGASRFQV 288

Query: 288 KFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMF 347
            +S +  TI     +     LF GAKE   +  Y+  L IP F+  +D+G  YFI KP+F
Sbjct: 289 DYSKSHGTIGAHDKVEAVTHLFMGAKELELLDQYKDTLNIPMFDKAVDFGMLYFITKPVF 348

Query: 348 MLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSP 407
           +L+ YF+ L+GNFG+AI++ TV +KL+ FPL+ + YVS   +K +QP++  ++E +K   
Sbjct: 349 LLLQYFHKLLGNFGLAIVMLTVAIKLVAFPLSMRSYVSMFKLKRLQPEVLRIKELYKTDD 408

Query: 408 PQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAA 467
            ++  K +  L+K H ++PL+G  P+L+QIP+FFA+YKV+ +++EMRHAP +GWI+DL++
Sbjct: 409 LRI-SKEIASLFKKHKVSPLSGFLPVLIQIPIFFALYKVLFVTIEMRHAPLFGWIRDLSS 467

Query: 468 ADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMK-MSPPPADKGQAMILNWMPVV 526
            D  N   LFG++P   P    +G+ P+++ L+M +Q K M    A   +  ++ ++P +
Sbjct: 468 QDTANFLNLFGLIPLEPP--FCIGVLPVVLGLTMVLQQKVMQKDQATPDRYGVMKFLPYI 525

Query: 527 FVFALSSFPAGLIIYWSWSNVISIVQQAVI 556
           FVF  SSFP+GL++YW  SNVI+I+QQ VI
Sbjct: 526 FVFVFSSFPSGLVLYWICSNVITILQQIVI 555


>gi|85709448|ref|ZP_01040513.1| putative inner membrane protein translocase component YidC
           [Erythrobacter sp. NAP1]
 gi|85688158|gb|EAQ28162.1| putative inner membrane protein translocase component YidC
           [Erythrobacter sp. NAP1]
          Length = 595

 Score =  353 bits (906), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 198/576 (34%), Positives = 305/576 (52%), Gaps = 25/576 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNF--YVYPR---------IEEMNNERKNIQTVKQ---- 45
           M+   N  +A+ LS +++ +W     Y YP+         +    ++  +  TV      
Sbjct: 1   MDNQRNILLAVVLSGLLILSWDMGMRYFYPQSDVPAPSEVMSGAASDPADADTVTSSTDG 60

Query: 46  -PNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
               +  + A V   D   AL+   RV +  P + GSINL GA+ DDL L+ Y       
Sbjct: 61  PAGDLGEAAAEVGPVDLGTALASENRVIIDAPRVAGSINLVGARVDDLVLKDYDETTQEG 120

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           S  V +L+P  T   ++AE  +V     +   +S  +W    G+ LTP TP+ L   + N
Sbjct: 121 SDPVRILAPDRTDEQHYAEFGFVVGGQRM---SSRAIWE-ADGERLTPETPVTLSRTDEN 176

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVL 224
            I +    S+D++Y+     TV N S +     P   I R     + + F    G   V 
Sbjct: 177 GITYRVAFSIDDNYMVSAQQTVENGSENAAIVQPFALIKRTSETASPDQFIAHAGPTGVF 236

Query: 225 GDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR 284
           G        Y ++ +    N   + SWLG +D YWAS  IP +  +  + ++ L D   R
Sbjct: 237 GGSLYDPNSYEELAELGRDNPAGAVSWLGFTDNYWASALIPGEGEADSAGWRSLGDQLFR 296

Query: 285 YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAK 344
               + A   T+  G S+T    LFAGAKE   +  YE D  I  F   I WGWF +  K
Sbjct: 297 ADLIYDAQ--TVPAGGSLTRGTQLFAGAKESAILDQYE-DAGITYFGKAISWGWFEWFEK 353

Query: 345 PMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK 404
           P+  L+     LVGNFG+AI+L TV ++ L FP+A+KQ+ S A MK +QPK+  ++E++K
Sbjct: 354 PLLWLLRTLNGLVGNFGVAIILLTVIIRGLLFPIAQKQFASMAQMKAVQPKMKAIQERYK 413

Query: 405 QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKD 464
               Q  Q+ +++LYK   +NPLAGC P+L+QIP+FFA+YKV+ +++EMRH PF  ++ D
Sbjct: 414 DDK-QTQQQKIMELYKEEKVNPLAGCLPLLIQIPIFFALYKVLYLAIEMRHEPFL-YMSD 471

Query: 465 LAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMP 524
           L+A DP  I  LFG+LP+ +PGF+ +GI  +++ ++M++  K++P   D  Q  I N MP
Sbjct: 472 LSAPDPAKILNLFGLLPYDVPGFLGIGILAVLLGVTMWLTFKLNPSAMDPVQQQIFNLMP 531

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMH 560
              +F ++ F AGL+IYW  SNV+++ QQ+ +   H
Sbjct: 532 WFLMFVMAPFAAGLLIYWVTSNVLTLAQQSYLYSRH 567


>gi|326386366|ref|ZP_08207989.1| putative inner membrane protein translocase component YidC
           [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209027|gb|EGD59821.1| putative inner membrane protein translocase component YidC
           [Novosphingobium nitrogenifigens DSM 19370]
          Length = 606

 Score =  352 bits (904), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 195/580 (33%), Positives = 302/580 (52%), Gaps = 26/580 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNF--YVYPRIEE------------------MNNERKNI 40
           ME+  N   A+ L  II+  W     Y YP   E                   + +    
Sbjct: 1   MEKQRNLIWAVVLMGIILIGWDLGLRYFYPHAGEHPHAAASSTATSASGTAPASGDAAPA 60

Query: 41  QTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLD 100
           +  ++      +  A+   D   AL+   RV +  P + GSINL G   DDL L  +   
Sbjct: 61  KPTREGGLQSPADIAIEAQDLKTALAAPTRVAIAAPGVSGSINLVGGLIDDLTLNRHRET 120

Query: 101 VSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVF 160
             + SP V L SP+ T   ++A+L +    N ++ P  NTVW     + LTPTTP+ L +
Sbjct: 121 SDAGSPPVRLFSPAGTPAQHYAQLGWTGD-NGVQTPQGNTVWQADRTR-LTPTTPVTLRW 178

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGF 220
            NA    F    ++DE+Y+     +VTN     +   P   I R     + +T+ V  G 
Sbjct: 179 TNATGQTFAIRYAIDENYMISAQQSVTNAGTAPVSVKPFALINRTDRTASLDTWQVHSGP 238

Query: 221 IAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
           I            Y D+  +         +W+G +D YW S  +P   T     F+ L +
Sbjct: 239 IGAFDGSVDFASHYKDVNAAGEVAPAGQTNWIGFTDIYWLSALVPDAGTKPSGSFRALGN 298

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
           G  R    + A   T+ PG++++ +  LFAGAKE   +  YE    I  F + IDWGWF 
Sbjct: 299 GFFRADLIYPA--ATVAPGQTVSQSLRLFAGAKENRVLEAYEAQ-GISNFSLAIDWGWFR 355

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           +  KP+F L+   ++ V NFGIAI+L T+ V+ + FP+A++Q+ S A M+ IQPK+  ++
Sbjct: 356 WFEKPIFWLLDSLFHAVKNFGIAIILLTLIVRGIMFPVAQRQFASMAAMRAIQPKMKAIQ 415

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E++K   P+  Q+ ++ LYK   +NPLAGC P+ LQIPVFFA+YKV+ +++EMRH PF  
Sbjct: 416 ERYKDDKPRQ-QQEIMALYKEEGVNPLAGCLPMFLQIPVFFALYKVLVLTIEMRHQPFAL 474

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMIL 520
           WI DL++ DPT++  LFG+LPF   G   +G+  +++  +M++Q K+ P   D  Q  ++
Sbjct: 475 WIHDLSSPDPTHLLNLFGLLPFTPTGMFGIGVLALLLGATMWLQFKLQPAAMDPSQQQVM 534

Query: 521 NWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMH 560
             MP + +F +S+F +GL+IYW  SN+++I QQ  +   H
Sbjct: 535 AIMPWMMMFVMSTFASGLLIYWITSNLLTIAQQRYLYSRH 574


>gi|58584448|ref|YP_198021.1| putative inner membrane protein translocase component YidC
           [Wolbachia endosymbiont strain TRS of Brugia malayi]
 gi|58418764|gb|AAW70779.1| Preprotein translocase subunit YidC [Wolbachia endosymbiont strain
           TRS of Brugia malayi]
          Length = 572

 Score =  350 bits (897), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 212/574 (36%), Positives = 336/574 (58%), Gaps = 17/574 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYV-YPRIEEMNNERKNIQTVKQPNQVDNSYAAVLID 59
           M    N  +A  LS++I+ +W+  Y  +   E+ +   +NI+ ++  N +    A V+  
Sbjct: 1   MSEARNLILAAILSILIIVSWRIIYDNFLNAEQDHPLIENIEHIESFNDL----APVIHQ 56

Query: 60  DRAQAL--SMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTK 117
            R++ +  +   R+ L N  + GSI+LKGA+FDDL L  Y L+   +SP V LLSP+ +K
Sbjct: 57  SRSEIINSTREQRINLTNNMVKGSISLKGARFDDLILTNYCLEPDPSSPQVVLLSPAESK 116

Query: 118 NAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEH 177
           + YFAE  ++      ++P+S T W     + LT    + L + N N I+F   +SLD +
Sbjct: 117 DVYFAEFGWLDPNGKTKVPDSKTFWQAEKTE-LTNQKAVNLFWNNENGIVFRMKVSLDNN 175

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           Y+FK+   V NN+ D +   P G+I R +     + +   EG +    D  L E  Y ++
Sbjct: 176 YMFKVEQIVENNTKDNVVLVPYGKINRKRDNINESYWISHEGILGAF-DNKLEEWTYKNV 234

Query: 238 EKSSISNFHESN-SWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA-RYQAKFSANEIT 295
            K  +     S  +W G +DKYW +  IP K    +   K+ +  +  ++Q  F      
Sbjct: 235 AKKHLIKASTSKKNWFGFADKYWLTAIIPEKFDKTNVSIKHTNANNVDKFQVDFVKPYKN 294

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           ILPG S +  N+ FAGAK+   + +Y+  L IP F+  +D+G  YFI KP+F+L+ YF  
Sbjct: 295 ILPGTSASNVNYFFAGAKKLNLLDYYKSTLNIPLFDKAVDFGVLYFITKPVFLLLEYFNF 354

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
           ++ NFG+AI+L T+ +KLL  PL+ + YVS   MK++QP++  ++E +K    +   K  
Sbjct: 355 VLKNFGLAILLLTLVIKLLMLPLSNRSYVSMFKMKSLQPEVARIKELYKNDSLK-QHKET 413

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           I L+K +N+NP++   PIL+QIPVFFA+YKV+ +++EMRHAPF  WIKDL+ +DPTNIFT
Sbjct: 414 IALFKKNNVNPMSSILPILVQIPVFFALYKVLFVTIEMRHAPFCLWIKDLSTSDPTNIFT 473

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP---ADKGQAMILNWMPVVFVFALS 532
           LFG+  +  P  + +GI PII+ ++M IQ K+        D  QA ++ + P + +F  S
Sbjct: 474 LFGLFNYNFP--ISIGILPIILGITMIIQQKIGEKGQTNKDDIQANVMKFFPYISIFIFS 531

Query: 533 SFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGL 566
           SFPAGL+IYW +SNVI+++QQ++I      ++G+
Sbjct: 532 SFPAGLVIYWIFSNVITLIQQSLIKLFLTRKLGI 565


>gi|149186358|ref|ZP_01864671.1| putative inner membrane protein translocase component YidC
           [Erythrobacter sp. SD-21]
 gi|148829947|gb|EDL48385.1| putative inner membrane protein translocase component YidC
           [Erythrobacter sp. SD-21]
          Length = 579

 Score =  348 bits (893), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 191/572 (33%), Positives = 310/572 (54%), Gaps = 28/572 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQ----NFYVYPRIEEMNNERKNIQTVKQP--------NQ 48
           ME + N+ + + LS+ ++  WQ    +FY  P     +N     +TV  P         +
Sbjct: 1   MENSRNFVLVLTLSLAVLIGWQWAMDHFYPQP-----DNVPVTAETVDTPAEAAAAASGE 55

Query: 49  VDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIV 108
           +  S A  +  D   +L  + R+ + +P + GSI + GA  DD+ L+ Y      +S  V
Sbjct: 56  IGESAATSV--DLESSLGAAERIRIDSPKVAGSIAVGGAMIDDIVLKDYAASPDGDSEPV 113

Query: 109 TLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILF 168
            + +P  T    +A+  ++     I   + + +W    G  L+   P+ L     N +L 
Sbjct: 114 RIFAPRGTDVQQYAQFGFLVNGAKI---SDDVLWE-SDGDTLSVGNPVTLRHDAGNGVLL 169

Query: 169 ERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKS 228
           E+T S+DE+Y+  +   V+N   + I   P G + R     + + F    G I   G   
Sbjct: 170 EQTYSIDENYMITVEQAVSNRGENGIVAQPFGLVGRTSTTMSDDFFIAHSGPIGSFGQAV 229

Query: 229 LVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAK 288
                YSD+E+    +   +  WLG +D YW +  +P   T   + F+ L  G   Y+A 
Sbjct: 230 EYGYDYSDVEEERKVSPSGTTDWLGFTDIYWLAALVPQAGTDPDATFRSL--GGDLYRAD 287

Query: 289 FSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFM 348
              + + +  G+ +TTT+ LFAGAK+   +  Y+ D  IP+F + IDWGWF +  KP   
Sbjct: 288 MIYDPVRVEAGRKVTTTSRLFAGAKDSEILDAYQ-DAGIPQFGLAIDWGWFRWFEKPFLW 346

Query: 349 LMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPP 408
           L+   + LVGNFG+AI++ T+ V+ L FP+A+KQ+ S A MK IQPK+ +L+E+ K    
Sbjct: 347 LLKNIFALVGNFGVAIIILTIIVRGLMFPIAQKQFASMAAMKAIQPKMKKLQERHKDDKV 406

Query: 409 QVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAA 468
           +  Q+ M +L+K   +NPLAGC P++LQIP+FFA+YKV+ +++EMRH  F  WI+DL+A 
Sbjct: 407 K-QQQEMQKLFKEEQVNPLAGCLPLILQIPIFFALYKVLYLAIEMRHQNFL-WIEDLSAP 464

Query: 469 DPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFV 528
           DP  I  LFG+LPF  P F+ +GI  +++ ++M++  K++P   D  Q  + + MP V +
Sbjct: 465 DPATILNLFGLLPFTPPSFLAIGILAVLLGVTMWLTFKLNPSAMDPVQQQVFSIMPWVLM 524

Query: 529 FALSSFPAGLIIYWSWSNVISIVQQAVIMKMH 560
           F ++ F AGL++YW  SNV+++ QQ  +   H
Sbjct: 525 FIMAPFAAGLLLYWVTSNVLTLAQQKYLYSKH 556


>gi|161544990|ref|YP_153758.2| putative inner membrane protein translocase component YidC
           [Anaplasma marginale str. St. Maries]
          Length = 572

 Score =  348 bits (892), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 184/507 (36%), Positives = 294/507 (57%), Gaps = 14/507 (2%)

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           R  A++  PRV L N S+  SI+LKGA  DD++L  Y +    +S  V L+SP  T+   
Sbjct: 58  RVDAINSVPRVRLGNTSVRASISLKGALVDDVSLTKYQVSTDKHSENVVLMSPEGTREDS 117

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF 180
             E  ++   +  ++P+ NT+W +  G   +      L + N   ++F    S+D  Y+F
Sbjct: 118 IVEFGWIDPEHKTKVPDKNTLWEVEQGSEASGEGSATLRWDNGQGLVFRLRFSIDRAYMF 177

Query: 181 KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS 240
            +   V N++ + +R S  GRI +   Q   + +   EG I   G   L E  Y D++K 
Sbjct: 178 SVSQEVENSTGEDLRLSYYGRINKAHAQDGKSYWISHEGAIGSFG-HGLQEWTYKDMQKG 236

Query: 241 SISNFHESNS-----WLGISDKYWASVFIPSKET---SFHSQFKYLSDGHARYQAKFSAN 292
           S +    +N      W+G++DKYW +  +PS +    +F ++    +D    +Q  FS +
Sbjct: 237 SGARVGATNEGTGSHWIGLADKYWFTALVPSSDKGKLAFRAKHVPRNDVD-HFQVDFSRS 295

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
             TI  G    +T  LF GAKE   + +Y   L IP F+  +D+G  YFI KP+F L+ Y
Sbjct: 296 YGTIPAGGKAESTTQLFIGAKELAVLDNYRSGLNIPLFDKAVDFGVLYFITKPVFQLLQY 355

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
           F+ +VGNFG+AI++ T+ +KL+ FPL+ K YVS   +K +QP+I  +RE  K    ++  
Sbjct: 356 FHKVVGNFGLAIVMLTIAIKLVVFPLSSKSYVSMFKLKKLQPEISRIRELHKTDDVRI-S 414

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           K +  L++ H ++P++G  PIL+QIPVFFA+YKV+ +++EMRHAP + WI+DL++ D  N
Sbjct: 415 KEISALFRKHGVSPMSGFLPILVQIPVFFALYKVLFVTIEMRHAPLFAWIQDLSSHDTAN 474

Query: 473 IFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMS-PPPADKGQAMILNWMPVVFVFAL 531
           +  LFG+L F  P  + VG+ PII+ ++M +Q K++    A +    ++ ++P VFVF  
Sbjct: 475 LLNLFGLLRFEPP--ICVGVLPIILGITMVLQQKINQQDQATQDPYGVMKFLPYVFVFIF 532

Query: 532 SSFPAGLIIYWSWSNVISIVQQAVIMK 558
           SSFPAGL++YW  SNVI+++QQ  + +
Sbjct: 533 SSFPAGLVLYWICSNVITMLQQLFVRR 559


>gi|255003028|ref|ZP_05277992.1| putative inner membrane protein translocase component YidC
           [Anaplasma marginale str. Puerto Rico]
          Length = 647

 Score =  348 bits (892), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 184/507 (36%), Positives = 294/507 (57%), Gaps = 14/507 (2%)

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           R  A++  PRV L N S+  SI+LKGA  DD++L  Y +    +S  V L+SP  T+   
Sbjct: 133 RVDAINSVPRVRLGNTSVRASISLKGALVDDVSLTKYQVSTDKHSENVVLMSPEGTREDS 192

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF 180
             E  ++   +  ++P+ NT+W +  G   +      L + N   ++F    S+D  Y+F
Sbjct: 193 IVEFGWIDPEHKTKVPDKNTLWEVEQGSEASGEGSATLRWDNGQGLVFRLRFSIDRAYMF 252

Query: 181 KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS 240
            +   V N++ + +R S  GRI +   Q   + +   EG I   G   L E  Y D++K 
Sbjct: 253 SVSQEVENSTGEDLRLSYYGRINKAHAQDGKSYWISHEGAIGSFG-HGLQEWTYKDMQKG 311

Query: 241 SISNFHESNS-----WLGISDKYWASVFIPSKET---SFHSQFKYLSDGHARYQAKFSAN 292
           S +    +N      W+G++DKYW +  +PS +    +F ++    +D    +Q  FS +
Sbjct: 312 SGARVGATNEGTGSHWIGLADKYWFTALVPSSDKGKLAFRAKHVPRNDVD-HFQVDFSRS 370

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
             TI  G    +T  LF GAKE   + +Y   L IP F+  +D+G  YFI KP+F L+ Y
Sbjct: 371 YGTIPAGGKAESTTQLFIGAKELAVLDNYRSGLNIPLFDKAVDFGVLYFITKPVFQLLQY 430

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
           F+ +VGNFG+AI++ T+ +KL+ FPL+ K YVS   +K +QP+I  +RE  K    ++  
Sbjct: 431 FHKVVGNFGLAIVMLTIAIKLVVFPLSSKSYVSMFKLKKLQPEISRIRELHKTDDVRI-S 489

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           K +  L++ H ++P++G  PIL+QIPVFFA+YKV+ +++EMRHAP + WI+DL++ D  N
Sbjct: 490 KEISALFRKHGVSPMSGFLPILVQIPVFFALYKVLFVTIEMRHAPLFAWIQDLSSHDTAN 549

Query: 473 IFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMS-PPPADKGQAMILNWMPVVFVFAL 531
           +  LFG+L F  P  + VG+ PII+ ++M +Q K++    A +    ++ ++P VFVF  
Sbjct: 550 LLNLFGLLRFEPP--ICVGVLPIILGITMVLQQKINQQDQATQDPYGVMKFLPYVFVFIF 607

Query: 532 SSFPAGLIIYWSWSNVISIVQQAVIMK 558
           SSFPAGL++YW  SNVI+++QQ  + +
Sbjct: 608 SSFPAGLVLYWICSNVITMLQQLFVRR 634


>gi|222475049|ref|YP_002563464.1| 60kD inner-membrane protein (yidC) [Anaplasma marginale str.
           Florida]
 gi|255004151|ref|ZP_05278952.1| putative inner membrane protein translocase component YidC
           [Anaplasma marginale str. Virginia]
 gi|56387916|gb|AAV86503.1| 60 kD inner-membrane protein [Anaplasma marginale str. St. Maries]
 gi|222419185|gb|ACM49208.1| 60kD inner-membrane protein (yidC) [Anaplasma marginale str.
           Florida]
          Length = 647

 Score =  348 bits (892), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 184/507 (36%), Positives = 294/507 (57%), Gaps = 14/507 (2%)

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           R  A++  PRV L N S+  SI+LKGA  DD++L  Y +    +S  V L+SP  T+   
Sbjct: 133 RVDAINSVPRVRLGNTSVRASISLKGALVDDVSLTKYQVSTDKHSENVVLMSPEGTREDS 192

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF 180
             E  ++   +  ++P+ NT+W +  G   +      L + N   ++F    S+D  Y+F
Sbjct: 193 IVEFGWIDPEHKTKVPDKNTLWEVEQGSEASGEGSATLRWDNGQGLVFRLRFSIDRAYMF 252

Query: 181 KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS 240
            +   V N++ + +R S  GRI +   Q   + +   EG I   G   L E  Y D++K 
Sbjct: 253 SVSQEVENSTGEDLRLSYYGRINKAHAQDGKSYWISHEGAIGSFG-HGLQEWTYKDMQKG 311

Query: 241 SISNFHESNS-----WLGISDKYWASVFIPSKET---SFHSQFKYLSDGHARYQAKFSAN 292
           S +    +N      W+G++DKYW +  +PS +    +F ++    +D    +Q  FS +
Sbjct: 312 SGARVGATNEGTGSHWIGLADKYWFTALVPSSDKGKLAFRAKHVPRNDVD-HFQVDFSRS 370

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
             TI  G    +T  LF GAKE   + +Y   L IP F+  +D+G  YFI KP+F L+ Y
Sbjct: 371 YGTIPAGGKAESTTQLFIGAKELAVLDNYRSGLNIPLFDKAVDFGVLYFITKPVFQLLQY 430

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
           F+ +VGNFG+AI++ T+ +KL+ FPL+ K YVS   +K +QP+I  +RE  K    ++  
Sbjct: 431 FHKVVGNFGLAIVMLTIAIKLVVFPLSSKSYVSMFKLKKLQPEISRIRELHKTDDVRI-S 489

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           K +  L++ H ++P++G  PIL+QIPVFFA+YKV+ +++EMRHAP + WI+DL++ D  N
Sbjct: 490 KEISALFRKHGVSPMSGFLPILVQIPVFFALYKVLFVTIEMRHAPLFAWIQDLSSHDTAN 549

Query: 473 IFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMS-PPPADKGQAMILNWMPVVFVFAL 531
           +  LFG+L F  P  + VG+ PII+ ++M +Q K++    A +    ++ ++P VFVF  
Sbjct: 550 LLNLFGLLRFEPP--ICVGVLPIILGITMVLQQKINQQDQATQDPYGVMKFLPYVFVFIF 607

Query: 532 SSFPAGLIIYWSWSNVISIVQQAVIMK 558
           SSFPAGL++YW  SNVI+++QQ  + +
Sbjct: 608 SSFPAGLVLYWICSNVITMLQQLFVRR 634


>gi|254796769|ref|YP_003081605.1| inner membrane protein, 60 kDa [Neorickettsia risticii str.
           Illinois]
 gi|254590012|gb|ACT69374.1| inner membrane protein, 60 kDa [Neorickettsia risticii str.
           Illinois]
          Length = 585

 Score =  345 bits (884), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 199/568 (35%), Positives = 322/568 (56%), Gaps = 30/568 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M++ +N F+A  LS +++  W   +  P   E  +E    ++VK    ++++ +      
Sbjct: 20  MQQTYNVFIATLLSFLVIIGWNLVFYNPAQRESLHEVPKRESVKVYESLESTLS------ 73

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
                  + R+++ +  L GSI L G   DDL L+ Y  D         LL P+ TK AY
Sbjct: 74  -------TERIKISSSKLEGSIQLTGLALDDLILKDYKSDDLKGQ--YRLLYPNKTKGAY 124

Query: 121 FAELDYVSTAN-NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYL 179
           F    +    +  +  P+S T W   S ++LTP  P+   + N + +LF+  +S+D++Y+
Sbjct: 125 FINPGWTIPGDAGLRTPSSKTKWQADS-ELLTPGNPVTFSWDNRSGLLFKVVVSVDDNYM 183

Query: 180 FKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEK 239
           F     V N S + +       I +  P+T  +   + EG + V+ D+ L+E KYS I K
Sbjct: 184 FTFKQIVENKSQNDLSVGSHFTITKRLPETNKSMLIMHEGPVGVIKDQ-LIELKYSKIAK 242

Query: 240 SSIS-----NFHESNSWLGISDKYW--ASVFIPSKETSFH-SQFKYLSDGHARYQAKFSA 291
            + S     +    + W G SDKYW  + +F  S +   + S     SD   R    F+A
Sbjct: 243 KNKSIAFDEDAQNQHGWFGFSDKYWFVSQIFENSSDGKLYISHVDDKSDDIFRI-TNFNA 301

Query: 292 NEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMS 351
            +I +  G  IT    LFAG K+   +  Y +++ I  F+  +D+G  YFI KP+  L+ 
Sbjct: 302 QKI-VRGGGFITKETMLFAGPKKLSLLEEYAQNMRIYLFDRAVDFGVLYFITKPISKLLQ 360

Query: 352 YFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVL 411
            FY+LVGNFG+AI+L T F+++L  PL+ K  +S   +K +QP+I +++  + Q+    L
Sbjct: 361 VFYHLVGNFGVAIILLTFFIRVLMLPLSIKSGISMFKIKELQPEILKIKSIY-QNDKDAL 419

Query: 412 QKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPT 471
            +A ++L++ H + P++GC P LLQ+PVFFA+YKVI I++EMR APF+ WI DL+  DPT
Sbjct: 420 NRASVELFRKHRVTPMSGCLPTLLQVPVFFALYKVIFITIEMRQAPFFLWISDLSLPDPT 479

Query: 472 NIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKG-QAMILNWMPVVFVFA 530
           N+FTLFG++ +  P F+ +GI PII+ L+M IQ K+SP   + G QA ++  MP VF+  
Sbjct: 480 NLFTLFGLINWNCPDFLSIGILPIILGLTMVIQQKLSPSHYEDGTQAFMIKAMPYVFMIL 539

Query: 531 LSSFPAGLIIYWSWSNVISIVQQAVIMK 558
            +SFP+GL++YW ++N++S+VQQ +I +
Sbjct: 540 FASFPSGLVLYWVFNNILSLVQQFMIGR 567


>gi|88608477|ref|YP_506289.1| inner membrane protein, 60 kDa [Neorickettsia sennetsu str.
           Miyayama]
 gi|88600646|gb|ABD46114.1| inner membrane protein, 60 kDa [Neorickettsia sennetsu str.
           Miyayama]
          Length = 566

 Score =  345 bits (884), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 200/568 (35%), Positives = 322/568 (56%), Gaps = 30/568 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M++ +N F+A  LS +++  W   +  P   E  +E +  ++VK    ++++ +      
Sbjct: 1   MQQTYNVFIATLLSFLVIIGWNLVFYNPTQRESFHEVQKKESVKVYESLESTLS------ 54

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
                  + R+++ +  L GSI L G   DDL L+ Y  D   +     LL P+ TK AY
Sbjct: 55  -------TERIKISSSKLEGSIQLTGLALDDLILKDYKSDDLKDQ--YRLLYPNKTKGAY 105

Query: 121 FAELDYVSTAN-NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYL 179
           F    +    +  +  P+S T W   S ++LTP +P+   + N   +LF+  +S+D++Y+
Sbjct: 106 FINPGWTIPGDPGLRTPSSKTKWQADS-ELLTPGSPVTFSWDNGFGLLFKVVVSIDDNYM 164

Query: 180 FKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEK 239
           F     V N S + +       I +  P+T  +   + EG + V+ D+ L+E KYS I K
Sbjct: 165 FTFKQIVENKSQNDLSVGSHFTITKSLPETNKSMLIMHEGPVGVVKDQ-LMELKYSKIAK 223

Query: 240 SSIS-----NFHESNSWLGISDKYW--ASVFIPSKETSFH-SQFKYLSDGHARYQAKFSA 291
            + S     +      W G SDKYW  + +F  S +   + S     SD   R    F+A
Sbjct: 224 KNKSIAFDEDTQNQRGWFGFSDKYWFVSQIFENSSDGKVYISHIDDKSDDIFRI-TNFNA 282

Query: 292 NEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMS 351
            +I +  G  I     LFAG K+   +  Y +++ I  F+  +D+G  YFI KP+  L+ 
Sbjct: 283 QKI-VRGGGLIVKETMLFAGPKKLSLLEEYAQNMRIYLFDRAVDFGVLYFITKPISKLLQ 341

Query: 352 YFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVL 411
            F++LVGNFG+AI+L T F+++L  PL+ K  +S   +K +QP+I +++  + Q+    L
Sbjct: 342 VFHHLVGNFGVAIILLTFFIRVLMLPLSIKSGISMFKIKELQPEILKIKSMY-QNDKDAL 400

Query: 412 QKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPT 471
            +A ++L++ H + P++GC P LLQ+PVFFA+YKVI I++EMR APF+ WI DL+  DPT
Sbjct: 401 NRASVELFRKHRVTPMSGCLPTLLQVPVFFALYKVIFITVEMRQAPFFLWISDLSLPDPT 460

Query: 472 NIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKG-QAMILNWMPVVFVFA 530
           N+FTLFG++ +  P F+ +GI PII+ L+M IQ K+SP   D G QA ++  MP VF+  
Sbjct: 461 NLFTLFGLIDWNCPDFLSIGILPIILGLTMVIQQKLSPSHYDDGTQAFMIKAMPYVFMIL 520

Query: 531 LSSFPAGLIIYWSWSNVISIVQQAVIMK 558
            +SFP+GL++YW ++NV+S++QQ VI K
Sbjct: 521 FASFPSGLVLYWVFNNVLSLLQQFVIGK 548


>gi|114798266|ref|YP_759144.1| inner membrane protein, 60 kDa [Hyphomonas neptunium ATCC 15444]
 gi|114738440|gb|ABI76565.1| inner membrane protein, 60 kDa [Hyphomonas neptunium ATCC 15444]
          Length = 606

 Score =  336 bits (862), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 203/590 (34%), Positives = 306/590 (51%), Gaps = 36/590 (6%)

Query: 6   NYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQ-A 64
           N+ +A+A  +  V+ +Q F + P  +    E+      +Q    D   A +L     + A
Sbjct: 8   NFLIAMAAMIAFVFLYQYFVMEPAQKRYEAEQAVAVAAEQAAVTDTGVAEILGPKSLEDA 67

Query: 65  LSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAEL 124
           L+   RV+    ++ G+I L GA+ DDL+L+ ++  V   + I  LL P  T+ AYF   
Sbjct: 68  LAEDGRVKFDANAVDGTIRLAGARIDDLSLKQFYTTVEREAEI-RLLRPEATEGAYFG-- 124

Query: 125 DYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVD 184
            Y     N  +   N+VW  + G  LT  TP+ L  +    +  +R IS+D +Y+F   D
Sbjct: 125 TYYWADGNALVAGRNSVWTQVGGDTLTTATPVTLRLET-EGMTIDREISIDANYMFSFRD 183

Query: 185 TVTNNSIDQIRFSPRGRIMRH----------KPQTATNT-------FGVQEGFIAVLGDK 227
           T+TN S         G   RH           P +AT+         GV +G + +   K
Sbjct: 184 TLTNTSGAARTVRAIGSFERHGDWKRFLEITDPASATSGGPAHLGLMGVADGELRLQKYK 243

Query: 228 SLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR-YQ 286
            L++ K    E    + F +   W G++D YW    +P +   F +     S       +
Sbjct: 244 PLMQSKKISGESGEGTFFSDEGGWWGLTDMYWMGALVPEQARPFTASVNRASLARGGPLE 303

Query: 287 AKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPM 346
            +     I + PG S+T  N LFAGAK+F  +  YEK   +PRF   IDWGW YF+ KP 
Sbjct: 304 VRTEGAAIEVAPGASVTVENGLFAGAKQFEVLQGYEKS-GLPRFVDAIDWGWAYFLTKPF 362

Query: 347 FMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQS 406
           F ++ +    +G+FG +I+  TV VKL   PL    + S A +K +Q  + +L E+F  +
Sbjct: 363 FYVLHWLNGYLGSFGWSILAFTVLVKLPLVPLYNASFKSMAKLKKLQEPMKQLNERFA-A 421

Query: 407 PPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLA 466
            PQ  Q+ +++LYK    NP+ GC PIL  IP+F+A+YK + +SLEMRHAPF  ++KDL+
Sbjct: 422 DPQRKQQELMKLYKEEGANPIGGCLPILFTIPIFYALYKTLYVSLEMRHAPF-AYLKDLS 480

Query: 467 AADPTNIFTLFGILPFYLPG----------FMHVGIWPIIMSLSMFIQMKMSPPPADKGQ 516
           A DPT I  LFG++PF+              + +GI PI+   +M     +SPPP DK Q
Sbjct: 481 APDPTAIGNLFGLIPFWSGADVKSIPIIGIIIGIGILPILYGATMAALQSLSPPPPDKMQ 540

Query: 517 AMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGL 566
           A I+  MP+VF+F    F AGL++YW WSNV++ +QQ +IM+M+G E  L
Sbjct: 541 ARIIMAMPIVFMFVFGGFAAGLVMYWVWSNVLTFIQQYIIMRMNGVETEL 590


>gi|260753817|ref|YP_003226710.1| inner membrane protein translocase component YidC [Zymomonas
           mobilis subsp. mobilis NCIMB 11163]
 gi|258553180|gb|ACV76126.1| 60 kDa inner membrane insertion protein [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 579

 Score =  336 bits (861), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 176/518 (33%), Positives = 291/518 (56%), Gaps = 10/518 (1%)

Query: 63  QALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFA 122
           Q L  +PR+ +   S+ GS+NLKG + DDL L  +   ++ NSP V L SP+ T+NA+F 
Sbjct: 65  QVLQETPRLPILTESVEGSVNLKGLRLDDLTLIRHRETLAKNSPAVRLFSPAGTENAWFT 124

Query: 123 ELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKI 182
              +  T  N+ LPN++++W   S K LT   P+   + N    +F  T+S+D  Y+F  
Sbjct: 125 SFGW--TGENVALPNADSLWKADSDK-LTAEHPVNFYWNNQQGQIFRITLSVDHDYMFNA 181

Query: 183 VDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSI 242
            ++V N     +   P             +++ +  G I V          ++DI+K++ 
Sbjct: 182 TESVINRGNSPVIVQPYVLTNHQGVFKTASSWTLHTGPIGVFNGSVNYHVDFADIDKATN 241

Query: 243 SNFHES--NSWLGISDKYWASVFIP-SKETSFHSQFKYLSDGHARYQAKFSANEITILPG 299
           ++   S    W+G SDKYW +   P +++ +  + F+  S+ H  YQA F+   + +  G
Sbjct: 242 NSIRNSTQGGWIGFSDKYWLTALAPHNQKIAIDTDFRSSSNHH--YQADFTVAPVMVAAG 299

Query: 300 KSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGN 359
           K+ +T+  +FAGAKE   +  Y   L +P F+  IDWGWF  I K  F  + + +  VGN
Sbjct: 300 KTASTSVDVFAGAKEVRVLDRYRDQLHLPHFDKAIDWGWFAIIEKVFFYYLDWLFLHVGN 359

Query: 360 FGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLY 419
           +G+AI+L    ++ L FP+A KQY S A+M+ +QPK+  +RE++K    ++ Q+ ++ LY
Sbjct: 360 YGLAIILMVFTIRALIFPIANKQYASMASMRRLQPKMQAVRERYKNDEARMRQE-LVTLY 418

Query: 420 KTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGI 479
           +   +NP AGC P+ +Q P+F A+YK + +++E RH PF  WIKDL+A DP   F LFG+
Sbjct: 419 QKEKVNPFAGCLPMFIQFPIFIALYKTLLVTIESRHQPFILWIKDLSAPDPLTPFNLFGL 478

Query: 480 LPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLI 539
           L F  P F+ +G+ PII+ ++M++Q + SP   +  Q  I++++P++ V  ++   AGL 
Sbjct: 479 LHFTPPHFLMIGVLPIILGITMWLQFRASPQQLEPAQQQIMSFLPLISVIFMAPLAAGLQ 538

Query: 540 IYWSWSNVISIVQQAVIMKMHGAEIGLIDRL-RSTFSK 576
           +Y+ ++N+IS+ Q   +   H       DR  R   SK
Sbjct: 539 VYYIFNNLISLAQMMWLQHRHSTPEERQDRAERKRLSK 576


>gi|241762238|ref|ZP_04760320.1| 60 kDa inner membrane insertion protein [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241373285|gb|EER62904.1| 60 kDa inner membrane insertion protein [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 579

 Score =  335 bits (859), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 178/519 (34%), Positives = 291/519 (56%), Gaps = 12/519 (2%)

Query: 63  QALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFA 122
           Q L  +PR+ +   S+ GS+NLKG + DDL L  +   ++ NSP V L SP+ T+NA+F 
Sbjct: 65  QVLQETPRLPILTESVEGSVNLKGLRLDDLTLIRHRETLAKNSPAVRLFSPAGTENAWFT 124

Query: 123 ELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKI 182
              +  T  N+ LPN++++W   S K LT   P+   + N    +F  T+S+D  Y+F  
Sbjct: 125 SFGW--TGENVALPNADSLWKADSDK-LTADHPVNFYWNNQQGQIFRITLSVDHDYMFNA 181

Query: 183 VDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS-- 240
            ++V N     +   P             +++ +  G I V          ++DI+K+  
Sbjct: 182 TESVINRGNSPVIVQPYVLTNHQGVFKTASSWTLHTGPIGVFNGSVNYHVDFADIDKATN 241

Query: 241 -SISNFHESNSWLGISDKYWASVFIP-SKETSFHSQFKYLSDGHARYQAKFSANEITILP 298
            SI N +    W+G SDKYW +   P +++ +  + F+  S+ H  YQA F+   + +  
Sbjct: 242 NSIRN-NTQGGWIGFSDKYWLTALAPHNQKIAIDTDFRSSSNHH--YQADFTVAPVVVAA 298

Query: 299 GKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVG 358
           GK+ +T+  +FAGAKE   +  Y   L +P F+  IDWGWF  I K  F  + + +  VG
Sbjct: 299 GKTASTSVDVFAGAKEVRVLDRYRDQLHLPHFDKAIDWGWFAIIEKVFFYYLDWLFLHVG 358

Query: 359 NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQL 418
           N+G+AI+L    ++ L FP+A KQY S A+M+ +QPK+  +RE++K    ++ Q+ ++ L
Sbjct: 359 NYGLAIILMVFTIRALIFPIANKQYASMASMRRLQPKMQAVRERYKNDEARMRQE-LVTL 417

Query: 419 YKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFG 478
           Y+   +NP AGC P+ +Q P+F A+YK + +++E RH PF  WIKDL+A DP   F LFG
Sbjct: 418 YQKEKVNPFAGCLPMFIQFPIFIALYKTLLVTIESRHQPFILWIKDLSAPDPLTPFNLFG 477

Query: 479 ILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGL 538
           +L F  P F+ +G+ PII+ ++M++Q + SP   +  Q  I++++P++ V  ++   AGL
Sbjct: 478 LLHFTPPHFLMIGVLPIILGITMWLQFRASPQQLEPAQQQIMSFLPLISVIFMAPLAAGL 537

Query: 539 IIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL-RSTFSK 576
            +Y+ ++N+IS+ Q   +   H       DR  R   SK
Sbjct: 538 QVYYIFNNLISLAQMMWLQHRHSTPEERQDRAERKRLSK 576


>gi|56552522|ref|YP_163361.1| putative inner membrane protein translocase component YidC
           [Zymomonas mobilis subsp. mobilis ZM4]
 gi|59803051|sp|Q9RNL5|OXAA_ZYMMO RecName: Full=Inner membrane protein oxaA
 gi|56544096|gb|AAV90250.1| YidC translocase/secretase [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 579

 Score =  334 bits (857), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 175/511 (34%), Positives = 288/511 (56%), Gaps = 11/511 (2%)

Query: 63  QALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFA 122
           Q L  +PR+ +   S+ GS+NLKG + DDL L  +   ++ NSP V L SP+ T+NA+F 
Sbjct: 65  QVLQETPRLPILTESVEGSVNLKGLRLDDLTLIRHRETLAKNSPAVRLFSPAGTENAWFT 124

Query: 123 ELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKI 182
              +  T  N+ LPN++++W   S K LT   P+   + N    +F  T+S+D  Y+F  
Sbjct: 125 SFGW--TGENVALPNADSLWKADSDK-LTADHPVNFYWNNQQGQIFRITLSVDHDYMFNA 181

Query: 183 VDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS-- 240
            ++V N     +   P             +++ +  G I V          ++DI+K+  
Sbjct: 182 TESVINRGNSPVIVQPYVLTNHQGVFKTASSWTLHTGPIGVFNGSVNYHVDFADIDKATN 241

Query: 241 -SISNFHESNSWLGISDKYWASVFIP-SKETSFHSQFKYLSDGHARYQAKFSANEITILP 298
            SI N +    W+G SDKYW +   P +++ +  + F+  S+ H  YQA F+   + +  
Sbjct: 242 NSIRN-NTQGGWIGFSDKYWLTALAPHNQKIAIDTDFRSSSNHH--YQADFTVAPVVVAA 298

Query: 299 GKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVG 358
           GK+ +T+  +FAGAKE   +  Y   L +P F+  IDWGWF  I K  F  + + +  VG
Sbjct: 299 GKTASTSVDVFAGAKEVRVLDRYRDQLHLPHFDKAIDWGWFAIIEKVFFYYLDWLFLHVG 358

Query: 359 NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQL 418
           N+G+AI+L    ++ L FP+A KQY S A+M+ +QPK+  +RE++K    ++ Q+ ++ L
Sbjct: 359 NYGLAIILMVFTIRALIFPIANKQYASMASMRRLQPKMQAVRERYKNDEARMRQE-LVTL 417

Query: 419 YKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFG 478
           Y+   +NP AGC P+ +Q P+F A+YK + +++E RH PF  WIKDL+A DP   F LFG
Sbjct: 418 YQKEKVNPFAGCLPMFIQFPIFIALYKTLLVTIESRHQPFILWIKDLSAPDPLTPFNLFG 477

Query: 479 ILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGL 538
           +L F  P F+ +G+ PII+ ++M++Q + SP   +  Q  I++++P++ V  ++   AGL
Sbjct: 478 LLHFTPPHFLMIGVLPIILGITMWLQFRASPQQLEPAQQQIMSFLPLISVIFMAPLAAGL 537

Query: 539 IIYWSWSNVISIVQQAVIMKMHGAEIGLIDR 569
            +Y+ ++N+IS+ Q   +   H       DR
Sbjct: 538 QVYYIFNNLISLAQMMWLQHRHSTPEERQDR 568


>gi|269958897|ref|YP_003328686.1| inner membrane protein translocase component YidC [Anaplasma
           centrale str. Israel]
 gi|269848728|gb|ACZ49372.1| inner membrane protein translocase component YidC [Anaplasma
           centrale str. Israel]
          Length = 572

 Score =  332 bits (851), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 182/511 (35%), Positives = 295/511 (57%), Gaps = 21/511 (4%)

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           RA A++  PRV L N +++ SI+LKGA  DD++L+ Y +    +S  V L+SP  T+   
Sbjct: 57  RADAVNSVPRVGLGNSNVLASISLKGALVDDVSLKKYQVSTDKHSENVVLMSPEGTQEDS 116

Query: 121 FAELDYVSTANNIELPNSNTVWNL-----ISGKILTPTTPIKLVFKNANNILFERTISLD 175
             E  ++   +++++P+ +T+W +       G   + TT   L + N   ++F    SLD
Sbjct: 117 IVEFGWIDPKHSVKVPDKSTLWEVEQNSAADGDGESHTT---LRWDNGQGLVFRLKFSLD 173

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
             Y+F +   V N++ + +  +  GRI +       + +   EG I   G + L E  Y 
Sbjct: 174 RAYMFSVSQEVENSTGEDLHLAYYGRINKAHAPDGKSYWISHEGAIGSFG-RGLQEWTYK 232

Query: 236 DIEKSSISNF--HE--SNSWLGISDKYWASVFIPSK---ETSFHSQFKYLSDGHARYQAK 288
           D++K +      HE   + W+G++DKYW +  +PS    + +F ++     D    +Q  
Sbjct: 233 DLQKENSIRVAAHEVAGSHWIGLADKYWFAALVPSSGGGKLAFRAK-HIPRDDVDHFQVD 291

Query: 289 FSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFM 348
           FS +   +  G     T  LF GAKE   +  Y   L IP F+  +D+G  YFI KP+F 
Sbjct: 292 FSRSYGLVPAGGKAEATTQLFIGAKELAVLDDYRSKLNIPLFDKAVDFGILYFITKPVFR 351

Query: 349 LMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPP 408
           L+ YF+ +VGNFG+AI++ T+ +KL+ FPLA K YVS   +K +QP+I  ++E +K    
Sbjct: 352 LLQYFHKVVGNFGLAIIMLTISIKLVVFPLASKSYVSMFKLKKLQPEISRIKELYKTDDV 411

Query: 409 QVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAA 468
           ++  K +  L++ H ++P++G  PIL+QIPVFFA+YKV+ +++EMRHAP   WI+DL++ 
Sbjct: 412 RI-GKEISSLFRKHGVSPVSGFLPILVQIPVFFALYKVLFVTIEMRHAPLCAWIQDLSSQ 470

Query: 469 DPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMS-PPPADKGQAMILNWMPVVF 527
           D  N+  LFG+L F  P  + +G+ PII+ ++M +Q K++    A      I+ ++P VF
Sbjct: 471 DTANLLNLFGLLQFDPP--VCIGVLPIILGVTMVLQQKLNQQDQAAHDPYGIMKFLPYVF 528

Query: 528 VFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           VF  SSFPAGL++YW  SNVI+I+QQ  + +
Sbjct: 529 VFIFSSFPAGLVLYWICSNVITILQQLFVRR 559


>gi|5932359|gb|AAD56912.1|AF180145_4 60KD inner-membrane protein yidC [Zymomonas mobilis subsp. mobilis
           ZM4]
          Length = 579

 Score =  331 bits (848), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 173/511 (33%), Positives = 286/511 (55%), Gaps = 11/511 (2%)

Query: 63  QALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFA 122
           Q L  +PR+ +   S+ GS+NLKG + DDL L  +   ++ NSP V L SP+ T+NA+F 
Sbjct: 65  QVLQETPRLPILTESVEGSVNLKGLRLDDLTLIRHRETLAKNSPAVRLFSPAGTENAWFT 124

Query: 123 ELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKI 182
              +  T  N+ LPN++++W   S K LT   P+   + N    +   T+ +D  Y+F  
Sbjct: 125 SFGW--TGENVALPNADSLWKADSDK-LTADHPVNFYWNNQQGQILRITLCVDHDYMFNA 181

Query: 183 VDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS-- 240
            ++V N     +   P             +++ +  G I V          ++DI+K+  
Sbjct: 182 TESVINRGNSPVIVQPYVLTNHQGVFKTASSWTLHTGPIGVFNGSVNYHVDFADIDKATN 241

Query: 241 -SISNFHESNSWLGISDKYWASVFIP-SKETSFHSQFKYLSDGHARYQAKFSANEITILP 298
            SI N +    W+G SDKYW +   P +++ +  + F+  S+ H  YQA F+   + +  
Sbjct: 242 NSIRN-NTQGGWIGFSDKYWLTALAPHNQKIAIDTDFRSSSNHH--YQADFTVAPVVVAA 298

Query: 299 GKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVG 358
           GK+ +T+  +FAGAKE   +  Y   L +P F+  IDWGWF  I K  F  + + +  VG
Sbjct: 299 GKTASTSVDVFAGAKEVRVLDRYRDQLHLPHFDKAIDWGWFAIIEKVFFYYLDWLFLHVG 358

Query: 359 NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQL 418
           N+G+AI+L    ++ L FP+A KQY S A+M+ +QPK+  +RE++K    ++ Q+ ++ L
Sbjct: 359 NYGLAIILMVFTIRALIFPIANKQYASMASMRRLQPKMQAVRERYKNDEARMRQE-LVTL 417

Query: 419 YKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFG 478
           Y+   +NP AGC P+ +Q P+F A+YK + +++E RH PF  WIKDL+A DP   F LFG
Sbjct: 418 YQKEKVNPFAGCLPMFIQFPIFIALYKTLLVTIESRHQPFILWIKDLSAPDPLTPFNLFG 477

Query: 479 ILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGL 538
           +L F  P F+ +G+ PII+ ++M++Q + SP   +  Q  I++++P++ V  ++   AGL
Sbjct: 478 LLHFTPPHFLMIGVLPIILGITMWLQFRASPQQLEPAQQQIMSFLPLISVIFMAPLAAGL 537

Query: 539 IIYWSWSNVISIVQQAVIMKMHGAEIGLIDR 569
            +Y+ ++N+IS+ Q   +   H       DR
Sbjct: 538 QVYYIFNNLISLAQMMWLQHRHSTPEERQDR 568


>gi|329114454|ref|ZP_08243216.1| Inner membrane protein OxaA [Acetobacter pomorum DM001]
 gi|326696530|gb|EGE48209.1| Inner membrane protein OxaA [Acetobacter pomorum DM001]
          Length = 594

 Score =  323 bits (828), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 178/567 (31%), Positives = 319/567 (56%), Gaps = 25/567 (4%)

Query: 9   VAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQALSM- 67
           +A  LS ++++ +   Y +P+ + +   ++ +  V  P    +  AA   + +A+A +  
Sbjct: 19  LATLLSALVLFGYD--YFFPQHQLVPPAQQGVHAVAPPAPASSGAAAPAENTQAEAAAPV 76

Query: 68  ----SPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAE 123
                 RV +  P++ G++NL+GA+ DDL L+ Y   V  +SP V +L+ ++T +A + +
Sbjct: 77  KDGPETRVAINAPAVQGTLNLRGARLDDLVLKHYRETVKPDSPDVRVLNSAST-HADYVD 135

Query: 124 LDYVSTAN-NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKI 182
             + + ++ ++ LP++NT+W   SG  +    P+ L + N   + F+  +S+D++Y+F I
Sbjct: 136 FGWRAPSDVSVRLPDANTLWK-ASGTQMDAEHPLTLSWDNGQGLTFDIRLSVDQNYMFTI 194

Query: 183 VDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSI 242
              V N++   +   P  R+ R      T    V EG I+V+ D  L E  Y  +    +
Sbjct: 195 SQQVHNSTGQAVALYPFYRVNRGYTPEETGGMLVHEGPISVI-DGRLNEGSYKTVRTGGV 253

Query: 243 S------NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANE-IT 295
                  +   +  W GI+DKYW    +P +  +    + + +     YQ  F+A   + 
Sbjct: 254 PPDNIAWSHQGTGGWAGITDKYWLMAVLPDQNANVIGTYGFQA-AQGAYQVGFTATAPVQ 312

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           +  G++ +T   +FAGAKE   +  YEKDL +P F   +D+GW  F+ +P+F ++ +   
Sbjct: 313 VAAGQTASTEAHVFAGAKEVRLLEQYEKDLHVPMFWKAVDFGWLSFLTRPVFFVLDWLNE 372

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
            +G+FG+A++  TV VK+ F PL  KQ   T     ++P++D +R + K  P   +Q+ +
Sbjct: 373 HLGSFGLALLTFTVIVKVAFLPLTIKQMRMTWKTARLKPQVDLIRSRLKDDP-MAMQQQI 431

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           + LY+  N+N   G  P+L+Q PVF+ +YK + +++EMRHAPF GW+KDL+A DPTN+F 
Sbjct: 432 MALYRQENVNLFGGFLPLLIQAPVFWCLYKDLYVTIEMRHAPFVGWVKDLSAPDPTNLFN 491

Query: 476 LFGILPF---YLPGFMHVGIWPIIMSLSMFIQMKMSPPPA--DKGQAMILNWMPVVFVFA 530
           LFG++PF   ++  F+ +G WPI+   ++F+  K+S   A  D  Q  ++ ++P++F F 
Sbjct: 492 LFGLIPFDPTHITPFLALGAWPIMYGATLFLMQKVSSSSANMDPSQQKVMMFIPLLFTFF 551

Query: 531 LSSFPAGLIIYWSWSNVISIVQQAVIM 557
           ++  P GL+IY+ WSN+++ VQQ VI+
Sbjct: 552 MARQPVGLVIYYCWSNILTAVQQVVII 578


>gi|258541762|ref|YP_003187195.1| translocase inner membrane component YidC [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256632840|dbj|BAH98815.1| translocase inner membrane component YidC [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256635897|dbj|BAI01866.1| translocase inner membrane component YidC [Acetobacter pasteurianus
           IFO 3283-03]
 gi|256638952|dbj|BAI04914.1| translocase inner membrane component YidC [Acetobacter pasteurianus
           IFO 3283-07]
 gi|256642006|dbj|BAI07961.1| translocase inner membrane component YidC [Acetobacter pasteurianus
           IFO 3283-22]
 gi|256645061|dbj|BAI11009.1| translocase inner membrane component YidC [Acetobacter pasteurianus
           IFO 3283-26]
 gi|256648116|dbj|BAI14057.1| translocase inner membrane component YidC [Acetobacter pasteurianus
           IFO 3283-32]
 gi|256651169|dbj|BAI17103.1| translocase inner membrane component YidC [Acetobacter pasteurianus
           IFO 3283-01-42C]
 gi|256654160|dbj|BAI20087.1| translocase inner membrane component YidC [Acetobacter pasteurianus
           IFO 3283-12]
          Length = 583

 Score =  323 bits (827), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 166/501 (33%), Positives = 290/501 (57%), Gaps = 18/501 (3%)

Query: 70  RVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVST 129
           RV +  P++ G++NL+GA+ DDL L+ Y   V  +SP V +L+ ++T +A + +  + + 
Sbjct: 72  RVAINAPAVQGTLNLRGARLDDLVLKHYRETVKPDSPDVRVLNSAST-HADYVDFGWRAP 130

Query: 130 AN-NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTN 188
           ++ ++ LP++NT+W   SG  +    P+ L + N   + F+  +S+D++Y+F I   V N
Sbjct: 131 SDVSVRLPDANTLWK-ASGTQMDAEHPLTLSWDNGQGLTFDIRMSVDQNYMFTISQQVHN 189

Query: 189 NSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSIS----- 243
           ++   +   P  R+ R      T    V EG I+V+ D  L E  Y  +    +      
Sbjct: 190 STGQAVALYPFYRVNRGYTPEGTGGMLVHEGPISVI-DGRLNEGSYKTVRTGGVPPDNIA 248

Query: 244 -NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANE-ITILPGKS 301
            +   +  W GI+DKYW    +P +  +    + + +     YQ  F+A   + +  G++
Sbjct: 249 WSHQGTGGWAGITDKYWLMAVLPDQNANVIGTYGFQA-AQGAYQVGFTATAPVQVAAGQT 307

Query: 302 ITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFG 361
            +T   +FAGAKE   +  YEKDL +P F   +D+GW  F+ +P+F ++ +    +G+FG
Sbjct: 308 ASTEAHVFAGAKEVRLLEQYEKDLHVPMFWKAVDFGWLSFLTRPVFFVLDWLNEHLGSFG 367

Query: 362 IAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKT 421
           +A++  TV VK+ F PL  KQ   T     ++P++D +R + K  P   +Q+ ++ LY+ 
Sbjct: 368 LALLTFTVIVKVAFLPLTIKQMRMTWKTARLKPQVDLIRSRLKDDP-MAMQQQIMALYRQ 426

Query: 422 HNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILP 481
            N+N   G  P+L+Q PVF+ +YK + +++EMRHAPF GW+KDL+A DPTN+F LFG++P
Sbjct: 427 ENVNLFGGFLPLLIQAPVFWCLYKDLYVTIEMRHAPFVGWVKDLSAPDPTNLFNLFGLVP 486

Query: 482 F---YLPGFMHVGIWPIIMSLSMFIQMKMSPPPA--DKGQAMILNWMPVVFVFALSSFPA 536
           F   ++  F+ +G WPI+   ++F+  K+S   A  D  Q  ++ ++P++F F ++  P 
Sbjct: 487 FDPTHITPFLALGAWPIMYGATLFLMQKVSSSSANMDPSQQKVMMFIPLLFTFFMARQPV 546

Query: 537 GLIIYWSWSNVISIVQQAVIM 557
           GL+IY+ WSN+++ VQQ +I+
Sbjct: 547 GLVIYYCWSNILTAVQQVIII 567


>gi|117927031|ref|YP_867648.1| protein translocase subunit yidC [Magnetococcus sp. MC-1]
 gi|166975874|sp|A0LE49|OXAA_MAGSM RecName: Full=Inner membrane protein oxaA
 gi|117610787|gb|ABK46242.1| protein translocase subunit yidC [Magnetococcus sp. MC-1]
          Length = 556

 Score =  286 bits (731), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 182/509 (35%), Positives = 279/509 (54%), Gaps = 44/509 (8%)

Query: 57  LIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNT 116
           LI+  A++L     +  KN  + GS++L+G +   ++    H DV    PI + +  S  
Sbjct: 78  LINTDAKSL-----LHFKNDLVEGSLSLQGGRLVGMDFL-QHTDVLGGKPI-SFMGISQV 130

Query: 117 KNAYFAELDYVSTANN-IELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD 175
           + +++ E  ++  A + I+ P++NT W LI  + L      KLV+ N   I+FE+  S  
Sbjct: 131 E-SFYQESGFLPVAGSAIKAPDANTQWQLIGKESLQGAGEFKLVWDNGEGIVFEKLFSFA 189

Query: 176 E-HYLFKIVDTVTNNSIDQI---RFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVE 231
           +  YLFK+ D + NNS   +    +S   RI     Q+       Q     + G++   +
Sbjct: 190 QGSYLFKVEDRLINNSAAALGVYHYSQFKRIPVINSQSMLAMSDFQGPMAYLNGER--YQ 247

Query: 232 QKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFK--YLSDGHARYQAKF 289
             Y D+    +        W G SDKY+ +  + +K     +Q +  Y       Y+   
Sbjct: 248 HSYEDLTAQDLRE-KGHGGWTGFSDKYFLAAMV-AKPLPPEAQPRRYYFDYDRPNYRVGM 305

Query: 290 SANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFML 349
             N + I  G+S+     LF G KE  T+      L     E  ID+GWF+F+A+P+  +
Sbjct: 306 VENSVIIPAGQSLAVDYDLFIGPKEISTLERSNLSL-----ERSIDYGWFHFLAEPLVKV 360

Query: 350 MSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQ 409
           +++F ++V N+G+AI+L T+ +KLLFFPLA K Y S   MK +QPKI+EL+ K   S   
Sbjct: 361 LNFFNSVVHNYGVAIILLTLAIKLLFFPLANKSYRSMNAMKKLQPKIEELK-KLHGSDRN 419

Query: 410 VLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAAD 469
            + +AM++LY+TH +NPL GC PIL+QIPVFFA+YKV+ +S+EMRHAPF  WI DL+A D
Sbjct: 420 KMNEAMMKLYQTHKVNPLGGCLPILVQIPVFFALYKVLFLSVEMRHAPFMLWIPDLSAMD 479

Query: 470 PTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVF 529
                      PFY        + P++M  SMF+Q K++P P+D  QA I+ ++PV+F  
Sbjct: 480 -----------PFY--------VLPLLMGGSMFLQSKLNPTPSDPMQAKIMMFLPVIFTV 520

Query: 530 ALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
              SFP+GL++YW  +NV+SI QQ  IMK
Sbjct: 521 MFLSFPSGLVLYWLVNNVLSISQQYYIMK 549


>gi|218461068|ref|ZP_03501159.1| putative inner membrane protein translocase component YidC
           [Rhizobium etli Kim 5]
          Length = 341

 Score =  275 bits (704), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 136/338 (40%), Positives = 192/338 (56%), Gaps = 16/338 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQ---------------TVKQ 45
           ME N NYF+AIALSV+IV  WQ  Y+ PRIE     ++  +               T   
Sbjct: 1   MENNRNYFIAIALSVLIVLGWQFLYMNPRIEAQRKAQEAQKAQQQTEQVQQPAAGGTTPA 60

Query: 46  PNQ-VDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
           P      S  A       QAL+ +PRV +  P+L GSINL GA+ DDL L+GYH  V  +
Sbjct: 61  PTSGTAPSGQAAATATLEQALAKNPRVVIDTPALSGSINLAGARLDDLKLKGYHETVDDS 120

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           SPI+TL SP+ TK+ YF EL Y+ +     +P ++T+W    G  LT  TP+ L + N  
Sbjct: 121 SPIITLFSPAETKDGYFTELGYIGSDATGAVPGASTLWTAPEGAKLTEKTPVTLSYTNDK 180

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVL 224
            + F RTIS+DE Y+F + D + N     +  S  GR+ R+   T  + + + EGFI V+
Sbjct: 181 GLTFTRTISVDERYMFTVADKIENTGQAPVSLSSYGRVTRYNKPTTPSVYVLHEGFIGVI 240

Query: 225 GDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR 284
           GD  LVE KYS +EK ++     +  WLGI+DKYWA+  +P + +++ ++F + +DG  R
Sbjct: 241 GDDGLVETKYSAVEKEAVMPAKSTGGWLGITDKYWAATIVPPQTSAYEARFSHFADGQPR 300

Query: 285 YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYE 322
           YQA +  +  T+ PG+SI   N +FAGAKE P I  YE
Sbjct: 301 YQADYKDDAFTVAPGQSIELKNLVFAGAKEVPVIDGYE 338


>gi|99034074|ref|ZP_01314196.1| hypothetical protein Wendoof_01001014 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 341

 Score =  256 bits (654), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 140/338 (41%), Positives = 212/338 (62%), Gaps = 10/338 (2%)

Query: 222 AVLG--DKSLVEQKYSDIEKSSISNFHESN-SWLGISDKYWASVFIPSKETSFHSQFKYL 278
            VLG  D  L E  Y DI K  +     S  +W G +DKYW +  IP K    +   K+ 
Sbjct: 7   GVLGAFDNKLEEWTYKDISKKHLIKASTSEKNWFGFADKYWLTAIIPEKSDKINVSIKHT 66

Query: 279 S-DGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWG 337
           + +   ++Q  F     +ILPG S++  N+ FAGAK+   +  Y+  L IP F+  +D+G
Sbjct: 67  NVNNTDKFQVDFVKPYKSILPGASVSNVNYFFAGAKKLNLLDSYKDTLNIPLFDKAVDFG 126

Query: 338 WFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKID 397
             YFI KP+F+L+ YF  ++ NFG+AI+L T+ +KLL   L  + Y+S   +K++QP++ 
Sbjct: 127 VLYFITKPVFLLLEYFNFVLKNFGLAILLLTLVIKLLMLSLFNRSYISMFKVKSLQPELT 186

Query: 398 ELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAP 457
            ++E +K    +   K  I L+K +N+NP++  +P+L+QIPVFFA+YKV+ +++EMRHAP
Sbjct: 187 RIKELYKNDSLKQ-HKETIALFKRNNVNPMSSIFPMLIQIPVFFALYKVLFVTIEMRHAP 245

Query: 458 FWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPP---PADK 514
           F+ WIKDL+A DPTNIFTLFG+  +  P  + +GI PII   +M IQ K+S       D 
Sbjct: 246 FFLWIKDLSAPDPTNIFTLFGLFNYNFP--ISIGILPIIFGATMIIQQKLSEKDQTSKDD 303

Query: 515 GQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQ 552
            Q  ++ ++P + VF  SSFPAGL+IYW +SN+I+++Q
Sbjct: 304 IQVNVMKFLPYISVFIFSSFPAGLVIYWIFSNIITLIQ 341


>gi|118582022|ref|YP_903272.1| 60 kDa inner membrane insertion protein [Pelobacter propionicus DSM
           2379]
 gi|166975879|sp|A1AV44|OXAA_PELPD RecName: Full=Inner membrane protein oxaA
 gi|118504732|gb|ABL01215.1| protein translocase subunit yidC [Pelobacter propionicus DSM 2379]
          Length = 542

 Score =  243 bits (619), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 132/335 (39%), Positives = 198/335 (59%), Gaps = 19/335 (5%)

Query: 226 DKSLVEQKYSDIEKSSISNFHESN-SWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR 284
           D SL   K  D+  SS S  ++ N  W G +DKY+ +  +   E    +  +   +G   
Sbjct: 223 DNSLESDKLKDV--SSASKLYDKNLQWSGFADKYFLTAIL--SEGGSIASVELRKNGAGF 278

Query: 285 YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAK 344
            ++  S+  IT+ PG+S+T  + LF G K+   +      L     E  +D GWF  IAK
Sbjct: 279 LESTVSSPRITVTPGQSVTVVHRLFVGPKDIDILKAQGNSL-----EQSLDLGWFTVIAK 333

Query: 345 PMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK 404
           P+   + YFY  VGN+G+AI++ T+ +K LFFPL  K Y S  +M+ IQP +  L+EK+K
Sbjct: 334 PLLYTLKYFYRYVGNYGVAIIIITIILKALFFPLTHKSYKSMKDMQKIQPMMAALKEKYK 393

Query: 405 QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKD 464
               + + KA+++LY+ H +NPL GC P+L+QIPVFFA+YK +  S+E+RHAPF+ WI D
Sbjct: 394 DDR-EGMNKAVMELYRDHKVNPLGGCLPMLVQIPVFFALYKALMFSIELRHAPFYFWITD 452

Query: 465 LAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMP 524
           L+   P N+F     LPF       +G  P++M  +MFIQ KM+P   D  QA ++  +P
Sbjct: 453 LSG--PDNLFGQMLGLPFV------IGPLPLLMGATMFIQQKMTPSTMDPMQAKMMLALP 504

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKM 559
           VVF F   +FP+GL++YW  +N+++I QQ  I K+
Sbjct: 505 VVFTFMFLNFPSGLVLYWLLNNILTIGQQMYINKL 539


>gi|308273509|emb|CBX30111.1| hypothetical protein N47_D29200 [uncultured Desulfobacterium sp.]
          Length = 551

 Score =  239 bits (610), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 171/575 (29%), Positives = 281/575 (48%), Gaps = 49/575 (8%)

Query: 7   YFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNS-----YAAVLIDDR 61
           + +A+ALS I+   W  FY   +  +   E +NI   + P  VDN        +   DD 
Sbjct: 6   FIIAVALSFIVFLGWDYFYNDKKPAKQITEVQNIDKRQSP--VDNKNINPPEKSSQSDDT 63

Query: 62  AQALSMSPRV-ELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSP---SNTK 117
               +   RV E+  P     IN K A      L+ Y+  +  +SP   L+     + T 
Sbjct: 64  VFQENKPLRVFEINTPLYSVKINEKNAAITSFKLKKYNETIDVDSPKKELIPKDLNTGTV 123

Query: 118 NAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD-E 176
              F E       N     +SN   NL+  +    +  IK  +K+   ++ E+      +
Sbjct: 124 IVGFDEKSVHGIENATYTADSNAAANLVLDQ---GSKEIKFYWKSPEGVIIEKKYKFSAD 180

Query: 177 HYLFKIVDTVTNNSI----DQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ 232
            YL  +   V N S     D++  S     M +K   +TN+F   EG  A++        
Sbjct: 181 TYLIGLKLNVLNQSSQSIKDRLFVSIESYNMSNK---STNSF---EGPSALIN------- 227

Query: 233 KYSDIEKSSISNFHESNS------WLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQ 286
               +E+  + N  E NS      W+ I D+Y+ S  IP      + +    +     ++
Sbjct: 228 --GSLEQIKLKNIEEKNSYPGNIKWVAIQDRYFMSAIIPVTPVEANMRLYMKAKDKGYFE 285

Query: 287 AKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPM 346
            +++  E  I PG+       L+ G K    +     DL        +++GWF F+AKP+
Sbjct: 286 EQYTLPEKEIRPGEQEEKEFKLYFGPKSLKLLGSLGYDL-----NKAVNFGWFDFLAKPV 340

Query: 347 FMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQS 406
              M++ Y+ + N+G+ I+L T+F K++F+PL  K Y S   MK IQP + EL+EK+   
Sbjct: 341 LYAMNFLYSFIPNYGVVIILLTIFFKIIFWPLGSKSYKSMNEMKKIQPLLAELKEKYGND 400

Query: 407 PPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLA 466
             + + + ++ LYKT+ INP+ GC P++ Q+PVFFA Y+++  ++E+RHAPF  WIKDL+
Sbjct: 401 KKR-MNEELMGLYKTYKINPMGGCLPMVAQLPVFFAFYRMLYETIELRHAPFVFWIKDLS 459

Query: 467 AADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVV 526
           A  P  +F     +PF  P +  + +  I+M  +MFIQ KM+P   D  QA ++ ++P+V
Sbjct: 460 A--PDRLFHFAFTIPFMEPPY-GIPVLTIVMGATMFIQQKMAPAVGDPAQAKMMMFLPLV 516

Query: 527 FVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHG 561
           F     +F AGL++YW  +NV+SI+QQ +I + + 
Sbjct: 517 FTVIFINFSAGLVLYWLVNNVLSILQQNIISRKNA 551


>gi|222056914|ref|YP_002539276.1| YidC translocase/secretase [Geobacter sp. FRC-32]
 gi|254772789|sp|B9M7R9|OXAA_GEOSF RecName: Full=Inner membrane protein oxaA
 gi|221566203|gb|ACM22175.1| YidC translocase/secretase [Geobacter sp. FRC-32]
          Length = 530

 Score =  236 bits (602), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 132/340 (38%), Positives = 199/340 (58%), Gaps = 29/340 (8%)

Query: 219 GFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYL 278
           G + + GDK ++  K SDI K     F  + SW   +DKY+    I  K +   ++   +
Sbjct: 216 GPVTMAGDK-VITDKVSDIAKGP-KQFDNNVSWSAFADKYFMDAVIAVKNSIASARVAKI 273

Query: 279 SDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGW 338
           SD +   Q   +++ +++ PG+S +    LF G K+   +          R E  ID+GW
Sbjct: 274 SDNYV--QTNVTSSPLSLNPGQSASMDYRLFYGPKDLDILKAQGS-----RLEEAIDFGW 326

Query: 339 FYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDE 398
           F  +AKP+   + +FY+   N+G+AI++ T+ +K+LFFPL  K Y S   M+ +QPK+ E
Sbjct: 327 FSALAKPLLRSIKFFYSYTHNYGLAIIIITIILKVLFFPLTHKSYKSMKEMQKLQPKMVE 386

Query: 399 LREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF 458
           L+EKFK      + +A++ LYKTH +NP+ GC P+L+QIPVFFA+YK +  S+E+RHAPF
Sbjct: 387 LKEKFKNDR-DAMNRAVMDLYKTHKVNPMGGCLPMLVQIPVFFALYKALMFSIELRHAPF 445

Query: 459 WGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAM 518
             WI DL+A D           P+Y        + PIIM ++MFIQ KM+P   D  QA 
Sbjct: 446 VLWITDLSAKD-----------PYY--------VTPIIMGVTMFIQQKMTPTNMDPIQAK 486

Query: 519 ILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           ++  +PVVF F   +FPAGL++YW  +N+++I QQA I K
Sbjct: 487 MMLALPVVFTFMFLNFPAGLVLYWLINNILTIAQQAYINK 526


>gi|95929982|ref|ZP_01312722.1| 60 kDa inner membrane insertion protein [Desulfuromonas acetoxidans
           DSM 684]
 gi|95133951|gb|EAT15610.1| 60 kDa inner membrane insertion protein [Desulfuromonas acetoxidans
           DSM 684]
          Length = 527

 Score =  236 bits (602), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 169/568 (29%), Positives = 290/568 (51%), Gaps = 57/568 (10%)

Query: 3   RNWNYFVAIALSVIIVYAWQNF-YVYPRIEEMNNE-----RKNIQTVKQPNQVDNSYAAV 56
            N N  VA+ L +I+   W  F +++P  E  + +     +   +++KQ   VD +   V
Sbjct: 2   ENKNTLVALILMLIV---WTGFTFLFPPSENQSPDSEVTAKAEDKSLKQDISVD-AQTVV 57

Query: 57  LIDDRAQALSMSPR-VELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSN 115
            I +    +  S R +  +N     +I++  +   DL L+ Y  D+ ++S +V+LL  S+
Sbjct: 58  DIQNNISNVKTSDRFITFENDVFEATISVSTSTLVDLKLKDYKRDIDNDSDLVSLLDKSD 117

Query: 116 TKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNA--NNILFERTIS 173
                   L Y    +  +L N+     +    +      +++ F +   N  + +R I 
Sbjct: 118 D----IKSLVYYGNNDFSQLSNALFNTKITDDHVFVSQDSLQVDFYSTVDNFEINKRYIF 173

Query: 174 LDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQK 233
               Y F IV ++ N S D    S  G ++       +    ++   +  +G     + +
Sbjct: 174 YKNKYDFDIVYSLKNISSD----SRNGNVVLSLSNFWSE--DIKGNRLEFVGPVYFSDDE 227

Query: 234 YSDIEKSSISNFHESN-SWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR--YQAKFS 290
            + I+   I+N   SN +W G  +KY+ S  I       + +F  L   H     Q    
Sbjct: 228 LNTIDVEDINNDVYSNIAWSGFENKYFFSALIG------NDKFSNLLVKHQNNYVQTNLI 281

Query: 291 ANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLM 350
           + ++TI  G+ +     +F G K+   +   + +L       ++D+G+F  +AKP+  ++
Sbjct: 282 STDLTISNGQQLDFKTKVFYGPKDVQILKGVDDNLV-----RVVDYGFFKILAKPLHTVL 336

Query: 351 SYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQV 410
           ++FY  +GN+G +I+L TV +K+LF+PL +K YVS   M+ IQP++ +LREK+     + 
Sbjct: 337 NFFYGYIGNYGFSIILLTVIIKMLFWPLTQKSYVSMKAMQKIQPEMKKLREKYGNDR-ES 395

Query: 411 LQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADP 470
           L + M++LY+ H +NPL GC P+L+QIPVFFA+YKV+  ++E+RHAPF  WI DL+  D 
Sbjct: 396 LNRKMMELYREHRVNPLGGCLPMLVQIPVFFALYKVLLGTIELRHAPFIFWITDLSVKD- 454

Query: 471 TNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFA 530
                     P+Y        I P++M L+MFIQ K++P   D  QA ++  MPVVF F 
Sbjct: 455 ----------PYY--------ITPLVMGLTMFIQQKLTPNTMDPMQAKMMLAMPVVFTFL 496

Query: 531 LSSFPAGLIIYWSWSNVISIVQQAVIMK 558
             +FPAGL++YW  +N+++I QQ +I K
Sbjct: 497 FLNFPAGLVVYWLVNNLLTIFQQYLIYK 524


>gi|300313620|ref|YP_003777712.1| inner-membrane transmembrane protein [Herbaspirillum seropedicae
           SmR1]
 gi|300076405|gb|ADJ65804.1| inner-membrane transmembrane protein [Herbaspirillum seropedicae
           SmR1]
          Length = 542

 Score =  235 bits (600), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 161/484 (33%), Positives = 253/484 (52%), Gaps = 28/484 (5%)

Query: 81  SINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNT 140
           SI+  G +   L L     DV   +  V L   S   + Y AE   +        PN  T
Sbjct: 73  SIDTVGGELKRLELL-KQPDVVDPTKNVVLFD-SEPGHMYLAESGLIGG----PFPNHKT 126

Query: 141 VWNLISG-KILTPTTPIKLVF-KNANNILFERTISLD-EHYLFKIVDTVTNNSIDQIRFS 197
           ++   +G + L     I+LV   +   +   +T +   + YL  +  TVTN +   I  S
Sbjct: 127 IFTAQAGPRTLDNGNEIQLVLVADQGGVKLTKTYTFKRDSYLIDVKHTVTNTTGAAINPS 186

Query: 198 PRGRIMR--HKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHES-NSWLGI 254
              +++R  +KP   ++ +    G       +   +  +  I      + +++ N W+ +
Sbjct: 187 LYLQLVRDGNKPGGESHFYSTFTGPAVYSNSEHFEKLDFEKIANGKQQHVNKTDNGWIAM 246

Query: 255 SDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKE 314
              Y+ S FIP +        K + D    Y         T+ P  S+T  + L++G   
Sbjct: 247 VQHYFVSAFIPPQNAQRDVFSKKVGDN--LYAVGSILPLGTVAPNASVTMDSQLYSG--- 301

Query: 315 FPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLL 374
            PT+    + +A P  +++ D+G    IA+P+F LM++ +N+VGN+G  I+L TV +KL+
Sbjct: 302 -PTVSKTLQAIA-PGLDLVRDYGHLTVIAEPIFWLMTHIHNIVGNWGWTIILLTVLIKLI 359

Query: 375 FFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPIL 434
           FFPL+   Y S A MK + PK+  +RE+ K  P Q + + M+ LYKT  INPL GC PI 
Sbjct: 360 FFPLSAASYRSMAKMKAVSPKMQAIRERHKGDP-QAMNREMMTLYKTEKINPLGGCLPIA 418

Query: 435 LQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWP 494
           +QIPVF A+Y V+  S+EMR AP+ GW+ DL A D      LFG +P++    M +G+ P
Sbjct: 419 IQIPVFIALYSVLLASVEMRGAPWLGWVHDLTAPD-----RLFGTIPYF---NMPIGLLP 470

Query: 495 IIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQA 554
           IIM+ SMF+Q K++P P D  QA ++ +MP+VF F    FP+GL++YW  +N++SI QQ 
Sbjct: 471 IIMAASMFLQTKLNPTPPDPVQAKVMMFMPLVFSFMFFFFPSGLVLYWVTNNILSIAQQW 530

Query: 555 VIMK 558
           VI +
Sbjct: 531 VITR 534


>gi|332286192|ref|YP_004418103.1| putative inner membrane protein translocase component YidC
           [Pusillimonas sp. T7-7]
 gi|330430145|gb|AEC21479.1| putative inner membrane protein translocase component YidC
           [Pusillimonas sp. T7-7]
          Length = 565

 Score =  234 bits (596), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 157/489 (32%), Positives = 254/489 (51%), Gaps = 34/489 (6%)

Query: 86  GAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLI 145
           GAQ     L  Y    S + P+V LL  S+T + Y A+   +   N    P   T + L+
Sbjct: 106 GAQLVKAELVKYTAPGSKDQPMV-LLDNSST-STYLAQTGVIGAPNGQSYPTHLTPFKLV 163

Query: 146 SGKILTPTTPIKLVFK-NANNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFSPRGRIM 203
           S +       + +VF+  A+ +   +T +L +  Y   +   + N   + I  S   +++
Sbjct: 164 SSETSLTGDTLDIVFEAQADGVKVVKTYTLHKGRYDIDVKHDIYNLGTEPITPSLYLQLV 223

Query: 204 R--HKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHES-NSWLGISDKYWA 260
           R  + P  +++ +    G       +   +  +SDI+K   S   ++ N W+G+   Y+A
Sbjct: 224 RDGNDPSDSSSFYSTFTGPALYSAGEKFQKITFSDIDKGKASYTQQADNGWIGMVQHYFA 283

Query: 261 SVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHH 320
           S +IP++ T  H++   LS+     ++  SA  I   PG++++    L+ G    P    
Sbjct: 284 SAWIPAQGTVRHNETLRLSNNLYAIRSIESAGAIQ--PGQNVSVEANLWVG----PQDQK 337

Query: 321 YEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAK 380
              +LA P  E+++D+GW   IAKP+F +M++ + L+GN+G  I+  T  +KL+F+PL+ 
Sbjct: 338 AMGELA-PGLELVVDYGWLTIIAKPLFKIMTWLHALLGNWGWTIVALTFLIKLVFYPLSA 396

Query: 381 KQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVF 440
             Y S A MK + P++  LREKF     + L  AM+++Y+T  INPL GC P+++QIPVF
Sbjct: 397 ASYRSMAKMKQVTPRLQALREKFGDDKAK-LNAAMMEMYRTEKINPLGGCLPMVVQIPVF 455

Query: 441 FAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLS 500
            ++Y V+  S+EMR AP+  WI+DL+  DP           F LP FM           +
Sbjct: 456 ISLYWVLLGSVEMRGAPWILWIQDLSVRDPW----------FILPAFMMA---------T 496

Query: 501 MFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMH 560
           MF+Q+K++P P D  QA I+  MP+VF   +  FPAGL++YW  +N +SI QQ  IM   
Sbjct: 497 MFLQIKLNPTPPDPTQAKIMMIMPLVFGGMMFFFPAGLVLYWCVNNAVSIAQQRYIMHKL 556

Query: 561 GAEIGLIDR 569
             E     R
Sbjct: 557 DKETAAAKR 565


>gi|254515874|ref|ZP_05127934.1| 60 kDa inner membrane insertion protein [gamma proteobacterium
           NOR5-3]
 gi|219675596|gb|EED31962.1| 60 kDa inner membrane insertion protein [gamma proteobacterium
           NOR5-3]
          Length = 586

 Score =  233 bits (593), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 148/500 (29%), Positives = 253/500 (50%), Gaps = 46/500 (9%)

Query: 71  VELKNPSLIGSINLKGAQFDDLNLRGYHLDVSS-NSPIVTLLSPSNTKNAYFAE-----L 124
           V++   SL  +I+L G    ++ L  +  ++    +P V L   +N++  Y A+      
Sbjct: 112 VQVYTDSLQVAIDLNGGDIVEVALAKFLAEIDDPETPFVLL--ENNSRRVYVAQSGLIGR 169

Query: 125 DYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD-EHYLFKIV 183
           D + + +      + T ++L S   L     + L++ N   +   +  +   + Y+  + 
Sbjct: 170 DGIDSKSRATYRTAQTRYDLGSADSLQ----VDLLWSNDEGVKVTKRFNFQRDSYVVDVE 225

Query: 184 DTVTNNSIDQIRFSPRGRIMRHKPQTATNT---FGVQE--GFIAVLGDKSLVEQKYSDIE 238
             + N S +Q + +  G+I R      TN     G+Q   G      D    +  + ++ 
Sbjct: 226 FIIDNQSGEQWQGNLFGQIKRDSSAAVTNGGGGMGMQPFLGAATTTADDRFKKFSFDNMR 285

Query: 239 KSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILP 298
           K      H S  W+ +   Y+ S +IP+ E +     +  + G     A F++  I + P
Sbjct: 286 KEPFREQH-SGGWIAMIQHYFLSAWIPAPEQTHTYSTRVTNSGFNI--AGFTSPAINVDP 342

Query: 299 GKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVG 358
           G +   +   +AG K+      Y      P  E+ +D+GW +++A+P+F L++  Y+LVG
Sbjct: 343 GSTREVSARFYAGPKD-----QYSLQEISPYLELSVDYGWLWWVAQPLFWLLTKIYSLVG 397

Query: 359 NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQL 418
           N+G AI+L TV +K +FF L+   Y S ANM+ +QPK+ ++RE++     Q   +AM++L
Sbjct: 398 NWGAAIILLTVLIKAVFFKLSATSYKSMANMRRVQPKMADIREQYADD-KQKQSQAMMEL 456

Query: 419 YKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFG 478
           Y+   INP+ GC PIL+Q+PVF A+Y ++  S+E+R APF  WI DL+  DP  +     
Sbjct: 457 YRKEKINPMGGCLPILVQMPVFIALYWMLMESVELRQAPFMLWINDLSVMDPYFVL---- 512

Query: 479 ILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGL 538
                          P++M  SMF   K++PPP D  QA I+ W+PV+F F    FPAGL
Sbjct: 513 ---------------PLMMGASMFFMQKLNPPPPDPMQAKIMQWLPVIFTFFFLWFPAGL 557

Query: 539 IIYWSWSNVISIVQQAVIMK 558
           ++YW  +N++S+ QQ VI +
Sbjct: 558 VLYWVVNNLLSMAQQYVITR 577


>gi|301064543|ref|ZP_07204939.1| putative membrane protein [delta proteobacterium NaphS2]
 gi|300441291|gb|EFK05660.1| putative membrane protein [delta proteobacterium NaphS2]
          Length = 551

 Score =  232 bits (591), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 163/562 (29%), Positives = 275/562 (48%), Gaps = 32/562 (5%)

Query: 9   VAIALSVIIVYAWQNFYVYPRIEEMNNER--KNIQTVKQPNQVDNSYAA----VLIDDRA 62
           +A ALS +I+  W  F+     +E   E   +++Q   + + V  S AA    +   ++ 
Sbjct: 7   LAFALSFVILVGWSLFFAPQPKKEPPKESSPESVQPEHEKSSVTISPAAPSKTIAAVEQP 66

Query: 63  QALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFA 122
                  R+++  P      +  G       L+ Y   V+  SP V +++       Y  
Sbjct: 67  TVQQEEKRIKIDTPLYSAVFSNVGPTIKSFKLKKYRQTVNPESPFVEMVTLEEGMGDYLT 126

Query: 123 EL--DYV-STANNIELPNSNTVWNLISGKILTPTTPIKLVFK--NANNILFERTISLD-E 176
            L  D + ++  NI          L  G     + P  +VF+  N N I   +T     +
Sbjct: 127 ILFDDSIDASTQNIAFSADKESLTLQQG-----SEPATIVFRGTNRNGIAITQTYRFHPD 181

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
            Y   +  T  N +   +    R   +R  P      +    GF   L DK L E +  D
Sbjct: 182 RYGIDLAVTAVNPNTVTVNGVFR-TTLRALPPKDKGGYYAYVGFALFLDDK-LDELEVED 239

Query: 237 IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITI 296
             ++  +    +  W+   D Y+ S  +P          K+LS G   ++  +    +++
Sbjct: 240 PGETKSAT--GTIGWICYEDNYFISAVVPEVPAKGSFTGKHLSSG--VFEGVYLPAAVSL 295

Query: 297 LPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNL 356
            P    T+   L+ G ++   +  + K+L     +  I++GW   IAKP+  ++ +F   
Sbjct: 296 PPSAQATSEYELYLGPRDLSILKKFGKNL-----DKAINFGWTDIIAKPLLYVLKFFDAY 350

Query: 357 VGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMI 416
           + N+G++I+L T+ VK+LF+PL  K Y S   M+ +QP++ +LREK+K    Q L + M+
Sbjct: 351 LHNYGVSIILLTILVKILFWPLTHKSYKSMKEMQKLQPRMAKLREKYKGDK-QKLNQEMM 409

Query: 417 QLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTL 476
            LYKT+ +NP+ GC P+++QIPVFFA+++V+   +E+RHAPF  WI DL+A  P  +F  
Sbjct: 410 ALYKTYKVNPMGGCLPMVVQIPVFFALFRVLGACIELRHAPFIFWINDLSA--PDRLFHF 467

Query: 477 FGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPA 536
              +PF  P +  + +  ++M  SMFIQ KM+P P D  QA I+ ++PV+F F   +FP+
Sbjct: 468 SFQIPFMAPPY-GIPVLTLLMGASMFIQQKMTPSPGDPAQAKIMMFLPVIFTFMFINFPS 526

Query: 537 GLIIYWSWSNVISIVQQAVIMK 558
           GL++YW  +N++SI QQ  I K
Sbjct: 527 GLVLYWLVNNLLSIGQQYRIYK 548


>gi|114778885|ref|ZP_01453682.1| 60 kDa inner membrane insertion protein [Mariprofundus ferrooxydans
           PV-1]
 gi|114550854|gb|EAU53420.1| 60 kDa inner membrane insertion protein [Mariprofundus ferrooxydans
           PV-1]
          Length = 435

 Score =  231 bits (590), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 148/476 (31%), Positives = 241/476 (50%), Gaps = 48/476 (10%)

Query: 89  FDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGK 148
           F +  L+ YH+ +   +  V++LS ++   + +      S   N  +    TV N  S  
Sbjct: 7   FTEAELKQYHVSIEPGAANVSVLSMTDEGRSVYVN----SGVMNRSIQKPFTVLNK-SAN 61

Query: 149 ILTPTTPIKLVFKNANNILFERTISL-DEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKP 207
            +T    +       N ++++R I+L  + Y+  I D +   +  +I      +++   P
Sbjct: 62  TMTLQATLD------NGLIWQRKITLAQDSYIVDIEDRILGGAGQKIY----RQVVERDP 111

Query: 208 QTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSK 267
               NTF    G  A+L  K L E  Y D++ SS+        W  I ++Y+ +  I + 
Sbjct: 112 DKKLNTFYEHMGPTALLNGK-LQEPDYKDLDSSSV-RMMAVGGWTAIMNRYFIAALISNP 169

Query: 268 ETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAI 327
           E  +   FK   DG + YQA     +   L GK     + +F G K    +    + L  
Sbjct: 170 EQDYPYYFK--GDGRS-YQA--GVIDSGTLDGKDNLFHSRMFLGPKSLTVLKKAGEGL-- 222

Query: 328 PRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTA 387
              +  I++GWF FI+KPM   + + Y  VGNFG  I+L  + +K+LFF   +K Y S A
Sbjct: 223 ---DRSINYGWFAFISKPMHSFLLWLYTYVGNFGFCIILLVLSIKILFFWPTQKSYESMA 279

Query: 388 NMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVI 447
            M+ +QP++  ++E +     Q + + M+ LYK H +NP+ GC PI++QIPVFFA+YKV+
Sbjct: 280 AMRKLQPEMARMKELYGDDR-QKMSQEMMALYKKHKVNPMGGCLPIIIQIPVFFALYKVL 338

Query: 448 SISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKM 507
            +S+EMR APF GWI D++  DP  +                    P++M +SMF+Q ++
Sbjct: 339 LMSIEMRQAPFIGWIHDMSVQDPYFVL-------------------PVLMGISMFVQQRL 379

Query: 508 SPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           +P P D  QA ++ ++P VF      FPAGL++YW  +N +SI+QQ ++MK    E
Sbjct: 380 NPTPPDPMQAKVMQFLPPVFTVLFLFFPAGLVLYWVVNNTLSILQQKLVMKRMNVE 435


>gi|224367782|ref|YP_002601945.1| OxaA [Desulfobacterium autotrophicum HRM2]
 gi|223690498|gb|ACN13781.1| OxaA [Desulfobacterium autotrophicum HRM2]
          Length = 557

 Score =  231 bits (589), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 169/585 (28%), Positives = 279/585 (47%), Gaps = 58/585 (9%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYV-------YPRIEEMNNE-----RKNIQTVKQPNQ 48
           M+     F AI LS++++  W  F+V        P    ++NE     + +I  +  P  
Sbjct: 1   MDDQKRLFTAIILSIVVIVGWNFFFVDSKPVPEKPDQAIVSNEQPMAGKGDIAPITDPAP 60

Query: 49  VDNSYAAVLIDDRAQ--ALSMSPR----VELKNPSLIGSINLKGAQFDDLNLRGYHLDVS 102
              +       D AQ  A ++  R    +++ N     +I+  GA+ + L L  Y     
Sbjct: 61  SQQTEI-----DAAQPPATAIPTRNARTIQVSNQFYNIAISETGAKVNSLTLNAYRETSE 115

Query: 103 SNSPIVTLLSPSNTKNAYFAELDYVSTAN------NIELPNSNTVWNLISGKILTPTTPI 156
            +SP+  ++SP+ T   +   LD  S           + P+     NL  GK       +
Sbjct: 116 KDSPLKEMVSPNLTGGLFGVSLDGKSIPGLETALFTAQTPSDQ--LNLDQGK-----KSL 168

Query: 157 KLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGV 216
              + +A  ++ E+  +          D V  NS        +   M   P         
Sbjct: 169 TFTWTSAQGVVVEKIFTFSADSYLIGFDLVLKNSSG---MPMKDSFMVEIP----GIIDE 221

Query: 217 QEGFIAVLGDKSLVEQKYSDIEKSSISN---FHESNSWLGISDKYWASVFIPSKETSFHS 273
           +    +  G  +L+  K  +I+   I+    +     W G +D+Y+ S  IP   T    
Sbjct: 222 KNARFSFEGPTTLINDKLEEIKAKKIAEKDTYEGQIQWAGYTDRYFMSCLIPQAPTEAKV 281

Query: 274 QFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEML 333
           +  + S        ++  +   + PGK +T +  LF G K    +  Y  +L     +  
Sbjct: 282 KLSFDS---PVVTTRYVQSMERLDPGKQVTYSFSLFMGPKSLKLLSSYGNNL-----KKA 333

Query: 334 IDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQ 393
           I++GWF  +AKP  M M+  + L+ N+GIAIML T+ +KL+F+PL  K Y S  +MK +Q
Sbjct: 334 INFGWFDILAKPCLMGMNLIHGLIPNYGIAIMLLTLLIKLIFWPLGTKSYRSMNDMKKLQ 393

Query: 394 PKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEM 453
           P + E+REK+K    ++ Q+ M  LYKT+ +NP++GC P+++Q+P+FFA+Y+++  ++E+
Sbjct: 394 PLMMEMREKYKGDKQRMNQEVM-GLYKTYKVNPMSGCLPMIVQMPIFFALYRMLYQAIEL 452

Query: 454 RHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPAD 513
           RHAPF  WI DL+A  P  +F     +PF    +  + +  IIM  +MF+Q KMSP   D
Sbjct: 453 RHAPFMWWINDLSA--PDRLFHFDFAIPFMQAPY-GIPVLTIIMGATMFLQQKMSPSTGD 509

Query: 514 KGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
             QA ++  MP+   F   +FPAGL++YW  +NV+SI QQ  I K
Sbjct: 510 PTQAKMMMLMPLFMTFIFINFPAGLVLYWLVNNVLSIGQQYYIQK 554


>gi|319778792|ref|YP_004129705.1| Inner membrane protein translocase component YidC, long form
           [Taylorella equigenitalis MCE9]
 gi|317108816|gb|ADU91562.1| Inner membrane protein translocase component YidC, long form
           [Taylorella equigenitalis MCE9]
          Length = 549

 Score =  231 bits (588), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 169/542 (31%), Positives = 269/542 (49%), Gaps = 40/542 (7%)

Query: 21  WQNFYVYPRIEEMNNERKNIQ---TVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPS 77
           W N+  Y     +N   +  Q   T   P+   NS A   I   +     S ++ +K+  
Sbjct: 20  WSNWKSYNNPAPLNTVTEQNQSPATPSVPSADTNSPATAPIKTNSVVSEDSEKITVKSDV 79

Query: 78  LIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPN 137
           L  + +  GAQ    +L  +H       P   L      K+ +  +   +S   N + P 
Sbjct: 80  LNLTFDTVGAQLIKADLLKHHSAEDKALPTTLL---DFKKDIFTVQSGVLSQTPNKQFPI 136

Query: 138 SNTVWNLISGKILTPTTPIKLVFK-NANNILFERTISLDE-HYLFKIVDTVTNNSIDQIR 195
             T +  +S           ++F+  ++ I   RT +L++  Y     D ++N S + I 
Sbjct: 137 QTTQFKYVSTDENLSGDKKDIIFEAESDGIKVRRTYTLNKGSYDITFKDEISNLSSEAIS 196

Query: 196 FSPRGRIMRH--KPQTATNTFGVQEGFIAVLGDKSLVEQ-KYSDIEKSSISNFHE-SNSW 251
                +I R   KP+ +T+      G+ AV  +K   E+  + DI+  S     + S+ W
Sbjct: 197 PIHYVQITRDGAKPKDSTSMTNSYWGY-AVYSEKEKFEKVPFKDIDDRSAEYVSKTSDGW 255

Query: 252 LGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAG 311
           +     Y+ + ++  K    H +F+    G   Y A  S     I P +++T ++ L+ G
Sbjct: 256 ISFIQHYFVTAWVLEKGKEHHIEFR--KAGQNLYAASASQVLGAIAPQQTVTVSSHLWVG 313

Query: 312 AKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFV 371
            ++   +         P    ++++GW  FIAKPMF LMS+   L+GN+G  I++ TV +
Sbjct: 314 PQDQKALVKLH-----PNLNTVVNYGWLTFIAKPMFALMSWINTLIGNWGWTIVVLTVII 368

Query: 372 KLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCW 431
           KLL +PL+   Y S A MKNI P++  L+E++     Q L  AM+QLYKT  INPL GC 
Sbjct: 369 KLLLYPLSATSYKSMARMKNISPRMKLLKEQYGDDK-QKLNAAMMQLYKTEKINPLGGCL 427

Query: 432 PILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVG 491
           PILLQIP+F  +Y+VI  S+E+R A + GWI DL+A D           P+Y        
Sbjct: 428 PILLQIPIFLTLYRVILSSVELRGASWIGWITDLSAQD-----------PYY-------- 468

Query: 492 IWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIV 551
           I P +M L+MF+QM+M+P P D  QA I+  MP+VF   +  FPAGL++YW+ ++++SI+
Sbjct: 469 ILPTLMILTMFLQMRMNPTPPDPTQAKIMMIMPLVFGAMMFFFPAGLVLYWTVNSLLSIL 528

Query: 552 QQ 553
           QQ
Sbjct: 529 QQ 530


>gi|319945014|ref|ZP_08019276.1| YidC/Oxa1 family membrane protein insertase [Lautropia mirabilis
           ATCC 51599]
 gi|319741584|gb|EFV94009.1| YidC/Oxa1 family membrane protein insertase [Lautropia mirabilis
           ATCC 51599]
          Length = 561

 Score =  229 bits (585), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 156/519 (30%), Positives = 254/519 (48%), Gaps = 38/519 (7%)

Query: 46  PNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNS 105
           P+Q  N   A +  D+A+       + LKN  +   I+  G Q     L   H+  + N 
Sbjct: 63  PSQAGNDAPASVPADQAEQAKAGQTITLKNDVIELGIDTVGGQIVSSKLL-KHIHDTRNP 121

Query: 106 PIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANN 165
               L+  S+ K ++F  +         + PN  T   ++            ++      
Sbjct: 122 DSGNLVIQSDRKGSFF--VGQTGLVGVKDAPNHTTPMTVVRTIETDGQVTGVVLAAEGGG 179

Query: 166 ILFERTISLD-EHYLFKIVDTVTNNSIDQIRFSPRGRI-MRHKPQTATNTFGVQEGFI-- 221
           +  ERT  L    Y  K+ + VTN  I +   SP   + +      A    G  + ++  
Sbjct: 180 LRIERTYQLSPGSYEIKVDNRVTN--IGEQPLSPSLYLQLTRDTHEAPGQSGYYKTYVGP 237

Query: 222 AVLGDKSLVEQ-KYSDIEKSSISNFHESN-SWLGISDKYWASVFIPSKETSFHSQFKYLS 279
           A+  D    ++  + DIEK    +   +N  W+GI   Y+ S ++P +      ++    
Sbjct: 238 AIYTDADKFQKVSFDDIEKGKAKHSGRANDGWVGIIQHYFVSAWVPKQGQP--REYYTRR 295

Query: 280 DGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWF 339
            G + Y A        I  G+S+  +  LF G ++   +         P  ++++D+GW 
Sbjct: 296 VGPSTYSAGAYEQLGQISAGQSVDASETLFIGPQDQDVLAK-----VAPGLDLVVDYGWL 350

Query: 340 YFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDEL 399
             IAKP+F L+++ + +VGN+G AI+  T+ VKL FFPL    Y S A M+ +QP+++ +
Sbjct: 351 TAIAKPLFWLLTFLHGIVGNWGWAIVALTILVKLAFFPLQAASYRSMAKMRKVQPRLNAI 410

Query: 400 REKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFW 459
           RE++       L +AM++LYKT  INPL GC PIL+QIPVF A+Y V+  S+E+R+AP+ 
Sbjct: 411 RERYGDDRMN-LNQAMMELYKTEKINPLGGCLPILVQIPVFIALYWVLLASVEIRNAPWI 469

Query: 460 GWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMI 519
           GWI DL++ DP  I                    PI+M+ +MF+Q  ++P PAD  QA +
Sbjct: 470 GWIHDLSSPDPLYIL-------------------PILMAGTMFLQTHLNPKPADPVQAKM 510

Query: 520 LNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           + +MP++F      FP+GL++YW  SN+ SI QQ VI +
Sbjct: 511 MTFMPLIFSVMFFFFPSGLVLYWVVSNIFSIAQQWVITR 549


>gi|254483195|ref|ZP_05096428.1| 60Kd inner membrane protein [marine gamma proteobacterium HTCC2148]
 gi|214036566|gb|EEB77240.1| 60Kd inner membrane protein [marine gamma proteobacterium HTCC2148]
          Length = 565

 Score =  229 bits (584), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 157/506 (31%), Positives = 254/506 (50%), Gaps = 61/506 (12%)

Query: 73  LKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAE--------L 124
           ++  SL  +I+L G    +L L  Y L+   N  I  +L   N    Y A+        +
Sbjct: 93  VRTDSLQLAIDLNGGDIIELALPRY-LEEIDNPDIPFVLLEQNDSRTYIAQSGLIGSNGI 151

Query: 125 D------YVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE-H 177
           D      + ++A+N EL  S+             T  + L    A+NI   +  +     
Sbjct: 152 DSKGRALFTASADNFELSESDD------------TLVVDLNLTTADNIKVTKRFTFTRGE 199

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHK---PQTATNTFGVQEGFIAVLGDKSLVEQKY 234
           YL +I   V NNS  + + +  G+I R     P  + +  G+Q    A +    +   K+
Sbjct: 200 YLVEIDYIVVNNSNARWQANLFGQIKRDSTPAPSASQSGMGMQPFLGAAITQPDVRFTKF 259

Query: 235 SDIEKSSISNFHES--NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSAN 292
           +  E      F       W+ +   Y+ S +IP+ + S +   +    G     A F++ 
Sbjct: 260 T-FEDMLDDPFKAQLPGGWIAMFQHYFLSAWIPNSDQSHNYSTRVTQAGFNI--AGFTSP 316

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
            +T+ PG+S TT    +AG K+      Y      P  ++++D+GW ++IAKP+F L++ 
Sbjct: 317 ALTLDPGQSGTTGAQFYAGPKD-----QYRLAEISPYLDLVVDYGWLWWIAKPLFWLLTN 371

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
            ++ VGN+G AI+L TV VK  FF L+   Y S A M+ +QP++ ++RE++     Q   
Sbjct: 372 IHSFVGNWGTAIILLTVVVKAAFFKLSATSYRSMARMRKVQPQMLDIREQYADD-KQKQS 430

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           +AM++LY+   +NP+ GC PIL+Q+PVF A+Y V+  S+E+RHAPF  WIKD++  DP  
Sbjct: 431 QAMMELYRKEKVNPMGGCLPILVQMPVFIALYWVLMESVELRHAPFALWIKDMSVMDPYF 490

Query: 473 IFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALS 532
           +                    PI+M  SM+   +++PPP D  QA I+ W+P+VF F   
Sbjct: 491 VL-------------------PILMGASMWFMQRLNPPPTDPMQAKIMQWLPIVFTFFFL 531

Query: 533 SFPAGLIIYWSWSNVISIVQQAVIMK 558
            FPAGL++YW  +N++S+ QQ VI K
Sbjct: 532 WFPAGLVLYWVVNNLLSMAQQYVITK 557


>gi|332288922|ref|YP_004419774.1| putative inner membrane protein translocase component YidC
           [Gallibacterium anatis UMN179]
 gi|330431818|gb|AEC16877.1| putative inner membrane protein translocase component YidC
           [Gallibacterium anatis UMN179]
          Length = 540

 Score =  229 bits (584), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 171/575 (29%), Positives = 275/575 (47%), Gaps = 85/575 (14%)

Query: 15  VIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNS--------YAAVLIDDRAQALS 66
           ++I   + +F +Y + E ++N  +  QT  Q  QVD S         A   ID+  Q   
Sbjct: 8   LVIALLFISFLIYQQWE-IDNNPQPAQTATQ-TQVDKSEVPTTVSTAANTTIDNNQQQGK 65

Query: 67  MSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTL-------------LSP 113
           +   + L++  L   I+  G    +  L  Y  ++ S +P   L             L  
Sbjct: 66  I---ITLQSDVLRLKIDTLGGDIVEAQLLKYGAELHSETPFALLKNTPQQVYIAQSGLIG 122

Query: 114 SNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTIS 173
           +N  +      DY    +N  L            ++  P T  K      + + + +  +
Sbjct: 123 ANGSDTVAGRADYQVEGDNFTLAEGQN-------ELSVPFTFTK------DGVTYRKIFT 169

Query: 174 LDEH-YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ 232
           L  + Y  K+   VTNNS   I+  P  + ++H    ++    +               +
Sbjct: 170 LSRNSYDVKVNYEVTNNSGATIQVQPYAQ-LKHTLVESSGNIAMPTYTGGAYSSSETNYK 228

Query: 233 KYS--DIEKSSISNFHESNSWLGISDKYWASVFIPSKE------TSFHSQFKYLSDGHAR 284
           KYS  D++K +++       W  I   Y+ S +IP+++      TS    F Y+      
Sbjct: 229 KYSFEDMQKENLA-IKTKQGWAAILQHYFVSAWIPNQDADNQLYTSTQGDFAYIG----- 282

Query: 285 YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAK 344
               F     +I  G + T ++ L+ G K        E +   P  ++ +D+GW +FIAK
Sbjct: 283 ----FRGPVTSIANGATDTISSQLWVGPK-----LQNEMETVAPHLDLTVDYGWAWFIAK 333

Query: 345 PMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK 404
           P+F L+ +  +LV N+G+AI+  T+ VK + +PL K QY S A M+ +QPKI E+RE+F 
Sbjct: 334 PLFWLLQFIQSLVHNWGLAIIGVTIVVKAILYPLTKAQYTSMAKMRMLQPKIQEMRERFG 393

Query: 405 QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKD 464
               Q + + M++LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+D
Sbjct: 394 DD-RQRMSQEMMKLYKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQD 452

Query: 465 LAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWM 523
           L+A D           P+Y        I P++M  SMF+  KMSP P AD  Q  ++ +M
Sbjct: 453 LSAQD-----------PYY--------ILPLLMGASMFLLQKMSPTPVADPMQQKVMMFM 493

Query: 524 PVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           PV+F F    FP+GL++YW  SN+I+IVQQ +I +
Sbjct: 494 PVMFTFFFLWFPSGLVLYWLVSNLITIVQQQLIYR 528


>gi|113869679|ref|YP_728168.1| putative inner membrane protein translocase component YidC
           [Ralstonia eutropha H16]
 gi|123133468|sp|Q0K5C1|OXAA_RALEH RecName: Full=Inner membrane protein oxaA
 gi|113528455|emb|CAJ94800.1| inner membrane protein [Ralstonia eutropha H16]
          Length = 555

 Score =  229 bits (583), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 163/504 (32%), Positives = 250/504 (49%), Gaps = 54/504 (10%)

Query: 70  RVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVST 129
           +V +   ++   I+  G     L L   H     +   V L    N +  Y A    +  
Sbjct: 84  KVVVTTDTVRAEIDTAGGIVSRLELLKEH---EKDGKPVVLFERDNVRT-YMARSGLIGG 139

Query: 130 ANNIELPNSNTVWNLISG-KILTPTTPIKLVFKNANNILFERTISLDEHYLFK----IVD 184
               +LPN  TV+    G + L     +++      N      + L + Y+F+    +VD
Sbjct: 140 ----DLPNHTTVFTAAPGPRTLDGAEQLEVALTAEKN-----GVKLVKTYVFRKGSYVVD 190

Query: 185 T---VTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ-KYSDIEKS 240
           T   VTN     +  +    + R   +   + F       AV  D     +  + DI K 
Sbjct: 191 TKFAVTNAGAAPVSPTLYLELARDGSKVEQSQFYSTFTGPAVYTDADKYHKIDFEDIAKG 250

Query: 241 SIS-NFHESNSWLGISDKYWASVFIP--SKETSFHSQFKYLSDGHARYQAKFSANEITIL 297
             +     +N W+ +   Y+AS +IP   KE SF+ Q     D H  Y+         + 
Sbjct: 251 KATVPAAANNGWVAMVQHYFASAWIPQTGKEHSFYVQ---QIDPHL-YRVGVQQPLGELA 306

Query: 298 PGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLV 357
           PG ++TT   LFAG +E     H  + +A P  E++ D+GW   +AKP+F L+   +  +
Sbjct: 307 PGATVTTDARLFAGPQE----EHMLEKIA-PGLELVKDYGWLTILAKPLFWLLEKLHGFL 361

Query: 358 GNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQ 417
           GN+G +I+  TV +KL+FFPL+   Y S   MK++QP++  +RE++K   PQ + + M+ 
Sbjct: 362 GNWGWSIIALTVLIKLVFFPLSAASYKSMGKMKDLQPRMTSIRERYKND-PQKMNQEMMG 420

Query: 418 LYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLF 477
           LYKT  +NPL GC PI++QIPVF A+Y V+  S+EMR AP+ GWI DL+  D        
Sbjct: 421 LYKTEKVNPLGGCLPIVIQIPVFIALYWVLLSSVEMRGAPWLGWIHDLSVPD-------- 472

Query: 478 GILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAG 537
              PFY        I PI+M++SMF+Q K++P P D  QA ++  MP+VF      FPAG
Sbjct: 473 ---PFY--------ILPIVMAVSMFVQTKLNPTPPDPVQAKVMMIMPLVFSVMFFFFPAG 521

Query: 538 LIIYWSWSNVISIVQQAVIMKMHG 561
           L++YW  +N++SI QQ  I +M G
Sbjct: 522 LVLYWVVNNILSIAQQWQINRMLG 545


>gi|297539958|ref|YP_003675727.1| membrane protein insertase [Methylotenera sp. 301]
 gi|297259305|gb|ADI31150.1| membrane protein insertase, YidC/Oxa1 family domain containing
           protein [Methylotenera sp. 301]
          Length = 542

 Score =  229 bits (583), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 126/334 (37%), Positives = 199/334 (59%), Gaps = 33/334 (9%)

Query: 234 YSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANE 293
           + D+ K  +     ++ W+G+   Y+ S +IP    +     + L++   R  +K + + 
Sbjct: 231 FKDMAKEPL-KVTSNDGWVGLLQHYFVSAWIPKDGLAREFYTEKLNEHMYRIGSKSTLS- 288

Query: 294 ITILPGKSITTTNFLFAGAKEFPTIHHYEKDL--AIPRFEMLIDWGWFYFIAKPMFMLMS 351
            TI PG S+T    LF+G +        +KDL    P  E  +D+GW   +A P+F ++S
Sbjct: 289 -TIAPGASLTVPARLFSGPQT-------KKDLVETAPGLEYTVDYGWLKMVASPLFWVLS 340

Query: 352 YFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVL 411
             ++LV N+G+AI+L T+ +K  F+PL+ K Y S A M+ + P+++ +++KF     Q +
Sbjct: 341 LIHSLVHNWGVAIILLTLLIKAAFYPLSAKSYRSMAQMRELAPRLESMKQKFGDDR-QKM 399

Query: 412 QKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPT 471
           Q+AM++LYKT  INP++GC PIL+QIPVF ++Y ++  S+E+RHAPF+GWI+DL+A D  
Sbjct: 400 QQAMMELYKTEKINPMSGCLPILIQIPVFISLYWMLLGSIELRHAPFFGWIQDLSAVD-- 457

Query: 472 NIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFAL 531
                    P+Y        I PIIM +SM IQ K++P P D  QA ++ WMPV+F    
Sbjct: 458 ---------PYY--------ILPIIMGISMIIQTKLNPKPTDPIQAKVMTWMPVIFSVFF 500

Query: 532 SSFPAGLIIYWSWSNVISIVQQAVIMK-MHGAEI 564
             FPAGL++YW  +N+ISI QQ  + K +H A +
Sbjct: 501 FFFPAGLVLYWVVNNIISIWQQWYVNKSIHAAAL 534


>gi|33151313|ref|NP_872666.1| putative inner membrane protein translocase component YidC
           [Haemophilus ducreyi 35000HP]
 gi|38502923|sp|Q7VPM2|OXAA_HAEDU RecName: Full=Inner membrane protein oxaA
 gi|33147533|gb|AAP95055.1| 60 kDa inner-membrane protein [Haemophilus ducreyi 35000HP]
          Length = 536

 Score =  229 bits (583), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 132/399 (33%), Positives = 219/399 (54%), Gaps = 34/399 (8%)

Query: 164 NNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIA 222
           + +++ +T +L    Y   +   + NNS + I   P G+I +H    ++    +      
Sbjct: 156 DGVMYTKTFTLKRGSYDVAVSFDIQNNSANTIEVQPYGQI-KHSLLDSSGNLAMPTYTGG 214

Query: 223 VLGDKSLVEQKYS--DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
                    +KYS  ++ K+++ N      W+ +   Y+ S ++P+++ S ++ +    +
Sbjct: 215 AYSSSETNYKKYSFDEMTKANL-NIDTKGGWVALLQHYFVSAWVPNQDAS-NTLYSRTHN 272

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
           G A     +     T+ P    T T+ L+ G K+       E   A    E+ +D+GW +
Sbjct: 273 GVAT--IGYRGPITTVKPNTKTTITSQLWTGPKD-----QKEMAQAATHLELTVDYGWAW 325

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           FIAKP+F L+ + ++++GN+G+AIM  T+ VK L +PL K QY S A M+ +QPK+ ELR
Sbjct: 326 FIAKPLFWLLIFIHSIIGNWGLAIMGVTLVVKSLLYPLTKAQYTSMAKMRMLQPKLQELR 385

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E++     Q+ Q+ M++LYK   +NP+ GC P++LQ+P+F A+Y     ++E+RHAPF+G
Sbjct: 386 ERYGDDRQQMSQE-MMKLYKQEKVNPMGGCLPLILQMPIFIALYWTFMEAVELRHAPFFG 444

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMI 519
           WI+DL+A DP  IF                   P++M LSMF+  KMSP   AD  Q  +
Sbjct: 445 WIQDLSAQDPYYIF-------------------PVLMGLSMFLLQKMSPTAVADPTQLKV 485

Query: 520 LNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           + +MPV+F      FP+GL++YW  SN I+IVQQ +I +
Sbjct: 486 MTFMPVIFTVFFLWFPSGLVLYWLTSNCITIVQQWLIYR 524


>gi|83747144|ref|ZP_00944187.1| 60 kDa inner membrane protein YIDC [Ralstonia solanacearum UW551]
 gi|207741912|ref|YP_002258304.1| preprotein translocase subunit yidc [Ralstonia solanacearum
           IPO1609]
 gi|83726119|gb|EAP73254.1| 60 kDa inner membrane protein YIDC [Ralstonia solanacearum UW551]
 gi|206593298|emb|CAQ60225.1| preprotein translocase subunit yidc [Ralstonia solanacearum
           IPO1609]
          Length = 563

 Score =  228 bits (580), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 129/329 (39%), Positives = 193/329 (58%), Gaps = 19/329 (5%)

Query: 234 YSDIEKSSIS-NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSAN 292
           +SDI+K          N W+G+   Y+AS +IP+   S   +F         Y+      
Sbjct: 244 FSDIDKGKAHVPAATDNGWVGMVQHYFASAWIPA--ASAKREFYVDRVDTNFYRIGIQEP 301

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
             T+ PG S++ T  LFAG +E   +     +   P  +++ D+GW   IAKP+F L+  
Sbjct: 302 LGTVAPGASLSATARLFAGPQEESML-----EAITPGLDLVKDYGWLTVIAKPLFWLLER 356

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
            + L+GN+G +I+  TV VKL+FFPL+   Y S A MK++QP++  +RE+ K   PQ + 
Sbjct: 357 IHALLGNWGWSIVALTVLVKLVFFPLSATSYRSMAKMKDLQPRMTAIRERHKGD-PQKMN 415

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           + M+ LY+T  +NPL GC PIL+QIPVF ++Y  +  S+EMR AP+ GW+ DLAA D   
Sbjct: 416 QEMMTLYRTEKVNPLGGCLPILIQIPVFMSLYWALLSSVEMRGAPWVGWVHDLAAPD--- 472

Query: 473 IFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALS 532
              LFG   F +P    VG+ PI+M++SMF+Q K++P P D  QA ++ +MP+ F     
Sbjct: 473 --ALFGTY-FGVP----VGLLPILMAVSMFVQTKLNPTPPDPVQAKMMMFMPLAFSVMFF 525

Query: 533 SFPAGLIIYWSWSNVISIVQQAVIMKMHG 561
            FP+GL++YW  +N +SI QQ  I +M G
Sbjct: 526 FFPSGLVLYWVVNNCLSIAQQWSINRMLG 554


>gi|219871547|ref|YP_002475922.1| putative inner membrane protein translocase component YidC
           [Haemophilus parasuis SH0165]
 gi|254772790|sp|B8F6M2|OXAA_HAEPS RecName: Full=Inner membrane protein oxaA
 gi|219691751|gb|ACL32974.1| putative inner membrane protein translocase component YidC
           [Haemophilus parasuis SH0165]
          Length = 546

 Score =  228 bits (580), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 144/488 (29%), Positives = 250/488 (51%), Gaps = 46/488 (9%)

Query: 81  SINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYV------STANNIE 134
           +++  G    D +L  Y+ ++ SN+P   L    N K  Y A+   V      +TA   +
Sbjct: 82  TVDTLGGDVVDSDLLKYNAELDSNTPFELL--QDNGKVLYVAQSGLVGKNGIDTTAGRAQ 139

Query: 135 LPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE-HYLFKIVDTVTNNSIDQ 193
              +   + L  G+       + L F+  + +++ +T +L    Y   +   + N + + 
Sbjct: 140 YQATAEKFALAEGQ---DEIALPLTFEK-DGVVYTKTFTLKRGSYNVAVNYHIKNGTAET 195

Query: 194 IRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS--DIEKSSISNFHESNSW 251
           +   P G+ ++H    +T  F +            +  +KYS  ++ K+++S       W
Sbjct: 196 LEVQPYGQ-LKHTLVESTGNFAMPTYTGGAYSSSEVNYKKYSFDEMAKANLS-VDTKAGW 253

Query: 252 LGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAG 311
             +   Y+ S +IP+++   +    Y   G+      +      + P    T T+ L+ G
Sbjct: 254 AAVLQHYFVSAWIPNQDAENN---LYTRTGNGVGTIGYRGPVTQVAPNGEATITSHLWTG 310

Query: 312 AKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFV 371
            K+   +     +     F++ +D+GW +FIAKP+F L+++  ++V N+G+AI+  T+ V
Sbjct: 311 PKDQAAMAQVANN-----FDLTVDYGWAWFIAKPLFWLLTFIQSIVSNWGLAIIGVTIVV 365

Query: 372 KLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCW 431
           K + +PL K QY S A M+ +QP+I E+RE+F     Q + + M++LYK   +NP+ GC 
Sbjct: 366 KTILYPLTKAQYTSMAKMRMLQPRIQEMRERFGDD-RQRMSQEMMKLYKEEKVNPMGGCL 424

Query: 432 PILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVG 491
           PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A DP  IF                 
Sbjct: 425 PILLQMPIFIALYWTFMEAVELRHAPFFGWIQDLSAQDPYYIF----------------- 467

Query: 492 IWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISI 550
             P++M  SM++  KMSP P AD  Q  ++N+MPV+F      FP+GL++YW  SN+I+I
Sbjct: 468 --PLLMGGSMYLLQKMSPTPIADPVQQKVMNFMPVMFTVFFLWFPSGLVLYWLTSNLITI 525

Query: 551 VQQAVIMK 558
            QQ +I +
Sbjct: 526 AQQWLIYR 533


>gi|207727482|ref|YP_002255876.1| preprotein translocase subunit yidc [Ralstonia solanacearum MolK2]
 gi|206590719|emb|CAQ56331.1| preprotein translocase subunit yidc [Ralstonia solanacearum MolK2]
          Length = 563

 Score =  228 bits (580), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 129/329 (39%), Positives = 193/329 (58%), Gaps = 19/329 (5%)

Query: 234 YSDIEKSSIS-NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSAN 292
           +SDI+K          N W+G+   Y+AS +IP+   S   +F         Y+      
Sbjct: 244 FSDIDKGKAHVPAATDNGWVGMVQHYFASAWIPA--ASAKREFYVDRVDTNFYRIGIQEP 301

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
             T+ PG S++ T  LFAG +E   +     +   P  +++ D+GW   IAKP+F L+  
Sbjct: 302 LGTVAPGASLSATARLFAGPQEESML-----EAITPGLDLVKDYGWLTVIAKPLFWLLER 356

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
            + L+GN+G +I+  TV VKL+FFPL+   Y S A MK++QP++  +RE+ K   PQ + 
Sbjct: 357 IHALLGNWGWSIVALTVLVKLVFFPLSATSYRSMAKMKDLQPRMTAIRERHKGD-PQKMN 415

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           + M+ LY+T  +NPL GC PIL+QIPVF ++Y  +  S+EMR AP+ GW+ DLAA D   
Sbjct: 416 QEMMTLYRTEKVNPLGGCLPILIQIPVFMSLYWALLSSVEMRGAPWVGWVHDLAAPD--- 472

Query: 473 IFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALS 532
              LFG   F +P    VG+ PI+M++SMF+Q K++P P D  QA ++ +MP+ F     
Sbjct: 473 --ALFGTY-FGVP----VGLLPILMAVSMFVQTKLNPTPPDPVQAKMMMFMPLAFSVMFF 525

Query: 533 SFPAGLIIYWSWSNVISIVQQAVIMKMHG 561
            FP+GL++YW  +N +SI QQ  I +M G
Sbjct: 526 FFPSGLVLYWVVNNCLSIAQQWSINRMLG 554


>gi|237749310|ref|ZP_04579790.1| preprotein translocase YidC subunit [Oxalobacter formigenes OXCC13]
 gi|229380672|gb|EEO30763.1| preprotein translocase YidC subunit [Oxalobacter formigenes OXCC13]
          Length = 559

 Score =  227 bits (579), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 156/486 (32%), Positives = 242/486 (49%), Gaps = 40/486 (8%)

Query: 82  INLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTV 141
           IN  G  F +L L  Y  +V S   +V  L  S     Y A+            PN  T 
Sbjct: 98  INPDGGVFQNLELLKYPDNVDSTKDMV--LFESAPPRIYLAQTGLTGGL----YPNHATR 151

Query: 142 WNLISGK--ILTPTTPIKLVFK-NANNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFS 197
           +++  G+  +   +  +KLV     + +   +T +     Y+  +   VTN S + I  S
Sbjct: 152 FHIRPGERTLGENSDEVKLVMDAEQDGVRLTKTYTFKRGSYVIDVDQKVTNLSHEPINAS 211

Query: 198 PRGRIMR--HKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISN-FHESNSWLGI 254
              +++R   +P+  +       G      +    + K+ +I +  + +     N W+G+
Sbjct: 212 LYLQLLRDSERPEGQSRFISTFTGPAVYSEEDKFQKIKFDNIGEGKMDHAIKTDNGWVGM 271

Query: 255 SDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKE 314
              Y+ S FIP  + +  +  K +  G   Y         TI P  S +    L+ G +E
Sbjct: 272 VQHYFVSAFIPQDKVARENYTKKV--GENLYAIGTVIPLGTIAPNASASNDTRLYVGPQE 329

Query: 315 FPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLL 374
              +         P  E++ D+GW   IAKP+F LM++ +N VGN+G  I+L T  +KL+
Sbjct: 330 SKLLEK-----TAPGLELVKDYGWLTIIAKPIFWLMTHIHNEVGNWGWTIILLTCLIKLI 384

Query: 375 FFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPIL 434
           F PL+   Y S A MK   P+I ELRE++K    Q + K ++ LYK   INPL GC P++
Sbjct: 385 FAPLSAASYRSMAKMKQFTPRITELRERYKDD-KQRMNKELMGLYKAEKINPLGGCLPVV 443

Query: 435 LQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWP 494
           +QIPVF ++Y V+  S+E+R+AP+ GWI++LAA D           P+Y        I P
Sbjct: 444 IQIPVFISLYWVLLASVEIRNAPWLGWIQNLAAPD-----------PYY--------ILP 484

Query: 495 IIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQA 554
           IIM+ SMFIQ KMSPPP D  QA ++ ++P+ F      FP+GL++YW  +N++SI QQ 
Sbjct: 485 IIMAGSMFIQQKMSPPPPDPMQAKMMMFLPIAFSITFFFFPSGLVLYWVVNNLLSIAQQY 544

Query: 555 VIMKMH 560
            I K +
Sbjct: 545 WITKKY 550


>gi|77920733|ref|YP_358548.1| inner-membrane protein [Pelobacter carbinolicus DSM 2380]
 gi|77546816|gb|ABA90378.1| protein translocase subunit yidC [Pelobacter carbinolicus DSM 2380]
          Length = 542

 Score =  226 bits (577), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 167/576 (28%), Positives = 284/576 (49%), Gaps = 52/576 (9%)

Query: 3   RNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQT--VKQPNQVDNSYAAVLIDD 60
            N N  +A+ L V+I   +  F+V P    +N+E    ++     P  V       +   
Sbjct: 2   ENKNVIIALLLMVLIWTGYTTFFVKPAPAPVNDEPAVAESFPAVTPEVVGERVVPSVDHV 61

Query: 61  RAQALS--MSPRVELKNPSLIGSINLK-GAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTK 117
            A A S  ++PR  + +     ++    G +   L L+ Y   +  +S +VTL+   N  
Sbjct: 62  MAAAASSDIAPRDFVVDTEDFRAVFTNVGGRLKKLELKNYRETLKEDSGLVTLVDADNAL 121

Query: 118 NAY--FAELDYVSTANNI---ELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTI 172
           + +    + D     N +   ++P           K L  T  +      +N ++ E+  
Sbjct: 122 STFGILGQGDIALAENTVYATDVPAEGLTLGSDDKKDLRFTAVL------SNGVVVEKVF 175

Query: 173 SLD-EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFI--AVLGDKSL 229
           SL+ + Y F +   V N     I+ S    ++  +P +     G +  F+  A+  D  L
Sbjct: 176 SLNGKGYDFNLQVRVVNPGDRPIQGSLE--LLMVQPWSEDRE-GSRYSFVGPAIYADDEL 232

Query: 230 VEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKF 289
              K  ++E  +I +   S  W    DKY+ +  +P +  S    F     G+A      
Sbjct: 233 NTYKVKELEDGAIRH-DNSGIWTAFEDKYFMTAAVPLR--SEQHAFVLEKVGNAVKNIVS 289

Query: 290 SANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFML 349
           S N +++   +S+T    L+AG ++   +      L     +  ID+G+F  +A+P+  +
Sbjct: 290 SGN-LSVGGQQSVTLDYLLYAGPRDLDVLEQVNHGL-----DKAIDFGFFDMLARPLLSV 343

Query: 350 MSYFY-NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPP 408
           + + + NL+ N+G+AI+L TVF+K+LF+PL  K Y S  +M+ +QP++  LREK+K+   
Sbjct: 344 LKFCHKNLISNYGVAIILLTVFIKVLFWPLTHKSYKSMRDMQKLQPEMQRLREKYKKDKE 403

Query: 409 QVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAA 468
           + + + +++LY+ + +NP+ GC P+  QIPVFFA+YKV+  S+ +RH PF  WI+DLAA 
Sbjct: 404 R-MNREIMELYRKNRVNPMGGCLPMFAQIPVFFALYKVLLGSIALRHEPFIFWIQDLAAK 462

Query: 469 DPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFV 528
           D           P+Y        I P+IM ++MF Q KMSP   D  QA I+ +MPV+F 
Sbjct: 463 D-----------PYY--------ITPLIMGVTMFFQQKMSPTTMDSQQAKIMLFMPVIFT 503

Query: 529 FALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEI 564
           F   +FP+GL+IYW  +NV++I QQ  I +  G  +
Sbjct: 504 FMFLNFPSGLVIYWLVNNVLTIAQQWFINREGGQPV 539


>gi|218677921|ref|ZP_03525818.1| putative inner membrane protein translocase component YidC
           [Rhizobium etli CIAT 894]
          Length = 240

 Score =  226 bits (577), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 100/238 (42%), Positives = 145/238 (60%)

Query: 63  QALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFA 122
           QAL+ SPRV +   +L GSINL GA+ DDL L+GYH  V  +SPI+TL SP+ TK+ YF 
Sbjct: 3   QALAKSPRVVIDTAALSGSINLAGARLDDLKLKGYHETVDDSSPIITLFSPAETKDGYFT 62

Query: 123 ELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKI 182
           EL Y+ +     +P   T+W    G  LT  TP+ L + N   + F RTIS+DE Y+F +
Sbjct: 63  ELGYIGSDATGSVPGPTTLWTAPEGAKLTEKTPVTLSYTNDKGLTFTRTISVDERYMFTV 122

Query: 183 VDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSI 242
            D + N+       S  GR+MR+   T  + + + EGFI V+GD  L+E KYS +EK ++
Sbjct: 123 ADKIVNSGQAPAALSSYGRVMRYNKPTTPSVYVLHEGFIGVIGDDGLIESKYSAVEKEAV 182

Query: 243 SNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGK 300
           S    +  WLGI+DKYWA+  +P +  ++ ++F Y +DG  RYQA +  +  T+ PG+
Sbjct: 183 SPAKSTGGWLGITDKYWAATIVPPQSAAYEAKFSYFTDGQPRYQADYKDDAFTVAPGQ 240


>gi|113460279|ref|YP_718337.1| putative inner membrane protein translocase component YidC
           [Haemophilus somnus 129PT]
 gi|123131891|sp|Q0I0Z1|OXAA_HAES1 RecName: Full=Inner membrane protein oxaA
 gi|112822322|gb|ABI24411.1| protein translocase subunit yidC [Haemophilus somnus 129PT]
          Length = 541

 Score =  226 bits (576), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 166/568 (29%), Positives = 274/568 (48%), Gaps = 54/568 (9%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
           +R+  +   + +S +I   WQ  Y  P+ E    E+  +  V       NS A     D 
Sbjct: 4   KRSLLFMALLFISFLIYQQWQVDYNTPKPE--MTEQAQVSEV-------NSTALTATSDI 54

Query: 62  AQALSMSPRV-ELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           A       RV  L+N      +N  G       L  Y  ++ S++P V L   +N    Y
Sbjct: 55  ANDTQAKGRVITLENDVFRLKVNTLGGDVIGSELLNYDAELHSSAPFVLL--QNNADKVY 112

Query: 121 FAELDYV------STANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISL 174
            A+   V      S A          V+ L  G+       + LVF+  + +++ +   L
Sbjct: 113 IAQSGLVGKNGIDSRAGRANYQVEGDVFKLAEGQ---QELKVPLVFEK-DGVIYRKVFVL 168

Query: 175 D-EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQK 233
               Y  ++   +TN S   I   P  + + H    ++ +  +               +K
Sbjct: 169 KPGSYALEVNFEITNQSPKPIEVVPYAQ-LTHTLVESSGSMAMPTYTGGAYSSSETNYKK 227

Query: 234 YS--DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSA 291
           YS  D+EK+ + + H    W+ +   Y+ S +IP+++ + ++ +   +         + +
Sbjct: 228 YSFEDMEKADL-DIHTKAGWVALLQHYFVSAWIPNQDAN-NTLYTLTNTKKHLGSIGYRS 285

Query: 292 NEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMS 351
             I I  G + T    L+ G    P +     D+A    ++ +D+GW +FIAKP+F L++
Sbjct: 286 APIVIENGATETIHTQLWTG----PKLQDQMADVA-NHLDLTVDYGWAWFIAKPLFKLLT 340

Query: 352 YFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVL 411
              +LV N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F +   Q +
Sbjct: 341 LIQSLVQNWGLAIIGVTLVVKAILYPLTKAQYTSMAKMRMLQPKLQEMRERFGED-RQRM 399

Query: 412 QKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPT 471
            + M++LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GW++DL+A DP 
Sbjct: 400 SQEMMKLYKEEKVNPLGGCLPILLQMPIFIALYWTFMEAVELRHAPFFGWVQDLSAQDPY 459

Query: 472 NIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFA 530
            I                    PI+M  SMF+  KMSP P AD  Q  ++ +MP++F+  
Sbjct: 460 FIL-------------------PILMGASMFLLQKMSPTPVADPMQQKVMTFMPLIFMVF 500

Query: 531 LSSFPAGLIIYWSWSNVISIVQQAVIMK 558
              FPAGL++YW  SN+I+I QQ +I +
Sbjct: 501 FLFFPAGLVLYWLASNLITIAQQWLIYR 528


>gi|300692995|ref|YP_003753990.1| cytoplasmic insertase, essential for proper integration of ATPase
           into the membrane [Ralstonia solanacearum PSI07]
 gi|299080055|emb|CBJ52730.1| cytoplasmic insertase, essential for proper integration of ATPase
           into the membrane [Ralstonia solanacearum PSI07]
          Length = 554

 Score =  226 bits (576), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 128/329 (38%), Positives = 189/329 (57%), Gaps = 28/329 (8%)

Query: 234 YSDIEKSSIS-NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSAN 292
           +SDI+K          N W+G+   Y+AS +IP+   S   +F         Y+      
Sbjct: 244 FSDIDKGKAHVPAATDNGWVGMVQHYFASAWIPA--ASAKREFYVDRVDTNFYRIGIQEP 301

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
             T+ PG +I+ T  LFAG +E   +         P  E++ D+GW   IAKP+F L+  
Sbjct: 302 LGTVAPGANISATARLFAGPQEERMLEGI-----TPGLELVKDYGWLTIIAKPLFWLLEK 356

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
            + L+GN+G +I+  TV VKL+FFPL+   Y S A MK++QP++  +RE+ K  P Q + 
Sbjct: 357 IHLLLGNWGWSIVGLTVLVKLVFFPLSATSYRSMAKMKDLQPRMTAIRERHKGDP-QKMN 415

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           + M+QLY+T  +NPL GC PI++QIPVF A+Y V+  S+EMR AP+ GW+ DLA+ D   
Sbjct: 416 QEMMQLYRTEKVNPLGGCLPIVIQIPVFIALYWVLLSSVEMRGAPWLGWVHDLASPD--- 472

Query: 473 IFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALS 532
                   PFY        I PI+M++SMF+Q +++P P D  QA ++ +MP+ F     
Sbjct: 473 --------PFY--------ILPILMAVSMFVQTRLNPTPPDPVQAKMMMFMPIAFSVMFF 516

Query: 533 SFPAGLIIYWSWSNVISIVQQAVIMKMHG 561
            FPAGL++YW  +N +SI QQ  I +M G
Sbjct: 517 FFPAGLVLYWVVNNCLSIAQQWSINRMLG 545


>gi|119475233|ref|ZP_01615586.1| putative inner membrane protein translocase component YidC [marine
           gamma proteobacterium HTCC2143]
 gi|119451436|gb|EAW32669.1| putative inner membrane protein translocase component YidC [marine
           gamma proteobacterium HTCC2143]
          Length = 569

 Score =  226 bits (575), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 140/411 (34%), Positives = 216/411 (52%), Gaps = 37/411 (9%)

Query: 156 IKLVFKNANNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFSPRGRIMR-HKPQTATNT 213
           + LVF++ + +   +        YL  +   V NNS         G++ R + P  + +T
Sbjct: 182 VDLVFQSNDPVSITKRFHFTRGEYLIGVEYIVKNNSEMPWSGGMFGQLKRDNSPDPSADT 241

Query: 214 FGVQEGFIAVLG------DKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSK 267
            G+  G    LG      D+   +  + DIE++S    +    W+ I   Y+ S ++P+ 
Sbjct: 242 SGM--GLAPYLGAAINLPDEPYKKVSFDDIEENSFPKQNIEGGWVAIIQHYFTSAWVPNA 299

Query: 268 ETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAI 327
           + +     +   DG       F++ +IT+  G +    + L+ G K+      Y  +   
Sbjct: 300 KQTHAYSMRKTKDGANI--VGFTSPQITVAAGATGDVKSELYIGPKD-----QYRLEEIS 352

Query: 328 PRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTA 387
           P  E+ +D+G  ++IA+P+F L++  +  +GN+G AI+  T+ VK  FF L  K Y S A
Sbjct: 353 PGLELTVDYGILWWIAQPLFWLLTKLHGYLGNWGFAIIAVTILVKAAFFQLNAKAYTSMA 412

Query: 388 NMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVI 447
           NM+ +QPK+  LRE++     Q   + M+ LYK   INPL GC PIL+Q+PVF A+Y V+
Sbjct: 413 NMRKVQPKLTALRERYADDK-QKQSQEMMALYKREKINPLGGCLPILVQMPVFMALYWVL 471

Query: 448 SISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKM 507
             S+E+RHAPF G+IKDL+  DP  I                    P+IM +SMFIQ + 
Sbjct: 472 MESVELRHAPFIGYIKDLSVMDPYFIL-------------------PLIMGVSMFIQQRF 512

Query: 508 SPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           +PPP D  QA I+ WMPV+F F    FPAGL++YW  +N +SI QQ +I K
Sbjct: 513 NPPPPDPMQAKIMQWMPVMFTFFFLFFPAGLVLYWVVNNTLSIAQQYLITK 563


>gi|170718320|ref|YP_001785332.1| inner membrane protein translocase component YidC [Haemophilus
           somnus 2336]
 gi|254772997|sp|B0URU3|OXAA_HAES2 RecName: Full=Inner membrane protein oxaA
 gi|168826449|gb|ACA31820.1| 60 kDa inner membrane insertion protein [Haemophilus somnus 2336]
          Length = 541

 Score =  226 bits (575), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 165/568 (29%), Positives = 274/568 (48%), Gaps = 54/568 (9%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
           +R+  +   + +S +I   WQ  Y  P+ E    E+  +  V       NS A     D 
Sbjct: 4   KRSLLFMALLFISFLIYQQWQVDYNTPKPEV--TEQAQVSEV-------NSTALTATSDI 54

Query: 62  AQALSMSPRV-ELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           A       RV  L+N      +N  G       L  Y  ++ S++P V L   +N    Y
Sbjct: 55  ANDTQAKGRVITLENDVFRLKVNTLGGDVIGSELLNYDAELHSSAPFVLL--QNNADKVY 112

Query: 121 FAELDYV------STANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISL 174
            A+   V      S A          V+ L  G+       + L+F+  + +++ +   L
Sbjct: 113 IAQSGLVGKNGIDSRAGRANYQVEGDVFKLAEGQ---QELKVPLIFEK-DGVIYRKVFVL 168

Query: 175 D-EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQK 233
               Y  ++   +TN S   I   P  + + H    ++ +  +               +K
Sbjct: 169 KPGSYALEVNFEITNQSPKPIELVPYAQ-LTHTLVESSGSMAMPTYTGGAYSSSETNYKK 227

Query: 234 YS--DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSA 291
           YS  D+EK+ + + H    W+ +   Y+ S +IP+++ + ++ +   +         + +
Sbjct: 228 YSFEDMEKADL-DIHTKAGWVALLQHYFVSAWIPNQDAN-NTLYTLTNTKKHLGSIGYRS 285

Query: 292 NEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMS 351
             I I  G + T    L+ G    P +     D+A    ++ +D+GW +FIAKP+F L++
Sbjct: 286 APIVIENGATETIHTQLWTG----PKLQDQMADVA-NHLDLTVDYGWAWFIAKPLFKLLT 340

Query: 352 YFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVL 411
              +LV N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F +   Q +
Sbjct: 341 LIQSLVQNWGLAIIGVTLVVKAVLYPLTKAQYTSMAKMRMLQPKLQEMRERFGED-RQRM 399

Query: 412 QKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPT 471
            + M++LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GW++DL+A DP 
Sbjct: 400 SQEMMKLYKEEKVNPLGGCLPILLQMPIFIALYWTFMEAVELRHAPFFGWVQDLSAQDPY 459

Query: 472 NIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFA 530
            I                    PI+M  SMF+  KMSP P AD  Q  ++ +MP++F+  
Sbjct: 460 FIL-------------------PILMGASMFLLQKMSPTPVADPMQQKVMTFMPLIFMVF 500

Query: 531 LSSFPAGLIIYWSWSNVISIVQQAVIMK 558
              FPAGL++YW  SN+I+I QQ +I +
Sbjct: 501 FLFFPAGLVLYWLASNLITIAQQWLIYR 528


>gi|194291287|ref|YP_002007194.1| inner membrane protein translocase component yidc [Cupriavidus
           taiwanensis LMG 19424]
 gi|254772772|sp|B3R883|OXAA_CUPTR RecName: Full=Inner membrane protein oxaA
 gi|193225122|emb|CAQ71133.1| preprotein translocase, cooperates with SecYEG and SecDFyajC
           translocon, membrane component [Cupriavidus taiwanensis
           LMG 19424]
          Length = 559

 Score =  225 bits (574), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 148/440 (33%), Positives = 231/440 (52%), Gaps = 46/440 (10%)

Query: 134 ELPNSNTVWNLISG-KILTPTTPIKLVFKNANNILFERTISLDEHYLFK----IVDT--- 185
           +LPN  TV+    G + L     +++V     N      + L + Y F+    +VD+   
Sbjct: 144 DLPNHTTVFTAAPGPRALDGAEQVQVVLTGEKN-----GVKLVKTYTFRKGSYVVDSKFD 198

Query: 186 VTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ-KYSDIEKSSIS- 243
           VTN     +  +    + R   +   + F       A+  D     +  + DI K   + 
Sbjct: 199 VTNAGTAPVSPTLYLELARDGSKVEQSQFYSTFTGPAIYTDADKYHKLSFEDIAKGKATV 258

Query: 244 NFHESNSWLGISDKYWASVFIP--SKETSFHSQFKYLSDGHARYQAKFSANEITILPGKS 301
               +N W+ +   Y+AS +IP   KE SF+ Q   +     R   +    E+   PG +
Sbjct: 259 PAAANNGWVAMVQHYFASAWIPQTGKEHSFYVQ--QIDPNLYRVGIQQPLGELA--PGAT 314

Query: 302 ITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFG 361
           ++T   LFAG +E     H  + +A P  E++ D+GW   +AKP+F L+   +  +GN+G
Sbjct: 315 VSTDARLFAGPQE----EHMLEKIA-PGLELVKDYGWLTILAKPLFWLLEKLHGFLGNWG 369

Query: 362 IAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKT 421
            +I+  TV +KL+FFPL+   Y S   MK++QP++  +RE++K   PQ + + M+ LY+T
Sbjct: 370 WSIIALTVLIKLVFFPLSAASYKSMGKMKDLQPRMTSIRERYKND-PQKMNQEMMALYRT 428

Query: 422 HNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILP 481
             +NPL GC PI++QIPVF A+Y V+  S+EMR AP+ GWI DL+  D           P
Sbjct: 429 EKVNPLGGCLPIVIQIPVFIALYWVLLSSVEMRGAPWLGWIHDLSVPD-----------P 477

Query: 482 FYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIY 541
           FY        I PI+M++SMF+Q K++P P D  QA ++  MP+VF      FPAGL++Y
Sbjct: 478 FY--------ILPIVMAVSMFVQTKLNPTPPDPVQAKVMMIMPLVFSVMFFFFPAGLVLY 529

Query: 542 WSWSNVISIVQQAVIMKMHG 561
           W  +N++SI QQ  I +M G
Sbjct: 530 WVVNNILSIAQQWQINRMLG 549


>gi|152980131|ref|YP_001355384.1| preprotein translocase YidC subunit [Janthinobacterium sp.
           Marseille]
 gi|166975871|sp|A6T4D7|OXAA_JANMA RecName: Full=Inner membrane protein oxaA
 gi|151280208|gb|ABR88618.1| preprotein translocase YidC subunit [Janthinobacterium sp.
           Marseille]
          Length = 564

 Score =  225 bits (574), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 161/490 (32%), Positives = 245/490 (50%), Gaps = 31/490 (6%)

Query: 80  GSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSN 139
             I+  G +   L L  +H    S   IV  L  S     Y  +   +  A     PN  
Sbjct: 95  ADIDTVGGEIRHLELLTHHESSDSTKDIV--LFDSTPPRTYLGQTGLIGGA----YPNHK 148

Query: 140 TVWNLISG-KILTPTTPIKLVFK-NANNILFERTISLDE-HYLFKIVDTVTNNSIDQIRF 196
           +++ +  G + L     ++LV +   N +   +T +     Y   I   V N +   I  
Sbjct: 149 SLFTVRPGPRSLEAGDQVQLVLEAEQNGVKLVKTYTFKRGEYKIDIKHDVINKTAAAINP 208

Query: 197 SPRGRIMRHKPQTATNT-FGVQEGFIAVLGDKSLVEQ-KYSDIEKSSISNFHESNS-WLG 253
           S   +++R   +    + F       AV  D    ++  +  IEK  I +  ++ S W+ 
Sbjct: 209 SLYLQLVRDGSKLNNESMFYSTFTGPAVYSDSDKFQKVTFESIEKGKIEHVVKAESGWIA 268

Query: 254 ISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAK 313
           +   Y+ S F+P          K L+       A      +   PG + +    L++G +
Sbjct: 269 MVQHYFVSAFVPPANVPREYFTKKLATNLYAVGAIMPMGAVA--PGATQSMDATLYSGPQ 326

Query: 314 EFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKL 373
           E   +     +   P FE++ D+GW   IAKP+F LM   + L+GN+G  I++ T+ +KL
Sbjct: 327 ESKRL-----EAVAPGFELVKDYGWLTIIAKPIFWLMIQIHQLLGNWGWTIVVLTIVIKL 381

Query: 374 LFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPI 433
            FFPL+   Y S A MK + PK+ E+R K+K   PQ +  AM++LYK   INPL GC PI
Sbjct: 382 AFFPLSAASYRSMAKMKLVTPKMTEIRTKYKGE-PQKMNAAMMELYKKEKINPLGGCMPI 440

Query: 434 LLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMH--VG 491
           ++QIPVF ++Y V+  S+EMR+AP W WI DLA+ D     TLFG    Y+ G  H  +G
Sbjct: 441 VIQIPVFISLYWVLLASVEMRNAP-WLWISDLASPD-----TLFG---SYMIGSFHLTIG 491

Query: 492 IWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIV 551
           I PI+M++SMFIQ K++P P D  QA ++ +MP+ F      FPAGL++YW  +N++SI 
Sbjct: 492 ILPILMAISMFIQTKLNPTPPDPIQAKVMMFMPIAFSLMFFFFPAGLVLYWVVNNILSIA 551

Query: 552 QQAVIMKMHG 561
           QQ  I K  G
Sbjct: 552 QQWTISKKMG 561


>gi|292493917|ref|YP_003529356.1| hypothetical protein Nhal_3959 [Nitrosococcus halophilus Nc4]
 gi|291582512|gb|ADE16969.1| 60 kDa inner membrane insertion protein [Nitrosococcus halophilus
           Nc4]
          Length = 554

 Score =  225 bits (573), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 156/529 (29%), Positives = 261/529 (49%), Gaps = 41/529 (7%)

Query: 38  KNIQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGY 97
           + +   + P  V  +    + D     +     +E+K   L   I +      ++ L  Y
Sbjct: 53  EEVPDAQLPEGVPGTTPPEMADMDTTPIQPGQTIEVKTDLLTVKIEMASGDLYEVQLLDY 112

Query: 98  HLDVSSNSPIVTLLSPSN-----TKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTP 152
            + +   +  V+LL  ++     T++   A      T    +   S   + L+ G+    
Sbjct: 113 PVSLKKPNEPVSLLHQADPDLFVTQSGLRAVSGPSVTHETAQFSASKAYYELVPGE---D 169

Query: 153 TTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQI-RFSPRGRIMRHKPQTAT 211
           +  + L +++ N I   +T           +     N  DQ+    P  + +R  P++  
Sbjct: 170 SLVVPLTWEDENGIKVTKTYIFHRDSYEVDLKLKIENGTDQVWTGRPYAQFIRTPPKS-- 227

Query: 212 NTFGVQEGFIAVLGDKSLVEQK--YSDIEKSSISNFHESNSWLGISDKYWASVFIPSKET 269
           ++F V+    AV   +    QK  + D+   S    H S  W  +   Y+ + +IP +E 
Sbjct: 228 DSFFVRSYIGAVFSTEENEYQKVDFGDLASQSFER-HSSGGWAAMLQHYFVAAWIPREEG 286

Query: 270 SFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPR 329
           S +   K++    +RY A    ++ T+ PG++      LFAG    P I       A P+
Sbjct: 287 SNYYYGKHVRG--SRYIAGVMPSQQTVAPGENGEFNLSLFAG----PKIQDRLAATA-PK 339

Query: 330 FEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANM 389
             + +D+G    +A+P+F LMS+F++LVGN+G AI+L TV VKL+FF L++  Y S A M
Sbjct: 340 LNLTVDYGKLTILAEPLFWLMSWFHSLVGNWGWAIVLLTVVVKLIFFKLSQTSYRSMARM 399

Query: 390 KNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISI 449
           + +QP++  L+E+      ++ Q AM++LY+   +NP+ GC PIL+QIPVF A+Y ++  
Sbjct: 400 RKLQPQLLALKERHGDDRHKMGQ-AMMELYRKEKVNPMGGCLPILVQIPVFIALYWMLIE 458

Query: 450 SLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSP 509
           S+E+RHAPF  WI+DL A DP  I                    P++M +SMF+Q K+SP
Sbjct: 459 SVELRHAPFVFWIQDLTAKDPYYIL-------------------PLLMGVSMFVQQKLSP 499

Query: 510 PPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
            P D  QA +++ MPV+F      FPAGL++YW  +N++SI QQ  I +
Sbjct: 500 APTDPIQAKVISLMPVMFTIFFVLFPAGLVLYWVVNNILSIAQQWYITR 548


>gi|237747151|ref|ZP_04577631.1| preprotein translocase YidC subunit [Oxalobacter formigenes HOxBLS]
 gi|229378502|gb|EEO28593.1| preprotein translocase YidC subunit [Oxalobacter formigenes HOxBLS]
          Length = 557

 Score =  225 bits (573), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 155/488 (31%), Positives = 241/488 (49%), Gaps = 41/488 (8%)

Query: 82  INLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTV 141
           IN +G  F +L L  Y  +V     ++  L  S     Y A+            PN  T 
Sbjct: 95  INSEGGVFQNLELLKYPDNVDPEKDMI--LFESVPPRIYLAQTGLTGGV----YPNHATR 148

Query: 142 WNLISGK--ILTPTTPIKLVFK-NANNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFS 197
           + +  G+  +      +KLV     + +   +T +     Y+  +   VTN + + I  S
Sbjct: 149 FTVHPGERSLADGKDEVKLVMDAERDGVRLTKTYTFKRGSYVVDVDQKVTNLTNEPIDAS 208

Query: 198 PRGRIMRH--KPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNF--HESNSWLG 253
              +++R   +P+  +       G           + K+ DI ++  ++      N W+ 
Sbjct: 209 LYLQLLRDSSRPEGQSRFISTFTGPAVYTQADKFQKLKFDDITETKGADHATKADNGWIA 268

Query: 254 ISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAK 313
           I   Y+ S FIP  +    +  K +  G   Y         TI P  S +  + L+AG +
Sbjct: 269 IVQHYFVSAFIPKDKVERENYTKKV--GEDLYAIGTVIPLGTIAPKASASNDSRLYAGPQ 326

Query: 314 EFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKL 373
           E   +         P  E++ D+GW   IAKP+F LM++ +  VGN+G  I+L T  +KL
Sbjct: 327 ESIILEQ-----TAPGLELVKDYGWLTIIAKPIFWLMTHIHKEVGNWGWTIILLTCLIKL 381

Query: 374 LFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPI 433
           +F PL+   Y S A MK   P+I ELR+++K    Q + + ++ LYK   INPL GC P+
Sbjct: 382 VFLPLSAASYKSMARMKQFTPRIQELRDRYKDD-KQRMNQELMALYKAEKINPLGGCLPV 440

Query: 434 LLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIW 493
           ++QIPVF ++Y V+  S+E+R+AP+ GWI++LAA D           PFY        I 
Sbjct: 441 VVQIPVFISLYWVLLASVEIRNAPWLGWIQNLAAPD-----------PFY--------IL 481

Query: 494 PIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQ 553
           PIIM+ SMFIQ KMSPPP D  QA ++ ++P+VF      FP+GL++YW  +N++SI QQ
Sbjct: 482 PIIMAGSMFIQQKMSPPPPDPLQAKLMMFLPIVFSITFFFFPSGLVLYWVVNNLLSIAQQ 541

Query: 554 AVIMKMHG 561
             I K +G
Sbjct: 542 YWINKRYG 549


>gi|88705404|ref|ZP_01103115.1| Inner membrane protein oxaA [Congregibacter litoralis KT71]
 gi|88700494|gb|EAQ97602.1| Inner membrane protein oxaA [Congregibacter litoralis KT71]
          Length = 580

 Score =  225 bits (573), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 149/511 (29%), Positives = 255/511 (49%), Gaps = 68/511 (13%)

Query: 71  VELKNPSLIGSINLKGAQFDDLNLRGYHLDVSS-NSPIVTLLSPSNTKNAYFAE------ 123
           +++   SL  +I+LKG    ++ L  +  D+   ++P V L   +N++  Y A+      
Sbjct: 106 IQVYTDSLQLAIDLKGGDIVEVALPKFLADIDDPDTPFVLL--ENNSRRVYVAQSGLIGK 163

Query: 124 --------LDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNI-LFERTISL 174
                    +Y STA+  E+  ++T+              + L + N   I + +R   L
Sbjct: 164 NGIDSKARANYQSTASRYEMGAADTL-------------EVDLTWSNDAGIEVTKRFRFL 210

Query: 175 DEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQE-----GFIAVLGDKSL 229
            + Y+  +   + N S +  + +  G+I R      +   G        G    + D   
Sbjct: 211 RDSYVVDVDFIINNQSSEAWQGNLFGQIKRDSSAADSGGGGSMGMQPFLGAATTMPDDRF 270

Query: 230 VEQKYSDIEKSSISNFHESN--SWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA 287
            +  + D++      F E N   W+ +   Y+ S +IP+ E +     +  + G     A
Sbjct: 271 KKFSFEDMQDDP---FREQNIGGWIAMIQHYFLSAWIPNPEKTHTYSTRVTNSGFNI--A 325

Query: 288 KFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMF 347
            F++  + + PG     +   +AG K+      Y      P  E+ +D+GW +++A+P+F
Sbjct: 326 GFTSPAVVVAPGAQQEVSARFYAGPKD-----QYSLQEISPFLELSVDYGWLWWVAQPLF 380

Query: 348 MLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSP 407
            L++  + +VGN+G+AI+L TV +K +FF L+   Y S ANM+ +QPK+ ++RE++    
Sbjct: 381 WLLTKIFAVVGNWGVAIILLTVLIKAVFFKLSATSYKSMANMRRVQPKMADIREQYADD- 439

Query: 408 PQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAA 467
            Q   +AM++LYK   INP+ GC PIL+Q+PVF A+Y ++  S+E+RHAPF  WI DL+ 
Sbjct: 440 KQKQSQAMMELYKKEKINPMGGCLPILVQMPVFIALYWMLMESVELRHAPFMLWIDDLSV 499

Query: 468 ADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVF 527
            DP  +                    P++M  SMF   K++PPP D  QA I+ W+PV+F
Sbjct: 500 MDPYFVL-------------------PLMMGASMFFMQKLNPPPPDPMQAKIMQWLPVIF 540

Query: 528 VFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
            F    FPAGL++YW  +N++S+ QQ VI +
Sbjct: 541 TFFFLWFPAGLVLYWVVNNLLSMAQQYVITR 571


>gi|56477030|ref|YP_158619.1| preprotein translocase subunit yidC [Aromatoleum aromaticum EbN1]
 gi|81677486|sp|Q5P4P4|OXAA_AZOSE RecName: Full=Inner membrane protein oxaA
 gi|56313073|emb|CAI07718.1| preprotein translocase subunit yidC [Aromatoleum aromaticum EbN1]
          Length = 550

 Score =  224 bits (572), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 154/522 (29%), Positives = 254/522 (48%), Gaps = 64/522 (12%)

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
           A   S +PR+ ++   ++  ++ +G     L L  +          V  L    T + Y 
Sbjct: 66  AATASTAPRMVVRTDLMVAEVSAQGGDIVRLELAQHKATADKTKNFV--LFDDGTIHLYA 123

Query: 122 AELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFK----NANNILFERTISLDE- 176
           A+   +      +LP   T + L  G+ +      +LV +      + +   + ++    
Sbjct: 124 AQSGLIGE----DLPTHKTTFALPQGEQVLKEGEDRLVVRLEAPEQDGVKVTKVMTFHRG 179

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRG--RIMRH-KPQTATNTFGVQEGFIAVLGDKSLVEQK 233
           +YL  +   + N+S  +   SP    ++ R  KP  +   FGV   F             
Sbjct: 180 NYLVDVAYEIVNSS--ERTLSPHAYYQLTRDGKPAESVEAFGVTT-FTG--------PAF 228

Query: 234 YSDIEKSSISNFHE------------SNSWLGISDKYWASVFIPSKETSFHSQFKYLSDG 281
           Y+D EK     F E            S+ W+ +   Y+ S ++P   T    +F     G
Sbjct: 229 YTDAEKFQKVQFEEIAEGKAKFVKKASDGWIAMVQHYFVSAWLPQGGT--EREFFAQKVG 286

Query: 282 HARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYF 341
           +  Y A        I PG+S      L+AG +E        +D+A P  ++++D+GW   
Sbjct: 287 NDLYSAGVIVPVAAIQPGQSGRVEASLYAGPQE----QDKLEDIA-PGLDLVVDYGWLTV 341

Query: 342 IAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELRE 401
           IA P+F ++S+ + +VGN+G AI++ T+ +KL+FFPL+   Y S A M+ + P++  L+E
Sbjct: 342 IAAPLFWVLSWIHGVVGNWGWAIIIVTILIKLMFFPLSAASYKSMAKMRVLGPRMQRLKE 401

Query: 402 KFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGW 461
            +     + +Q+ M+++Y+   INPL GC PIL+QIPVF ++Y V+  S+EMR AP+ GW
Sbjct: 402 LYGNDKAK-MQQEMMEMYRKEKINPLGGCLPILVQIPVFISLYWVLLGSVEMRQAPWLGW 460

Query: 462 IKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILN 521
           I+DL+A DP  I                    P+IM +SM IQMK++P P D  QA ++ 
Sbjct: 461 IQDLSAKDPYFIL-------------------PVIMGVSMLIQMKLNPTPPDPIQAKVMM 501

Query: 522 WMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
            MPV+F F    FP+GL++YW  +N++SI QQ  I +M  +E
Sbjct: 502 AMPVIFTFMFLWFPSGLVLYWVVNNILSIAQQWQITRMIESE 543


>gi|17544723|ref|NP_518125.1| inner membrane protein translocase component YidC [Ralstonia
           solanacearum GMI1000]
 gi|38503108|sp|Q8Y3H6|OXAA_RALSO RecName: Full=Inner membrane protein oxaA
 gi|17427012|emb|CAD13532.1| putative preprotein translocase subunit yidc transmembrane
           [Ralstonia solanacearum GMI1000]
          Length = 553

 Score =  224 bits (572), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 128/331 (38%), Positives = 192/331 (58%), Gaps = 32/331 (9%)

Query: 234 YSDIEKSSISNFHESNS-WLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSAN 292
           ++DI+KS       ++S W+ +   Y+AS +IP+   S   +F         Y+      
Sbjct: 243 FADIDKSKAHVPAPTDSGWVAMVQHYFASAWIPA--ASAKREFYVDRIDTNFYRVGMQQA 300

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLA--IPRFEMLIDWGWFYFIAKPMFMLM 350
             T+ PG S++ T  LFAG +E       E+ L    P  E++ D+GW   IAKP+F L+
Sbjct: 301 LGTVAPGASVSATARLFAGPQE-------ERMLEGITPGLELVKDYGWLTIIAKPLFWLL 353

Query: 351 SYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQV 410
              + L+GN+G +I+  TV VKL+FFPL+   Y S A MK++QP++  +RE+ K   PQ 
Sbjct: 354 EKIHKLLGNWGWSIVALTVLVKLVFFPLSATSYRSMAKMKDLQPRMTAIRERHKGD-PQK 412

Query: 411 LQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADP 470
           + + M+ LY+T  +NPL GC PI++QIPVF A+Y V+  S+EMR AP+ GW+ DLA+ D 
Sbjct: 413 MNQEMMTLYRTEKVNPLGGCLPIVIQIPVFIALYWVLLSSVEMRGAPWLGWVHDLASPD- 471

Query: 471 TNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFA 530
                     PFY        I PI+M++SMF+Q +++P P D  QA ++ +MP+ F   
Sbjct: 472 ----------PFY--------ILPILMAVSMFVQTRLNPTPPDPVQAKMMMFMPIAFSVM 513

Query: 531 LSSFPAGLIIYWSWSNVISIVQQAVIMKMHG 561
              FPAGL++YW  +N +SI QQ  I +M G
Sbjct: 514 FFFFPAGLVLYWVVNNCLSIAQQWSINRMLG 544


>gi|189426685|ref|YP_001953862.1| hypothetical protein Glov_3642 [Geobacter lovleyi SZ]
 gi|254772788|sp|B3E3S0|OXAA_GEOLS RecName: Full=Inner membrane protein oxaA
 gi|189422944|gb|ACD97342.1| 60 kDa inner membrane insertion protein [Geobacter lovleyi SZ]
          Length = 530

 Score =  224 bits (571), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 171/576 (29%), Positives = 283/576 (49%), Gaps = 80/576 (13%)

Query: 9   VAIALSVIIVYAWQNFYVYPRIEEMNNERKNI-QTVKQPNQVDNSYAAVLIDDRAQALS- 66
           +A+ LS+ + Y +  FY          E+K     V  P + +N  AA  +  +A A++ 
Sbjct: 7   LAVVLSIGVFYLFSFFY--------GPEKKPAPAAVSVPVKTENVGAAPAVSVQAAAIAP 58

Query: 67  -MSPR------VELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNA 119
            + P+      V ++        +  GA    L L+G+       +  V LL+ ++    
Sbjct: 59  VVVPKIVSAADVTVETERYTAVFSGVGASLKSLTLKGFRETNKPGAAQVKLLANADPALP 118

Query: 120 YFAE--LDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD-E 176
            F+   + +  +A     PN +++  L+SG+       +   + +A   +  +T + D  
Sbjct: 119 SFSTRGVGFALSAQAAYSPNVSSL-KLLSGE----KKQLVFTYVDAQGFVVRKTYTFDGT 173

Query: 177 HYLFKIVDTVTNNSIDQIR----------FSPRGRIMRHKPQTATNTFGVQEGFIAVLGD 226
            Y   +   + NNS   I           F P  +  R++      T+G      ++  D
Sbjct: 174 GYGIALETQLVNNSAAPIAGAFQYLFTSPFDPPQKDGRYE------TYGS-----SLYAD 222

Query: 227 KSLVEQKYSDIEK---SSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
            SL    ++D  K   S+   + +  +W  I+DKY+ S  +    +    + K  + G+ 
Sbjct: 223 GSL----HTDAPKNVASATKKYDKGITWAAINDKYFLSALLSVNNSIASVELKKSAAGY- 277

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
             ++  S    ++ PG+++T  + LF G KE   +      L     E  +D GWF  IA
Sbjct: 278 -LESDISTPAFSVAPGQAVTVAHKLFIGPKEIDILKAQGSSL-----EQSLDLGWFSAIA 331

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           KPM   + +FY  VGN+GIAI++ TV +K+ FFPL  K Y S   M  +QPK+  L+EK+
Sbjct: 332 KPMLYSLKFFYRYVGNYGIAIIIITVILKIFFFPLTHKSYKSMKEMGKLQPKMAALKEKY 391

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
           K      + +A+++LY+ H +NPL GC P+++QIPVFFA+YK +  S+E+RHAPF  WI 
Sbjct: 392 KND-KDAMNRAVMELYRDHKVNPLGGCLPMIVQIPVFFALYKALMYSIELRHAPFMFWIT 450

Query: 464 DLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWM 523
           DL+  D           PFY        + P+IM ++MFIQ KM+P   D+ Q  I+  +
Sbjct: 451 DLSDKD-----------PFY--------VTPVIMGVTMFIQQKMTPSNMDEMQQKIMLGL 491

Query: 524 PVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKM 559
           PV+F F   SFP+GL++YW  +N+++I QQA I K+
Sbjct: 492 PVIFTFMFLSFPSGLVLYWLINNILTIGQQAYINKL 527


>gi|253702733|ref|YP_003023922.1| hypothetical protein GM21_4149 [Geobacter sp. M21]
 gi|259515695|sp|C6DYS1|OXAA_GEOSM RecName: Full=Inner membrane protein oxaA
 gi|251777583|gb|ACT20164.1| 60 kDa inner membrane insertion protein [Geobacter sp. M21]
          Length = 536

 Score =  224 bits (571), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 130/359 (36%), Positives = 199/359 (55%), Gaps = 33/359 (9%)

Query: 205 HKPQTATNTFGVQEGFIAVLGDKSLVEQK-----YSDIEKSSISNFHESNSWLGISDKYW 259
           H  QT+      +EG   V    +L E K       D++K+ +  + +  +W   +DKY+
Sbjct: 203 HLLQTSRVVDAKKEGRYEVYSPSTLAEGKVKLDDLEDLQKTPV-QYGKDIAWSAFADKYF 261

Query: 260 ASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIH 319
               I  K +   SQ +     +       ++  +++ PG+       ++ G K+   + 
Sbjct: 262 VDGIIADKGSI--SQVRITRPANDAILRDVASPTVSVAPGQRSAINYAIYYGPKDLDILK 319

Query: 320 HYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLA 379
                L   RFE +ID+GWF  IAKP+   + + Y   GN+GIAI++ T  +KL+FFPL 
Sbjct: 320 -----LQGSRFEEVIDYGWFGPIAKPLIYSLKFLYKYTGNYGIAIIIITFILKLVFFPLT 374

Query: 380 KKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPV 439
            K Y S  +M+ +QPK+ EL+EKFK      + +A+++LYKTH +NPL GC P+L+QIPV
Sbjct: 375 HKSYKSMKDMQKLQPKMTELKEKFKND-RDAMNRAVMELYKTHKVNPLGGCLPMLVQIPV 433

Query: 440 FFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSL 499
           FF +Y+ +  S+E+RHAPF+ WI DL+A D           P+Y        + PIIM  
Sbjct: 434 FFGLYRALMYSIELRHAPFYLWITDLSAKD-----------PYY--------VTPIIMGA 474

Query: 500 SMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           +MFIQ KM+P   D  QA ++  +P+VF F   +FP+GL+IYW  +NV++I QQ  I K
Sbjct: 475 TMFIQQKMTPTNMDPVQAKMMLMLPIVFTFMFLNFPSGLVIYWLVNNVLTIAQQMYINK 533


>gi|167856364|ref|ZP_02479091.1| putative inner membrane protein translocase component YidC
           [Haemophilus parasuis 29755]
 gi|167852502|gb|EDS23789.1| putative inner membrane protein translocase component YidC
           [Haemophilus parasuis 29755]
          Length = 546

 Score =  224 bits (571), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 143/488 (29%), Positives = 249/488 (51%), Gaps = 46/488 (9%)

Query: 81  SINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYV------STANNIE 134
           +++  G    D +L  Y+ ++ SN+P   L    N K  Y A+   V      +TA   +
Sbjct: 82  TVDTLGGDVVDSDLLKYNAELDSNTPFELL--QDNGKVLYVAQSGLVGKNGIDTTAGRAQ 139

Query: 135 LPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE-HYLFKIVDTVTNNSIDQ 193
              +   + L  G+       + L F+  +++++ +T +L    Y   +   + N S + 
Sbjct: 140 YQATAEKFALAEGQ---NEIDVPLTFEK-DDVVYTKTFTLKRGSYNVAVNYHIKNGSAET 195

Query: 194 IRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS--DIEKSSISNFHESNSW 251
           +   P G+ ++H    +   F +            +  +KYS  ++ K+++S       W
Sbjct: 196 LEVQPYGQ-LKHTLVESAGNFAMPTYTGGAYSSSEVNYKKYSFDEMAKANLS-VDTKAGW 253

Query: 252 LGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAG 311
             +   Y+ S +IP+++   +    Y   G+      +      + P    T  + L+ G
Sbjct: 254 AAVLQHYFVSAWIPNQDAENN---LYTRTGNGVGTIGYRGPVTQVAPNGEATIISHLWTG 310

Query: 312 AKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFV 371
            K+   +     +     F++ +D+GW +FIAKP+F L+++  ++V N+G+AI+  T+ V
Sbjct: 311 PKDQAAMAQVANN-----FDLTVDYGWAWFIAKPLFWLLTFIQSIVSNWGLAIIGVTIVV 365

Query: 372 KLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCW 431
           K + +PL K QY S A M+ +QP+I E+RE+F     Q + + M++LYK   +NP+ GC 
Sbjct: 366 KTILYPLTKAQYTSMAKMRMLQPRIQEMRERFGDD-RQRMSQEMMKLYKEEKVNPMGGCL 424

Query: 432 PILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVG 491
           PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A DP  IF                 
Sbjct: 425 PILLQMPIFIALYWTFMEAVELRHAPFFGWIQDLSAQDPYYIF----------------- 467

Query: 492 IWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISI 550
             P++M  SM++  KMSP P AD  Q  ++N+MPV+F      FP+GL++YW  SN+I+I
Sbjct: 468 --PLLMGGSMYLLQKMSPTPIADPVQQKVMNFMPVMFTVFFLWFPSGLVLYWLTSNLITI 525

Query: 551 VQQAVIMK 558
            QQ +I +
Sbjct: 526 AQQWLIYR 533


>gi|261346746|ref|ZP_05974390.1| membrane protein insertase, YidC/Oxa1 family [Providencia
           rustigianii DSM 4541]
 gi|282565146|gb|EFB70681.1| membrane protein insertase, YidC/Oxa1 family [Providencia
           rustigianii DSM 4541]
          Length = 550

 Score =  224 bits (571), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 155/576 (26%), Positives = 284/576 (49%), Gaps = 64/576 (11%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
           +RN    + IAL  +    WQ +      +++  E K +QT +Q   + NS    + +  
Sbjct: 4   QRN---LLLIALLFVTFLVWQAW----ESDKVAQETKTVQTSQQKTDMPNSDGQAVTNSE 56

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
              L     + +K   L   IN +G   D+ +L  Y   ++S  P   L   +     Y 
Sbjct: 57  QGKL-----IAVKTDVLDVRINTRGGDIDEADLLAYPATLNSPDPFRLL--ETTPGFVYQ 109

Query: 122 AELDYVS-------TANNIELP---NSNTVWNLISGKILTPTTPIKLVFKNANNILFERT 171
           A+   +          NN + P     +  + L +G+       + + F + N +++++T
Sbjct: 110 AQSGLIGPHGPDNPANNNGQRPLYTADSASFELQAGQ---DELRVPMSFTDNNGVVYQKT 166

Query: 172 ISLDE-HYLFKIVDTVTNNSIDQIRFSPRGRIMR-----HKPQTATNTFGVQ--EGFIAV 223
             L    Y  ++  ++ N +   +  +  G++ +      +  T +N F +    G    
Sbjct: 167 YILKRGKYTVEVEYSIQNPTAQPLSLAFFGQLKQTIALPEQRDTGSNNFALHTYRGAAYS 226

Query: 224 LGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
             + +  +  +SDIE  ++S       W+ +  +Y+A+ ++P  E +  S F  +     
Sbjct: 227 SDENNYKKYSFSDIEDKNLS-LTTKGGWVAMLQQYFATAWVP--EATEQSTFYTIDLDKK 283

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
                + +  +TI    + T ++ L+ G    P I     ++A P  ++ +D+GW +FI+
Sbjct: 284 SAIVGYKSEPVTIAANGAGTYSSTLWIG----PEIQSEMAEVA-PHLDLTVDYGWLWFIS 338

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           +P+F L+ + +  VGN+GIAI++ T  V+ + +PL K QY S A M+ +QPK+  +RE+ 
Sbjct: 339 QPLFKLLKFIHGFVGNWGIAIIVITFIVRGIMYPLTKAQYTSMAKMRLLQPKLAAMRERI 398

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
                Q + + M+ +YK   +NPL GC P+L+Q+P+F A+Y ++  S+E+RHAPF+GWI+
Sbjct: 399 GDD-KQRMSQEMMAMYKAEKVNPLGGCLPLLIQMPIFLALYYMLMGSVELRHAPFFGWIQ 457

Query: 464 DLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNW 522
           DL+A D           P+Y        I P++M ++MF+  KMSP    D  Q  I+ +
Sbjct: 458 DLSAQD-----------PYY--------ILPVLMGVTMFVIQKMSPTAVTDPMQQKIMTY 498

Query: 523 MPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           MPVVF      FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 499 MPVVFTVFFLWFPSGLVLYYIVSNLVTIIQQQIIYR 534


>gi|212712607|ref|ZP_03320735.1| hypothetical protein PROVALCAL_03702 [Providencia alcalifaciens DSM
           30120]
 gi|212684823|gb|EEB44351.1| hypothetical protein PROVALCAL_03702 [Providencia alcalifaciens DSM
           30120]
          Length = 553

 Score =  224 bits (571), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 157/586 (26%), Positives = 285/586 (48%), Gaps = 81/586 (13%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
           +RN      + +S ++  AW++       +++  E K +Q  +Q   + +S +     + 
Sbjct: 4   QRNLLLIALLFVSFLVWQAWES-------DKVAQETKAVQVSQQKTDMPSSAS-----ND 51

Query: 62  AQALSMSPR---VELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLS------ 112
            QA++ S +   + +K   L   IN +G   D+ +L  Y   ++S  P   L +      
Sbjct: 52  GQAVTGSEQGKLIAVKTDVLDIRINTRGGDIDEADLLAYPATLNSPDPFRLLETTPGFVY 111

Query: 113 -----------PSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFK 161
                      P N  N       Y S A + EL +                  I + F 
Sbjct: 112 QAQSGLIGPHGPDNPANNNGQRPLYTSDATSFELKDGQDELR------------IPMTFT 159

Query: 162 NANNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFSPRGRIMR-----HKPQTATNTFG 215
           + N +++++T  L    Y   +   + N +   +  +  G++ +      +  T ++ F 
Sbjct: 160 DNNGVVYQKTYILKRGKYTVDVEYNIQNPTAQPLTLAFFGQLKQTIALPEQRDTGSSNFA 219

Query: 216 VQ--EGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHS 273
           +    G      + +  +  +SDIE  ++S       W+ +  +Y+A+ +IP+  +S  S
Sbjct: 220 LHTYRGAAYSSDENNYKKYSFSDIEDKNLS-LTTKGGWVAMLQQYFATAWIPA--SSEQS 276

Query: 274 QFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEML 333
            F  +          + +  +TI    + T ++ L+ G    P I     ++A P  ++ 
Sbjct: 277 TFYTIDLDKKSAIVGYKSEPLTIASNGAATYSSTLWVG----PEIQSEMAEVA-PHLDLT 331

Query: 334 IDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQ 393
           +D+GW +FI++P+F L+ + +  VGN+GIAI++ T  V+ + +PL K QY S A M+ +Q
Sbjct: 332 VDYGWLWFISQPLFKLLKFIHGFVGNWGIAIIVITFIVRGIMYPLTKAQYTSMAKMRLLQ 391

Query: 394 PKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEM 453
           PK+  +RE+      Q + + M+ LYK+  +NPL GC P+L+Q+P+F A+Y ++  S+E+
Sbjct: 392 PKLAAMRERIGDD-KQRMSQEMMALYKSEKVNPLGGCLPLLIQMPIFLALYYMLMGSVEL 450

Query: 454 RHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-A 512
           RHAPF+GWI+DL+A D           P+Y        I P++M ++MF+  KMSP    
Sbjct: 451 RHAPFFGWIQDLSAQD-----------PYY--------ILPVLMGVTMFVIQKMSPTTVT 491

Query: 513 DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           D  Q  I+ +MPVVF      FP+GL++Y+  SN+++I+QQ VI +
Sbjct: 492 DPMQQKIMMYMPVVFTVFFLWFPSGLVLYYIVSNLVTIIQQQVIYR 537


>gi|317154269|ref|YP_004122317.1| membrane protein insertase, YidC/Oxa1 family [Desulfovibrio
           aespoeensis Aspo-2]
 gi|316944520|gb|ADU63571.1| membrane protein insertase, YidC/Oxa1 family [Desulfovibrio
           aespoeensis Aspo-2]
          Length = 554

 Score =  224 bits (570), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 168/581 (28%), Positives = 286/581 (49%), Gaps = 78/581 (13%)

Query: 9   VAIALSVIIVYAWQNFYVYPRIEE--------MNNERKNIQTVKQPNQVDNSYA-AVLID 59
           +A+ALS I+++ WQ + + P  EE        +  ER+ +    Q +    + A  V   
Sbjct: 11  IALALSFIVIFGWQ-YLMAPSAEEQAEVARKAVEAERRAVALSSQSDAAGVTQAHGVPAG 69

Query: 60  DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNA 119
           D      ++  V +  P      N +G   +   L+ Y   +  +SP V L+      NA
Sbjct: 70  DFIATAGVA--VTVDTPLYTAVFNSQGGILEKFILKNYRETIKPDSPNVDLIG----ANA 123

Query: 120 YF-AELDYVSTANNIELPN-SNTVWNLISGKI-LTPTTPIK-LVFKN-ANNILFERTISL 174
           +    L  + TA + E        W      + L     +K L F   + +   ERT++ 
Sbjct: 124 FAKGPLGLILTAGDKEFHTWQRGEWAFAGSNLALGEGDGVKTLTFSGQSGDFRIERTLTF 183

Query: 175 DEHYLF----KIVDTVTNNSID-QIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSL 229
           D          +V T+ N  ++  + F+   + M  +  +   T   +  +++  G + +
Sbjct: 184 DPATYHITESAMVTTLGNTGVEGAVSFTAAAKSMSAEDDSYNPT---KVAYLSADGREEM 240

Query: 230 VEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKF 289
            ++   D++++ I++      W  +   Y+    IP+ E++       LS G      + 
Sbjct: 241 SDR--DDLKETGITS-PSGLKWGAVESNYFLFAIIPASESA------TLSAGVQDDIFRM 291

Query: 290 SANE-ITILPGKSITTTNFLFAGAKEFPTIHHYEKDL--AIP-RFEMLIDWGWFYFIAKP 345
           + NE  T LP  + T     F G    PT    ++D+   +P + E  +D+GWF F+AKP
Sbjct: 292 AVNEDATFLPNVTKTVKASYFLG----PT----DRDMLATMPNQLEKAVDFGWFDFLAKP 343

Query: 346 MFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQ 405
           + + +++FY+ V N+GIAI+L T+ +KL+F+PL+++ Y S   MK +QP + +LREK+  
Sbjct: 344 LLIGLNFFYDYVHNYGIAIILLTIVIKLIFWPLSQRSYASMEQMKKLQPMVQKLREKYGD 403

Query: 406 SPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG----- 460
              ++ Q+ M  LYKT+ +NP+ GC P+++QIPVFF +YK +  ++E+RHAPF       
Sbjct: 404 DKQRLNQETM-ALYKTYKVNPMGGCLPMVVQIPVFFGLYKALLGAVELRHAPFIANVPFT 462

Query: 461 ---WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQA 517
              W+ DL+A D           P+Y        + P+IM  +MF+Q KM+P   D  Q 
Sbjct: 463 DLPWLADLSAKD-----------PYY--------VTPLIMGATMFLQQKMTPSAGDPTQQ 503

Query: 518 MILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
            I+  MPVVF F    FP+GL+IYW  +NV+SI QQ +I++
Sbjct: 504 KIMMLMPVVFTFMFLQFPSGLVIYWLLNNVLSIGQQLLIVR 544


>gi|39998555|ref|NP_954506.1| hypothetical protein GSU3466 [Geobacter sulfurreducens PCA]
 gi|81700814|sp|Q746Q2|OXAA_GEOSL RecName: Full=Inner membrane protein oxaA
 gi|39985502|gb|AAR36856.1| membrane protein, putative [Geobacter sulfurreducens PCA]
 gi|298507497|gb|ADI86220.1| preprotein translocase subunit YidC [Geobacter sulfurreducens
           KN400]
          Length = 531

 Score =  223 bits (569), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 166/560 (29%), Positives = 275/560 (49%), Gaps = 55/560 (9%)

Query: 8   FVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQP-NQVDNSYAAVLIDDRAQALS 66
            +A+ LS++  Y +   +  P  E         Q+  QP  QV  +   V +  + Q   
Sbjct: 6   LIAVVLSILFFYGYTALFSPPPKETPKPVATATQS--QPAQQVTAAPVPVAVPAQPQPAV 63

Query: 67  MSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFA--EL 124
            +  V +  P+   + + +G     L+L+ YH         VTL+S  N  N        
Sbjct: 64  AARDVSVDTPAYSVTFSTQGGSIKRLDLKRYHETAGPGGKNVTLVSEDNPSNYTIGLRAP 123

Query: 125 DYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFK--NANNILFERTISLD-EHYLFK 181
            +    N + +P+++ +        + P    +L F   +   +   +T +   + Y  +
Sbjct: 124 GFGLDQNAVFVPSADAL-------TVGPGEKKQLSFTWVSPAGVTVTKTYNFSGDGYGLE 176

Query: 182 IVDTVTNNSIDQIRFSPRGRIMRHK-----PQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
           I   VTN+   ++  SP   +  +       ++   TFG      A      L E K  D
Sbjct: 177 IQYQVTNSGSARVS-SPVQTVQTYPLVPKVKESRFETFGP-----ATFAQDKLFEDKVKD 230

Query: 237 IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITI 296
           +E  S +  H +  W G +DKY+ S  +  + +   +  +  + G+   +   S+ E+++
Sbjct: 231 LE--SGAKTHAAPLWSGFADKYFLSAVLAHEGSMAAATIRKTASGY--LENTISSPELSL 286

Query: 297 LPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNL 356
            PG+    T  LF G K+   +      L     E  I+ GWF  +AKP+   + +F+N 
Sbjct: 287 NPGEGRALTYRLFFGPKDIDVLKAQGNSL-----ERAINLGWFAMLAKPLLHSLKFFHNY 341

Query: 357 VGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMI 416
            GN+GIAI++ TV +K++F+PL    Y S   M+ +QPK+ +LREK+K    + + +AM+
Sbjct: 342 TGNYGIAIIIITVIIKVIFYPLTHSSYKSMKEMQKLQPKMQQLREKYKNDR-EAMNRAMM 400

Query: 417 QLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTL 476
           +LY+TH +NP+ GC P+L+QIPVFFA+YK +  S+E+RHAPF  WI DLAA D       
Sbjct: 401 ELYQTHKVNPVGGCLPMLVQIPVFFALYKALMFSIELRHAPFMLWITDLAAKD------- 453

Query: 477 FGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPA 536
               P+Y        + PIIM ++M IQ KM+P   D  Q  ++  +PVVF F   +FP+
Sbjct: 454 ----PYY--------VTPIIMGVTMVIQQKMTPSQMDPVQQKMMMALPVVFTFMFLNFPS 501

Query: 537 GLIIYWSWSNVISIVQQAVI 556
           GL++YW  +NV++I+QQ  I
Sbjct: 502 GLVLYWLVNNVLTIIQQYYI 521


>gi|322421977|ref|YP_004201200.1| membrane protein insertase, YidC/Oxa1 family [Geobacter sp. M18]
 gi|320128364|gb|ADW15924.1| membrane protein insertase, YidC/Oxa1 family [Geobacter sp. M18]
          Length = 537

 Score =  223 bits (568), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 146/443 (32%), Positives = 229/443 (51%), Gaps = 60/443 (13%)

Query: 126 YVSTANNIELPNSNTVWNLISGKI-LTPTTPIKLVFKNANNILFERTISLDEHYLFKIVD 184
           Y  +AN ++L N +       G +  T TTP  +VFK   +          + Y   + +
Sbjct: 141 YNVSANELKLSNGS------KGTLEFTTTTPQGVVFKKIYSFS-------GDAYRIGLTE 187

Query: 185 TVTNNSIDQIRFS----PRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVE-----QKYS 235
            V N+   Q+  +       R++  K            G   V G  +L E     +K +
Sbjct: 188 QVQNSGAAQVAGALHLLQNSRVIDQK---------AGGGRYEVYGPSTLTEDAVKSEKLN 238

Query: 236 DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
           ++ K+ +  + +S +W   +DKY+    I  K +   +Q      G         +  +T
Sbjct: 239 NLLKAPV-QYDKSIAWSSFADKYFTESVIAEKGSI--AQLHMTRPGTDAMLRDIVSPAVT 295

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           + PG++ + +  L+ G K+   +      L     E +ID+GWF  IAKP+ + + + Y 
Sbjct: 296 VAPGQTASVSYALYYGPKDLDILKAQGSSL-----EKVIDYGWFAPIAKPLVVFLKFLYK 350

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
             GN+GIAI++ T  +KL+FFPL  K Y S  +M+ +QPK+  L+EK+K      + KA+
Sbjct: 351 YTGNYGIAIIIITCILKLVFFPLTHKSYKSMKDMQKLQPKMTALKEKYKNDR-DAMNKAV 409

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           ++LYKTH +NPL GC P+L+QIPVFF +Y+ +  S+E+RHAPF+ WI DL+A D      
Sbjct: 410 MELYKTHKVNPLGGCLPMLVQIPVFFGLYRALMYSIELRHAPFYLWITDLSAKD------ 463

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFP 535
                P+Y        + PIIM  +MFIQ KM+P   D  QA ++  +PVVF F   +FP
Sbjct: 464 -----PYY--------VTPIIMGATMFIQQKMTPSNMDPVQAKMMLMLPVVFTFMFLNFP 510

Query: 536 AGLIIYWSWSNVISIVQQAVIMK 558
           +GL+IYW  +NV++I QQ  I K
Sbjct: 511 SGLVIYWLVNNVLTIAQQMYINK 533


>gi|268593484|ref|ZP_06127705.1| membrane protein insertase, YidC/Oxa1 family [Providencia rettgeri
           DSM 1131]
 gi|291310905|gb|EFE51358.1| membrane protein insertase, YidC/Oxa1 family [Providencia rettgeri
           DSM 1131]
          Length = 549

 Score =  223 bits (568), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 162/579 (27%), Positives = 286/579 (49%), Gaps = 71/579 (12%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
           +RN    + IAL  +    WQ +       E +   ++++TV+   Q D      +    
Sbjct: 4   QRN---LLLIALLFVSFLVWQAW-------ESDKVAQDVKTVQTSQQAD------MPSSD 47

Query: 62  AQALSMSPRVEL---KNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
           AQA++ S + +L   K   L   IN +G   D+ +L  Y   + S SP   L   +N   
Sbjct: 48  AQAVTGSGQGKLITVKTDVLDIRINTRGGDIDEADLLAYPATLHSESPFRLL--ETNPGF 105

Query: 119 AYFAELDYVS-------TANNIELP---NSNTVWNLISGKILTPTTPIKLVFKNANNILF 168
            Y A+   +          NN E P     +T + L  G+       + + F + N +++
Sbjct: 106 VYQAQSGLIGLHGPDNPANNNGERPLYSADSTTFTLEKGQ---DVLRVPMTFTDNNGVVY 162

Query: 169 ERT-ISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR-----HKPQTATNTFGVQEGFIA 222
           ++T I     Y  ++  ++ N +   +  +  G++ +      +  T ++ F +     A
Sbjct: 163 QKTYIVKRGQYTVEVEYSIQNPTAQPLSLAFFGQLKQTIELPKERDTGSSNFALHTYRGA 222

Query: 223 VLGDKSLVEQKYS--DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
                    +KYS  DIE  ++ +      W+ +  +Y+A+ +IP+  ++  S F  +  
Sbjct: 223 AYSSDENNYKKYSFGDIEDKNL-DLTTKGGWVAMLQQYFATAWIPA--SAEKSTFYTIDL 279

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
                   + +  +TI    + T ++ L+ G    P I   E     P  ++ +D+GW +
Sbjct: 280 DKKSAIIGYKSEPMTIAANGAGTYSSTLWVG----PEIQS-EMAAVAPHLDLTVDYGWLW 334

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           FI++P+F L+ + +  VGN+GIAI++ T  V+ + +PL K QY S A M+ +QPK+  +R
Sbjct: 335 FISQPLFKLLKFIHGFVGNWGIAIIVITFIVRGIMYPLTKAQYTSMAKMRLLQPKLAAMR 394

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E+      Q + + M+ +YK   +NPL GC P+L+Q+P+F A+Y ++  S+E+RHAPF+G
Sbjct: 395 ERIGDD-KQRMSQEMMAMYKAEKVNPLGGCLPLLIQMPIFLALYYMLMGSVELRHAPFFG 453

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMI 519
           WI+DL+A D           P+Y        I P++M ++MF+  KMSP    D  Q  I
Sbjct: 454 WIQDLSAQD-----------PYY--------ILPVLMGVTMFVIQKMSPTAVTDPMQQKI 494

Query: 520 LNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           + +MPVVF      FP+GL++Y+  SN+++I+QQ VI +
Sbjct: 495 MTYMPVVFTIFFLWFPSGLVLYYIVSNLVTIIQQQVIYR 533


>gi|114332119|ref|YP_748341.1| 60 kDa inner membrane insertion protein [Nitrosomonas eutropha C91]
 gi|122313199|sp|Q0AE56|OXAA_NITEC RecName: Full=Inner membrane protein oxaA
 gi|114309133|gb|ABI60376.1| protein translocase subunit yidC [Nitrosomonas eutropha C91]
          Length = 622

 Score =  223 bits (567), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 162/523 (30%), Positives = 255/523 (48%), Gaps = 66/523 (12%)

Query: 64  ALSMSPR-------VELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNT 116
           A S++PR       + +    +I  I+  G     L L         N P   L S ++ 
Sbjct: 81  ADSVTPRLLPSGEQIRVVTDKVIAEIDTMGGDLRRLELLQQPSPEDENVPYSLLHSEAS- 139

Query: 117 KNAYFAELDYVSTANNIELPNSNTVWNLISG---------------KILTPTTPIKLVFK 161
              Y A+   V       LPN  TV+ + SG               ++L P T    V K
Sbjct: 140 -RTYVAQSGLVGEG----LPNHKTVYQVESGIRNYELTAGEDKVVIRLLAPETQGVQVIK 194

Query: 162 NANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFI 221
                 F R     + Y+  I   + N S   IR     +++R       +T  ++    
Sbjct: 195 TYT---FHR-----DSYVIDIGFEIANKSDATIRPFAYFQMLRDDTPPPAHTMMIRSFLG 246

Query: 222 AVLGDKSLVEQK--YSDIEKSSIS-NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYL 278
           A +       QK  + D++K       + +N W+ + + Y+ + ++P ++T      K  
Sbjct: 247 AAVYTDEEKYQKIPFDDLDKGKTDYPANANNGWIAMLEHYFLTAWLPPQQTPREYFAKRQ 306

Query: 279 SDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGW 338
           SD    Y A        I  G+++TTT  L+AG +E         +LA P  E+ +D+GW
Sbjct: 307 SDN--LYTAGVIVPAGVITAGETVTTTMPLYAGPEE----QDRLAELA-PGLELTVDYGW 359

Query: 339 FYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDE 398
              IAKP+F L+S++++  GN+GIAI+L T+ VKLLFFPL+   Y S A ++ + PK+  
Sbjct: 360 LTMIAKPLFRLLSFYHSWTGNWGIAIILLTITVKLLFFPLSAAGYRSMAKLRLVTPKLKR 419

Query: 399 LREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF 458
           +++++K    Q + +AM+  YKT  INP+ GC+PIL+QIPVF A+Y  I  ++E+R+APF
Sbjct: 420 IQDQYKGD-RQRMHQAMMDFYKTEKINPMGGCFPILVQIPVFIALYWTILAAVELRYAPF 478

Query: 459 WGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAM 518
             WI DL++ DP  +                    P+++ +SMFIQ +++P P D  QA 
Sbjct: 479 ALWITDLSSPDPKYLL-------------------PVLLGISMFIQTRLNPTPTDPIQAK 519

Query: 519 ILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHG 561
           I+  MPV F      FPAGL++Y   +N++SI QQ  I KM+G
Sbjct: 520 IMQIMPVAFSAIFFFFPAGLVLYSLVNNILSIAQQWKITKMYG 562


>gi|271502719|ref|YP_003335745.1| membrane protein insertase, YidC/Oxa1 family domain containing
           [Dickeya dadantii Ech586]
 gi|270346274|gb|ACZ79039.1| membrane protein insertase, YidC/Oxa1 family domain containing
           [Dickeya dadantii Ech586]
          Length = 543

 Score =  223 bits (567), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 154/569 (27%), Positives = 262/569 (46%), Gaps = 71/569 (12%)

Query: 15  VIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELK 74
           ++I   +  F ++ + E   N     QT +Q N      A    +    A      + +K
Sbjct: 8   LVIALLFVTFMIWQQWETDKNPPATTQTTQQANGAVGDAA----NQGVPASGQGKLITVK 63

Query: 75  NPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLS-----------------PSNTK 117
              L  +IN +G   ++ +L  Y  ++ SN P   L S                 P N  
Sbjct: 64  TDVLSLNINTRGGDIEEADLLAYPAELGSNQPFKLLESTPAFTYQAQSGLTGKNGPDNPA 123

Query: 118 NAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE- 176
           N   A   Y ++A+  EL                    I L + +AN + F +T  L   
Sbjct: 124 NG--ARPLYTASADRFELAAGQNELR------------IPLTYTDANGVSFTKTFVLKRG 169

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMR------HKPQTATNTFGVQEGFIAVLGDKSLV 230
            Y   +  +V N S   +  +  G++ +      H+  T +N F +     A        
Sbjct: 170 EYALNVEYSVNNTSAQPLELTLFGQLKQSIDLPSHR-DTGSNNFALHTYRGAAFSSSDDK 228

Query: 231 EQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFS 290
            +KYS  +     N +    W+ +  +Y+A+ ++P+   S  + F   + G+      F 
Sbjct: 229 YRKYSFSDMKENLNINTQGGWVAMLQQYFATAWVPNAAAS--NTFYSANLGNGLAAIGFK 286

Query: 291 ANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLM 350
           +  + + PG        L+ G    P I      +A P  ++ +D+GW +FI++P+F L+
Sbjct: 287 SPSVVVQPGSQQNLNATLWVG----PEIQDKMAAVA-PHLDLTVDYGWLWFISQPLFKLL 341

Query: 351 SYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQV 410
            + +  +GN+G +I+  T  V+ + +PL K QY S A M+ +QPK+  +RE+      Q 
Sbjct: 342 KFLHGFIGNWGFSIIAITFIVRGIMYPLTKAQYTSMAKMRMLQPKLQAMRERIGDD-KQR 400

Query: 411 LQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADP 470
           + + M+ LYKT  +NPL GC+P+++Q+P+F A+Y ++  S+E+RHAPF  WI DL+A D 
Sbjct: 401 MSQEMMALYKTEKVNPLGGCFPLVIQMPIFLALYYMLMGSVELRHAPFALWIHDLSAQD- 459

Query: 471 TNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVF 529
                     P+Y        + PI+M L+MF   KMSP    D  Q  I+ +MPV+F  
Sbjct: 460 ----------PYY--------VLPILMGLTMFFIQKMSPTTVTDPMQQKIMTYMPVIFTV 501

Query: 530 ALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
               FP+GL++Y+  SN+++I QQ +I +
Sbjct: 502 FFLWFPSGLVLYYIVSNLVTIAQQQLIYR 530


>gi|301169726|emb|CBW29327.1| cytoplasmic insertase into membrane protein, Sec system
           [Haemophilus influenzae 10810]
          Length = 541

 Score =  222 bits (566), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 127/376 (33%), Positives = 212/376 (56%), Gaps = 31/376 (8%)

Query: 186 VTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYSDIEKSSISN 244
           + N S   I   P G++     +++ N       G      + +  +  +SD++ +++S 
Sbjct: 182 IDNQSGQAIEVEPYGQLKHSIVESSGNVAMPTYTGGAYSSSETNYKKYSFSDMQDNNLS- 240

Query: 245 FHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA-KFSANEITILPGKSIT 303
                 W+ +   Y+ S +IP+++   ++Q   ++D      +  +  + +TI  G   T
Sbjct: 241 IDTKAGWVAVLQHYFVSAWIPNQDV--NNQLYTITDSKNNVASIGYRGSVVTIPAGSQET 298

Query: 304 TTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIA 363
            T+ L+ G    P + +    +A    ++ +D+GW +FIAKP+F L+++   +V N+G+A
Sbjct: 299 ITSSLWTG----PKLQNQMATVA-NNLDLTVDYGWAWFIAKPLFWLLTFIQGIVSNWGLA 353

Query: 364 IMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHN 423
           I+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++LYK   
Sbjct: 354 IICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGDD-RQRMSQEMMKLYKEEK 412

Query: 424 INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY 483
           +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A D           P+Y
Sbjct: 413 VNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQD-----------PYY 461

Query: 484 LPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPAGLIIYW 542
                   I PI+M +SMF+  KMSP P  D  Q  ++N+MP+VF+F    FPAGL++YW
Sbjct: 462 --------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLVFMFFFLWFPAGLVLYW 513

Query: 543 SWSNVISIVQQAVIMK 558
             SN+I+I QQ +I +
Sbjct: 514 LVSNLITIAQQQLIYR 529


>gi|251791812|ref|YP_003006533.1| putative inner membrane protein translocase component YidC [Dickeya
           zeae Ech1591]
 gi|247540433|gb|ACT09054.1| 60 kDa inner membrane insertion protein [Dickeya zeae Ech1591]
          Length = 543

 Score =  221 bits (564), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 149/546 (27%), Positives = 255/546 (46%), Gaps = 67/546 (12%)

Query: 38  KNIQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGY 97
           KN     Q  Q+ NS      +    A      + +K   L  +IN +G   ++ +L  Y
Sbjct: 27  KNPPAATQTTQLANSAVGDAANQGVPASGQGKLITVKTDVLSLNINTRGGDIEEADLLAY 86

Query: 98  HLDVSSNSPIVTLLS-----------------PSNTKNAYFAELDYVSTANNIELPNSNT 140
             ++SS+ P   L +                 P N  N   +   Y ++A+  ELP    
Sbjct: 87  PAELSSSQPFKLLETTPAFTYQAQSGLTGKNGPDNPANG--SRPLYTASADRFELPAGQN 144

Query: 141 VWNLISGKILTPTTPIKLVFKNANNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFSPR 199
                          I L + +AN + F +T  L    Y   +  +V N S   +  +  
Sbjct: 145 ELR------------IPLTYTDANGVSFTKTFVLKRGEYALNVEYSVNNASAQPLELALF 192

Query: 200 GRIMR------HKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLG 253
           G++ +      H+  T +N F +     A         +KYS  +     N +    W+ 
Sbjct: 193 GQLKQSIDLPSHR-DTGSNNFALHTYRGAAFSSSEDKYRKYSFSDMKENLNINTQGGWVA 251

Query: 254 ISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAK 313
           +  +Y+A+ ++P+   + ++ F   + G+      F A  + + PG        L+ G  
Sbjct: 252 MLQQYFATAWVPT--AAANNTFYSANLGNGLAAIGFKAAPVIVQPGSQQNLNATLWVG-- 307

Query: 314 EFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKL 373
             P I      +A P  ++ +D+GW +FI++P+F L+ + +  +GN+G +I+  T  V+ 
Sbjct: 308 --PEIQDKMAAVA-PHLDLTVDYGWLWFISQPLFKLLKFLHGFIGNWGFSIIAITFIVRG 364

Query: 374 LFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPI 433
           + +PL K QY S A M+ +QPK+  +RE+      Q + + M+ LYK   +NPL GC+P+
Sbjct: 365 IMYPLTKAQYTSMAKMRMLQPKLQAMRERIGDD-KQRMSQEMMALYKAEKVNPLGGCFPL 423

Query: 434 LLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIW 493
           ++Q+P+F A+Y ++  S+E+RHAPF  WI DL+A D           P+Y        + 
Sbjct: 424 IIQMPIFLALYYMLMGSVELRHAPFALWIHDLSAQD-----------PYY--------VL 464

Query: 494 PIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQ 552
           PI+M L+MF   KMSP    D  Q  I+ +MPV+F      FP+GL++Y+  SN+++I Q
Sbjct: 465 PILMGLTMFFIQKMSPTTVTDPMQQKIMTYMPVIFTVFFLWFPSGLVLYYIVSNLVTIAQ 524

Query: 553 QAVIMK 558
           Q +I +
Sbjct: 525 QQMIYR 530


>gi|238921764|ref|YP_002935279.1| inner membrane protein translocase component YidC [Edwardsiella
           ictaluri 93-146]
 gi|259515692|sp|C5BF61|OXAA_EDWI9 RecName: Full=Inner membrane protein oxaA
 gi|238871333|gb|ACR71044.1| inner membrane protein OxaA [Edwardsiella ictaluri 93-146]
          Length = 541

 Score =  221 bits (564), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 157/543 (28%), Positives = 267/543 (49%), Gaps = 63/543 (11%)

Query: 41  QTVKQPNQVDNSYAAVLIDDRAQALSMSPR---VELKNPSLIGSINLKGAQFDDLNLRGY 97
           QT   P  V  +    + D  +QA+  S +   + +K   L  +IN +G   +  +L  Y
Sbjct: 24  QTDHNPQPVAQTAGQSISDTASQAVPESGQGKLITVKTDVLALTINTRGGDIEQADLLAY 83

Query: 98  HLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNS--------NTVWNLISGKI 149
              + S++P   L   +  +  Y A+      +      N          T + ++ G+ 
Sbjct: 84  PATLGSDTPFQLL--ETTPQFVYQAQSGLTGKSGPDNPANGARPLYSANQTSYEMLPGQ- 140

Query: 150 LTPTTPIKLVFKNANNILFERTISLDEH-YLFKIVDTVTNNSIDQIRFSPRGRIM----- 203
                 I L +  AN +++ +T  L  + Y   +   V N+S D +  +  G++      
Sbjct: 141 --DELRIPLTYTAANGVIYTKTFVLKRNDYAIAVDYKVKNDSHDALDLTLFGQLKQSVDL 198

Query: 204 -RHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS--DIEKSSISNFHESNSWLGISDKYWA 260
            +H+  T +N F +     A         QKYS  DIE  ++ N      W+ +  +Y+A
Sbjct: 199 PKHR-DTGSNNFALHTFRGAAYSSSDDKYQKYSFSDIEDKNL-NVQTKGGWVAMLQQYFA 256

Query: 261 SVFIP--SKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTI 318
           + +IP  S   +F+S    L +G A     + A  +++ P      +  L+ G +     
Sbjct: 257 TAWIPHDSGVNTFYS--ANLGNGQAA--IGYKAPSVSVAPNTEKVLSTTLWVGPE----- 307

Query: 319 HHYEKDLAI--PRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFF 376
              + D+A   P  ++ +D+GW +FI++P+F L+   ++ VGN+G AI++ T  V+ + +
Sbjct: 308 --LQSDMAAVAPHLDLTVDYGWLWFISQPLFKLLQLIHSFVGNWGFAIIIITFIVRGIMY 365

Query: 377 PLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQ 436
           PL K QY S A M+ +QPK+  +RE+      Q + + M+ LYKT  +NPL GC+P+L+Q
Sbjct: 366 PLTKAQYTSMAKMRMLQPKLQAMRERIGDD-KQRMSQEMMALYKTEKVNPLGGCFPLLIQ 424

Query: 437 IPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPII 496
           +P+F A+Y ++  S+E+R APF  WI DLAA D           PFY        I PI+
Sbjct: 425 MPIFLALYYMLMGSVELRQAPFALWIHDLAAPD-----------PFY--------ILPIL 465

Query: 497 MSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAV 555
           M ++MF   KMSP    D  Q  I+ +MPV+F      FP+GL++Y+  SN+++I+QQ +
Sbjct: 466 MGVTMFFIQKMSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQL 525

Query: 556 IMK 558
           I +
Sbjct: 526 IYR 528


>gi|302880138|ref|YP_003848702.1| membrane protein insertase, YidC/Oxa1 family domain containing
           [Gallionella capsiferriformans ES-2]
 gi|302582927|gb|ADL56938.1| membrane protein insertase, YidC/Oxa1 family domain containing
           [Gallionella capsiferriformans ES-2]
          Length = 541

 Score =  221 bits (564), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 162/555 (29%), Positives = 270/555 (48%), Gaps = 46/555 (8%)

Query: 8   FVAIALSVIIVY-AWQNFYVYPRIEEMNNERKNIQ-TVKQPNQVDNSYAAVLIDDRAQAL 65
           F+  + S+++V+  WQ +   P +++    + ++     +P  +    A +    + +  
Sbjct: 9   FLIFSFSLMMVWDGWQRYQNPPVVQQAATTKSDLPVATTKPTDLAAQAAIIQQAAKVETG 68

Query: 66  SMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELD 125
            +   +++K   L   IN  G     L+    HLD    +    L    +  + Y A+  
Sbjct: 69  KI---IKVKTDFLEAEINSVGGDIQRLDFIK-HLDGQDKTKQFVLFEKGSGTHNYIAQSG 124

Query: 126 YVSTANNIELPNSNTVWNL--ISGKILTPTTPIKLVFKNANNILFERTISLDEH-YLFKI 182
            + T     +PN  TV++    S ++      +KL    AN +   + ++  +  Y+  +
Sbjct: 125 LLGTG----MPNHTTVFSAEQDSYQLTGDKLEVKLAAVAANGMKVVKLLTFHKSSYVVDV 180

Query: 183 VDTVTNNSIDQIRFSPRGRIMRHK--PQTATNTFGVQEGFIAVLGDKSLVEQ-KYSDIEK 239
              + N +   I  S   +++R    P   +       G +AV  DK   ++  +SD+EK
Sbjct: 181 AYEIENTTAAPITTSAYFQLIRDSIDPAGGSKMVPTYTG-MAVYTDKEKFQKIAFSDVEK 239

Query: 240 SSISNFHES-NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILP 298
             I    E  N W+GI   Y+ + ++P  +TS    F    +G A Y A        I P
Sbjct: 240 GKIDYPKEGDNGWIGILQHYFVAAWLPKDKTS-REFFTRKLEGDA-YSAGVIVPVAAIAP 297

Query: 299 GKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVG 358
           G+    +  L+AG  +         D   P   + +D+GW   +A P+F  +++   +V 
Sbjct: 298 GQKAVVSMPLYAGPAQ------STLDSIAPGLGLTVDYGWLTVVATPIFWTLTFIQGMVQ 351

Query: 359 NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQL 418
           N+G+AI+L TV +KLLFFPL+   Y S A M+ + PK+++++ +      + L +AM+ L
Sbjct: 352 NWGVAIILLTVLIKLLFFPLSAASYRSMAKMRVVAPKLEKIKLQHADDREK-LNRAMMDL 410

Query: 419 YKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFG 478
           YKT  INPL GC P+L+QIPVF A+Y  I  S+EMR+APF+GWI DL+AAD         
Sbjct: 411 YKTEKINPLGGCLPVLIQIPVFIALYWSILASVEMRNAPFFGWITDLSAAD--------- 461

Query: 479 ILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGL 538
             PF+        + P++M  SMF+Q K++P P D  QA I+  MP+ F      FPAGL
Sbjct: 462 --PFF--------VLPVLMGASMFLQSKLNPVPPDPIQAKIMKIMPIAFSVVFFWFPAGL 511

Query: 539 IIYWSWSNVISIVQQ 553
           ++Y   +N +SI QQ
Sbjct: 512 VLYSIVNNALSIAQQ 526


>gi|254468017|ref|ZP_05081423.1| inner membrane protein, 60 kDa [beta proteobacterium KB13]
 gi|207086827|gb|EDZ64110.1| inner membrane protein, 60 kDa [beta proteobacterium KB13]
          Length = 535

 Score =  221 bits (564), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 160/554 (28%), Positives = 273/554 (49%), Gaps = 53/554 (9%)

Query: 8   FVAIALSVIIVY-AWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQALS 66
           FV  + S+++++ +WQ   +   +   N E  ++Q    P   D+S     I++ A  L+
Sbjct: 9   FVVFSFSLLLLWDSWQQKQLQTELAVNNAELSDLQ----PGDYDSSN----IENPAYQLA 60

Query: 67  MSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDY 126
              ++ +K       IN  G     L L  +  D  +   +  +L+       Y A+   
Sbjct: 61  DDQKIVVKTSLYEAEINTVGGDIRKLKLANFQND--NKDGLYEILNDEMNPLLYIAQSGL 118

Query: 127 VSTANNIELPNSNTVW--NLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVD 184
           +       LP    V+  + +  +       + ++F+N    + +  I  +++Y  K+V 
Sbjct: 119 IGK----NLPTHKDVFKSDQLQYESNDQEVSVPIIFENEEVKVVKTYIFSNDNYQIKLVT 174

Query: 185 TVTNNSIDQIRFSPRGRIMR-HKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSIS 243
           ++TN S   ++     +++  HK    +       G           +  + DI+     
Sbjct: 175 SITNKSDAALQPQIYYQLLHDHKSAEKSGMMPTFTGVSYFTEASKFKKMDFDDIDNQKPF 234

Query: 244 NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDG--HARYQAKFSANEITILPGKS 301
             + ++ W+GI  +Y+AS +I    +      K L+DG   A  +AK +  E     G S
Sbjct: 235 TQNANDGWIGIIQRYFASAWIIPGNSPRQFYTKRLTDGISSAGVRAKLAMVE----AGSS 290

Query: 302 ITTTNFLFAGAKEFPTIHHYEKDL--AIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGN 359
              ++ L++G +        +K L  A P  E  +D+GW  FIA P+F L+S    LV N
Sbjct: 291 AEVSSVLYSGPQ-------LKKQLIKAAPGMEYTVDYGWLTFIASPLFSLLSGIQKLVHN 343

Query: 360 FGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLY 419
           +G++I+L T+ +K+ F+PL+   Y S A +K + P++  ++EKF     Q +Q+AM++LY
Sbjct: 344 WGVSIILLTLVIKIFFYPLSASSYRSMAQLKEVAPRLQSMKEKFGDDK-QKMQQAMMELY 402

Query: 420 KTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGI 479
           KT  INPL GC PIL+QIPVF A+Y V+  ++E+R APF+GWI DL+  DP  I      
Sbjct: 403 KTEKINPLGGCLPILIQIPVFIALYWVLLGAVELRQAPFFGWITDLSVKDPLYIL----- 457

Query: 480 LPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLI 539
                         PI+M+ SMF+Q K++P P D  QA ++  MP++F      FPAGL+
Sbjct: 458 --------------PILMAASMFLQQKLNPKPTDPTQARLMMMMPIIFSIFFFFFPAGLV 503

Query: 540 IYWSWSNVISIVQQ 553
           +YW  +NV+S++QQ
Sbjct: 504 LYWFINNVLSMMQQ 517


>gi|192360367|ref|YP_001984274.1| inner membrane protein, 60 kDa [Cellvibrio japonicus Ueda107]
 gi|254772765|sp|B3PIU1|OXAA_CELJU RecName: Full=Inner membrane protein oxaA
 gi|190686532|gb|ACE84210.1| inner membrane protein, 60 kDa [Cellvibrio japonicus Ueda107]
          Length = 552

 Score =  221 bits (563), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 114/325 (35%), Positives = 181/325 (55%), Gaps = 27/325 (8%)

Query: 234 YSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANE 293
           + DI K +     +   W+ +   Y+ S +IP   +  + + + L D    Y   F+   
Sbjct: 246 FEDIAKQTFETSRQGG-WVAMVQHYFISAWIPDASSQVNYKLRKLGD-QDLYLLGFTTQP 303

Query: 294 ITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYF 353
           + + PG         +AG K+   +         P  ++ +D+GW ++IAKP+F  + + 
Sbjct: 304 VVVEPGSKGVIKASFYAGPKDTERLEEIS-----PYLDLTVDYGWLWWIAKPLFAFLKFI 358

Query: 354 YNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQK 413
           +  +GN+G+AI+  T+ VKLLFFPL+   Y S A M+ +QPK+ EL+E++ +   Q   +
Sbjct: 359 HGFLGNWGLAIIGLTLSVKLLFFPLSAASYRSMAKMRKLQPKLLELKERYGED-RQKFSQ 417

Query: 414 AMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNI 473
            M++LYKT  +NP  GC P+L+Q+PVF A+Y V+  S+E+RHAPF+GWI+DL+  DP  +
Sbjct: 418 EMMKLYKTEQVNPFGGCLPLLIQMPVFIALYWVLMESVELRHAPFFGWIEDLSRMDPYFV 477

Query: 474 FTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSS 533
                               PII   +M+I  K++P P D  QA I+N +P VF F    
Sbjct: 478 L-------------------PIIYGATMWIMQKLNPQPTDPMQARIMNMLPFVFTFMFLW 518

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMK 558
           FPAGL++YW  +N++SI QQ VI +
Sbjct: 519 FPAGLVLYWVTNNLLSIAQQYVITR 543


>gi|16272937|ref|NP_439163.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae Rd KW20]
 gi|260580091|ref|ZP_05847921.1| membrane protein insertase, YidC/Oxa1 family domain [Haemophilus
           influenzae RdAW]
 gi|1168226|sp|P44973|OXAA_HAEIN RecName: Full=Inner membrane protein oxaA
 gi|1574032|gb|AAC22663.1| inner membrane protein, 60 kDa (yidC) [Haemophilus influenzae Rd
           KW20]
 gi|260093375|gb|EEW77308.1| membrane protein insertase, YidC/Oxa1 family domain [Haemophilus
           influenzae RdAW]
          Length = 541

 Score =  221 bits (563), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 126/376 (33%), Positives = 212/376 (56%), Gaps = 31/376 (8%)

Query: 186 VTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYSDIEKSSISN 244
           + N S   I   P G++     +++ N       G      + +  +  +SD++ +++S 
Sbjct: 182 IDNQSGQAIEVEPYGQLKHSIVESSGNVAMPTYTGGAYSSSETNYKKYSFSDMQDNNLS- 240

Query: 245 FHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA-KFSANEITILPGKSIT 303
                 W+ +   Y+ S +IP+++   ++Q   ++D      +  +  + +TI  G   T
Sbjct: 241 IDTKAGWVAVLQHYFVSAWIPNQDV--NNQLYTITDSKNNVASIGYRGSVVTIPAGSQET 298

Query: 304 TTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIA 363
            T+ L+ G    P + +    +A    ++ +D+GW +FIAKP+F L+++   +V N+G+A
Sbjct: 299 ITSSLWTG----PKLQNQMATVA-NNLDLTVDYGWAWFIAKPLFWLLTFIQGIVSNWGLA 353

Query: 364 IMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHN 423
           I+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++LYK   
Sbjct: 354 IICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGDD-RQRMSQEMMKLYKEEK 412

Query: 424 INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY 483
           +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A D           P+Y
Sbjct: 413 VNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQD-----------PYY 461

Query: 484 LPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPAGLIIYW 542
                   I PI+M +SMF+  KMSP P  D  Q  ++N+MP+VF+F    FP+GL++YW
Sbjct: 462 --------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLVFMFFFLWFPSGLVLYW 513

Query: 543 SWSNVISIVQQAVIMK 558
             SN+I+I QQ +I +
Sbjct: 514 LVSNLITIAQQQLIYR 529


>gi|240949810|ref|ZP_04754139.1| putative inner membrane protein translocase component YidC
           [Actinobacillus minor NM305]
 gi|240295727|gb|EER46422.1| putative inner membrane protein translocase component YidC
           [Actinobacillus minor NM305]
          Length = 554

 Score =  221 bits (563), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 154/519 (29%), Positives = 260/519 (50%), Gaps = 57/519 (10%)

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
           A++ S    + +++  L  +++  G    D +L  +H ++ SN+P   L    N+K  Y 
Sbjct: 59  AESNSKGKTITIESDVLRLTVDTLGGDVIDSDLLKHHAELHSNTPFELL--QDNSKVLYV 116

Query: 122 AELDYVSTANNIELPNSNTVWNLISG--KILTPTTPIK--LVFKNANNILFERTISLDEH 177
           A+   +   N I+  N    +   +   K+      I   L F+  + +++ +T +L   
Sbjct: 117 AQSGLIG-KNGIDTNNGRAQYQTTADSFKLAEGQNEISVPLTFEK-DGVVYTKTFTLKRG 174

Query: 178 YLFKIVD-TVTNNSIDQIRFSPRGRIMRHK----------PQTATNTFGVQEGFIAVLGD 226
                VD  + NNS + +   P G+ ++H           P      +   E        
Sbjct: 175 SYNVGVDFNIKNNSAEVVEVQPYGQ-LKHTLVESSGSLTMPTYTGGAYSSSETNYKKYSF 233

Query: 227 KSLVEQKYSDIEKSSISNFH---ESNS-WLGISDKYWASVFIPSKETSFHSQFKYLSDGH 282
           + + ++K    E+  I+N     ESN+ W+ I   Y+ S ++P ++       +   +G 
Sbjct: 234 QEMADEKKRKAEQG-IANGGLSIESNTGWVAILQHYFVSAWVPQQDKPMTIYTRVSDNGV 292

Query: 283 ARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLA--IPRFEMLIDWGWFY 340
           A     +     ++ P    T +  L+ G K+       +K++A      ++  D+GW +
Sbjct: 293 ATI--GYRGALTSVAPNSDATISTHLWTGPKD-------QKEMAETAAHLDLTADYGWAW 343

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           FIAKP+F L++    LV N+G+AI+  T+ VK L +PL K QY S A M+ +QP+I E+R
Sbjct: 344 FIAKPLFWLLTQIQKLVVNWGLAIICVTIVVKTLLYPLTKAQYTSMAKMRMLQPRIQEMR 403

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E+F     Q + + M++LYK   +NP+ GC PIL+Q+P+F A+Y     ++E+RHAPF+G
Sbjct: 404 ERFGDD-RQRMSQEMMKLYKEEKVNPMGGCLPILIQMPIFIALYWTFMEAVELRHAPFFG 462

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMI 519
           WI+DL+A D           P+Y        I P++M  SMF+  KMSP P AD  Q  +
Sbjct: 463 WIQDLSAQD-----------PYY--------ILPLLMGGSMFLLQKMSPTPIADPVQQKV 503

Query: 520 LNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           + +MPV+F      FP+GL++YW  SN I+IVQQ +I +
Sbjct: 504 MTFMPVMFTVFFLWFPSGLVLYWLTSNCITIVQQWLIYR 542


>gi|33575018|emb|CAE39684.1| probable inner-membrane protein [Bordetella parapertussis]
          Length = 554

 Score =  221 bits (562), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 151/482 (31%), Positives = 242/482 (50%), Gaps = 42/482 (8%)

Query: 86  GAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLI 145
           GAQ     L  Y     S+ P  T+L   +    Y A+   V        P   T ++L+
Sbjct: 94  GAQLIRAELLKYPSSSQSDKP--TVLMDRSADLVYVAQTGVVGAPQGESFPTHQTPFHLV 151

Query: 146 SGKILTPTTPIKLVFK-NANNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFSPRGRIM 203
           S +       + +VF+  +  +   +T +L    Y   +   + N        SP   + 
Sbjct: 152 SSERSLTGDTLDVVFEAESGGLKVTKTYTLHRGRYDVDVRHAMANTG--GAPLSPALYLQ 209

Query: 204 RHKPQT---ATNTFGVQEGFIAVLGDKSLVEQ-KYSDIEKSSISNFHES-NSWLGISDKY 258
             +  T    T++F      +AV  ++   ++  +SDIEK   +   ++ N W+GI   Y
Sbjct: 210 LERDGTDPAGTSSFYHTFTGVAVYSEQDKFQKVTFSDIEKKKGTYIKQADNGWIGIVQHY 269

Query: 259 WASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTI 318
           +A+ +IP++     ++   L      Y A+      TI PG S      L+ G ++    
Sbjct: 270 FATAWIPAQGKQRTNEL--LQVQQNLYAARTIEAVGTIAPGSSANVDAHLWVGPQD---- 323

Query: 319 HHYEKDLAI--PRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFF 376
              +K +A   P  E+++D+GW   IAKP+F LM++ + L+GN+G  I+  TV +K +FF
Sbjct: 324 ---QKAMAAVAPGLELVVDYGWLTIIAKPLFTLMTWLHGLLGNWGWTIVALTVIIKAVFF 380

Query: 377 PLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQ 436
           PLA   Y S A MK + P++  L+EK+     Q L +AM+++Y+T  INPL GC P+++Q
Sbjct: 381 PLAAASYRSMARMKQVAPRLQALKEKYGDD-RQKLNQAMMEMYRTEKINPLGGCLPMVVQ 439

Query: 437 IPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPII 496
           IPVF A+Y V+  S+EMR AP+  W+ DL+  D           PF+        I P I
Sbjct: 440 IPVFIALYWVLLASVEMRGAPWILWVHDLSVRD-----------PFF--------ILPAI 480

Query: 497 MSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVI 556
           M  +MF+Q+K++P P D  QA ++  MP+VF   +  FPAGL++YW  +N +SI QQ  I
Sbjct: 481 MMATMFLQIKLNPTPPDPVQAKVMMIMPLVFGGMMFFFPAGLVLYWCVNNTLSIAQQWTI 540

Query: 557 MK 558
            +
Sbjct: 541 TR 542


>gi|33568943|emb|CAE35357.1| probable inner-membrane protein [Bordetella bronchiseptica RB50]
          Length = 554

 Score =  221 bits (562), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 150/480 (31%), Positives = 243/480 (50%), Gaps = 38/480 (7%)

Query: 86  GAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLI 145
           GAQ     L  Y     S+ P  T+L   +    Y A+   V        P   T ++L+
Sbjct: 94  GAQLIRAELLKYPSSSQSDKP--TVLMDRSADLVYVAQTGVVGAPQGESFPTHQTPFHLV 151

Query: 146 SGKILTPTTPIKLVFK-NANNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFSPRGRIM 203
           S +       + +VF+  +  +   +T +L    Y   +   + N     +  +   ++ 
Sbjct: 152 SSERSLTGDTLDVVFEAESGGLKVTKTYTLHRGRYDVDVRHAMANTGGAPLNPALYLQLE 211

Query: 204 RHKPQTA-TNTFGVQEGFIAVLGDKSLVEQ-KYSDIEKSSISNFHES-NSWLGISDKYWA 260
           R     A T++F      +AV  ++   ++  +SDIEK   +   ++ N W+GI   Y+A
Sbjct: 212 RDGTDPAGTSSFYHTFTGVAVYSEQDKFQKVTFSDIEKKKGTYIKQADNGWIGIVQHYFA 271

Query: 261 SVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHH 320
           + +IP++     ++   L      Y A+      TI PG S      L+ G ++      
Sbjct: 272 TAWIPAQGKQRTNEL--LQVQQNLYAARTIEAVGTIAPGSSANVDAHLWVGPQD------ 323

Query: 321 YEKDLAI--PRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPL 378
            +K +A   P  E+++D+GW   IAKP+F LM++ + L+GN+G  I+  TV +K +FFPL
Sbjct: 324 -QKAMAAVAPGLELVVDYGWLTIIAKPLFTLMTWLHGLLGNWGWTIVALTVIIKAVFFPL 382

Query: 379 AKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIP 438
           A   Y S A MK + P++  L+EK+     Q L +AM+++Y+T  INPL GC P+++QIP
Sbjct: 383 AAASYRSMARMKQVAPRLQALKEKYGDD-RQKLNQAMMEMYRTEKINPLGGCLPMVVQIP 441

Query: 439 VFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMS 498
           VF A+Y V+  S+EMR AP+  W+ DL+  D           PF+        I P IM 
Sbjct: 442 VFIALYWVLLASVEMRGAPWILWVHDLSVRD-----------PFF--------ILPAIMM 482

Query: 499 LSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
            +MF+Q+K++P P D  QA ++  MP+VF   +  FPAGL++YW  +N +SI QQ  I +
Sbjct: 483 ATMFLQIKLNPTPPDPVQAKVMMIMPLVFGGMMFFFPAGLVLYWCVNNTLSIAQQWTITR 542


>gi|161610372|ref|NP_886531.2| putative inner membrane protein translocase component YidC
           [Bordetella parapertussis 12822]
 gi|38502926|sp|Q7W2K1|OXAA_BORPA RecName: Full=Inner membrane protein oxaA
          Length = 563

 Score =  221 bits (562), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 151/482 (31%), Positives = 242/482 (50%), Gaps = 42/482 (8%)

Query: 86  GAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLI 145
           GAQ     L  Y     S+ P  T+L   +    Y A+   V        P   T ++L+
Sbjct: 103 GAQLIRAELLKYPSSSQSDKP--TVLMDRSADLVYVAQTGVVGAPQGESFPTHQTPFHLV 160

Query: 146 SGKILTPTTPIKLVFK-NANNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFSPRGRIM 203
           S +       + +VF+  +  +   +T +L    Y   +   + N        SP   + 
Sbjct: 161 SSERSLTGDTLDVVFEAESGGLKVTKTYTLHRGRYDVDVRHAMANTG--GAPLSPALYLQ 218

Query: 204 RHKPQT---ATNTFGVQEGFIAVLGDKSLVEQ-KYSDIEKSSISNFHES-NSWLGISDKY 258
             +  T    T++F      +AV  ++   ++  +SDIEK   +   ++ N W+GI   Y
Sbjct: 219 LERDGTDPAGTSSFYHTFTGVAVYSEQDKFQKVTFSDIEKKKGTYIKQADNGWIGIVQHY 278

Query: 259 WASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTI 318
           +A+ +IP++     ++   L      Y A+      TI PG S      L+ G ++    
Sbjct: 279 FATAWIPAQGKQRTNEL--LQVQQNLYAARTIEAVGTIAPGSSANVDAHLWVGPQD---- 332

Query: 319 HHYEKDLAI--PRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFF 376
              +K +A   P  E+++D+GW   IAKP+F LM++ + L+GN+G  I+  TV +K +FF
Sbjct: 333 ---QKAMAAVAPGLELVVDYGWLTIIAKPLFTLMTWLHGLLGNWGWTIVALTVIIKAVFF 389

Query: 377 PLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQ 436
           PLA   Y S A MK + P++  L+EK+     Q L +AM+++Y+T  INPL GC P+++Q
Sbjct: 390 PLAAASYRSMARMKQVAPRLQALKEKYGDD-RQKLNQAMMEMYRTEKINPLGGCLPMVVQ 448

Query: 437 IPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPII 496
           IPVF A+Y V+  S+EMR AP+  W+ DL+  D           PF+        I P I
Sbjct: 449 IPVFIALYWVLLASVEMRGAPWILWVHDLSVRD-----------PFF--------ILPAI 489

Query: 497 MSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVI 556
           M  +MF+Q+K++P P D  QA ++  MP+VF   +  FPAGL++YW  +N +SI QQ  I
Sbjct: 490 MMATMFLQIKLNPTPPDPVQAKVMMIMPLVFGGMMFFFPAGLVLYWCVNNTLSIAQQWTI 549

Query: 557 MK 558
            +
Sbjct: 550 TR 551


>gi|33591704|ref|NP_879348.1| putative inner membrane protein translocase component YidC
           [Bordetella pertussis Tohama I]
 gi|161609254|ref|NP_891527.2| putative inner membrane protein translocase component YidC
           [Bordetella bronchiseptica RB50]
 gi|54038802|sp|P65623|OXAA_BORBR RecName: Full=Inner membrane protein oxaA
 gi|54041691|sp|P65622|OXAA_BORPE RecName: Full=Inner membrane protein oxaA
 gi|33571347|emb|CAE44824.1| probable inner-membrane protein [Bordetella pertussis Tohama I]
 gi|332381123|gb|AEE65970.1| putative inner membrane protein translocase component YidC
           [Bordetella pertussis CS]
          Length = 563

 Score =  221 bits (562), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 150/480 (31%), Positives = 243/480 (50%), Gaps = 38/480 (7%)

Query: 86  GAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLI 145
           GAQ     L  Y     S+ P  T+L   +    Y A+   V        P   T ++L+
Sbjct: 103 GAQLIRAELLKYPSSSQSDKP--TVLMDRSADLVYVAQTGVVGAPQGESFPTHQTPFHLV 160

Query: 146 SGKILTPTTPIKLVFK-NANNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFSPRGRIM 203
           S +       + +VF+  +  +   +T +L    Y   +   + N     +  +   ++ 
Sbjct: 161 SSERSLTGDTLDVVFEAESGGLKVTKTYTLHRGRYDVDVRHAMANTGGAPLNPALYLQLE 220

Query: 204 RHKPQTA-TNTFGVQEGFIAVLGDKSLVEQ-KYSDIEKSSISNFHES-NSWLGISDKYWA 260
           R     A T++F      +AV  ++   ++  +SDIEK   +   ++ N W+GI   Y+A
Sbjct: 221 RDGTDPAGTSSFYHTFTGVAVYSEQDKFQKVTFSDIEKKKGTYIKQADNGWIGIVQHYFA 280

Query: 261 SVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHH 320
           + +IP++     ++   L      Y A+      TI PG S      L+ G ++      
Sbjct: 281 TAWIPAQGKQRTNEL--LQVQQNLYAARTIEAVGTIAPGSSANVDAHLWVGPQD------ 332

Query: 321 YEKDLAI--PRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPL 378
            +K +A   P  E+++D+GW   IAKP+F LM++ + L+GN+G  I+  TV +K +FFPL
Sbjct: 333 -QKAMAAVAPGLELVVDYGWLTIIAKPLFTLMTWLHGLLGNWGWTIVALTVIIKAVFFPL 391

Query: 379 AKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIP 438
           A   Y S A MK + P++  L+EK+     Q L +AM+++Y+T  INPL GC P+++QIP
Sbjct: 392 AAASYRSMARMKQVAPRLQALKEKYGDD-RQKLNQAMMEMYRTEKINPLGGCLPMVVQIP 450

Query: 439 VFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMS 498
           VF A+Y V+  S+EMR AP+  W+ DL+  D           PF+        I P IM 
Sbjct: 451 VFIALYWVLLASVEMRGAPWILWVHDLSVRD-----------PFF--------ILPAIMM 491

Query: 499 LSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
            +MF+Q+K++P P D  QA ++  MP+VF   +  FPAGL++YW  +N +SI QQ  I +
Sbjct: 492 ATMFLQIKLNPTPPDPVQAKVMMIMPLVFGGMMFFFPAGLVLYWCVNNTLSIAQQWTITR 551


>gi|269103816|ref|ZP_06156513.1| OxaI/YidC membrane insertion protein [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268163714|gb|EEZ42210.1| OxaI/YidC membrane insertion protein [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 540

 Score =  220 bits (561), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 163/563 (28%), Positives = 285/563 (50%), Gaps = 60/563 (10%)

Query: 15  VIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNS-------YAAVLIDDRAQALSM 67
           ++I   + +F ++ +     N +   Q V Q  QV+NS           L+ D++ + ++
Sbjct: 8   LLIALLFVSFLLFQQWNSDKNPQPQSQGVAQ--QVNNSGDVPSHSADGQLVTDQSSSQNL 65

Query: 68  SPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYV 127
              + +K   L  +++  G    D  L  Y+  + S  P V L   +N +++Y A+   +
Sbjct: 66  ---ITIKTDVLALTVDTLGGDVVDAKLLKYNNTLGSKDPFVLL--ENNPEHSYVAQSGLI 120

Query: 128 STANNIELPNSNTVWNLISGK--ILTPTTP---IKLVFKNANNILFERTISLDEH-YLFK 181
              N I+  N+      +SGK   L P      + + ++  + I + +T  L  + Y   
Sbjct: 121 G-QNGIDT-NAGRAQFTVSGKDFTLAPDQKELRVPMTYEK-DGIKYTKTFVLKPNSYAVN 177

Query: 182 IVDTVTNNSID----QIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           +  T+ N S      Q+    R  ++  K      T+  Q G  + + D +  +  + D+
Sbjct: 178 VDYTIDNQSAAPTSVQMYAQLRHSLVASKSSLTMPTY--QGGAYSSV-DTNYKKYSFDDM 234

Query: 238 EKSSISNFHESNSWLGISDKYWASVFIP-SKETSFHSQFKYLSDGHARYQAKFSANEITI 296
           +  ++ N    + W+ +   Y+ S +IP     S ++ +   SDG+     +  A  +T+
Sbjct: 235 KDKNL-NVTTPDGWVAVLQHYFVSAWIPRDGNESLNNLYSRSSDGNGYIGVRMPA--VTV 291

Query: 297 LPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNL 356
            PG + T    L+ G K    +    K+L      + +D+GW +FIA P+  L+S+ +++
Sbjct: 292 APGATDTLKATLWVGPKLQNEMAATAKNL-----NLTVDYGWLWFIASPLHKLLSFIHSI 346

Query: 357 VGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMI 416
           VGN+G+AIM+ T  V+   +PL K QY S A M+ +QPK+  +RE+F     Q L + M+
Sbjct: 347 VGNWGVAIMVLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLQAMRERFGDD-RQRLSQEMM 405

Query: 417 QLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTL 476
           +LY+   +NPL GC PIL+Q+P+F A+Y  +  S+E+RHAPF+GWI DL+A D       
Sbjct: 406 ELYRKEKVNPLGGCLPILVQMPIFIALYWALMESVELRHAPFFGWIHDLSAQD------- 458

Query: 477 FGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFP 535
               P+Y        I PI+M ++MF+  KMSP    D  Q  I+ +MPV+F F    FP
Sbjct: 459 ----PYY--------ILPILMGITMFMIQKMSPSTITDPMQQKIMTFMPVMFTFFFLWFP 506

Query: 536 AGLIIYWSWSNVISIVQQAVIMK 558
           +GL++YW  SN+++++QQ +I +
Sbjct: 507 SGLVLYWLVSNIVTLIQQTLIYR 529


>gi|269140892|ref|YP_003297593.1| 60 kDa inner membrane insertion protein [Edwardsiella tarda EIB202]
 gi|267986553|gb|ACY86382.1| 60 kDa inner membrane insertion protein [Edwardsiella tarda EIB202]
 gi|304560650|gb|ADM43314.1| OxaI/YidC membrane insertion protein [Edwardsiella tarda FL6-60]
          Length = 541

 Score =  220 bits (561), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 154/541 (28%), Positives = 265/541 (48%), Gaps = 59/541 (10%)

Query: 41  QTVKQPNQVDNSYAAVLIDDRAQALSMSPRVEL---KNPSLIGSINLKGAQFDDLNLRGY 97
           QT   P  V  +    + D  +QA+  S + +L   K   L  +IN +G   +  +L  Y
Sbjct: 24  QTDNNPQPVAQTAGQSVSDTASQAVPESGQGKLITVKTDVLALTINTRGGDIEQADLLAY 83

Query: 98  HLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNS--------NTVWNLISGKI 149
              + SN+P   L   +  +  Y A+      +      N          T + ++ G+ 
Sbjct: 84  PATLGSNTPFQLL--ETTPQFVYQAQSGLTGKSGPDNPANGARPLYSANQTSYEMLPGQ- 140

Query: 150 LTPTTPIKLVFKNANNILFERTISLDEH-YLFKIVDTVTNNSIDQIRFSPRGRIM----- 203
                 I L +  AN +++ +T  L  + Y   +   V N+S D +  +  G++      
Sbjct: 141 --DELRIPLTYTAANGVIYTKTFVLKRNDYAIAVDYKVKNDSHDALDLTLFGQLKQSVDL 198

Query: 204 -RHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS--DIEKSSISNFHESNSWLGISDKYWA 260
            +H+  T +N F +     A         QKYS  DIE  ++ N      W+ +  +Y+A
Sbjct: 199 PKHR-DTGSNNFALHTFRGAAYSSSDDKYQKYSFSDIEDKNL-NVQTKGGWVAMLQQYFA 256

Query: 261 SVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHH 320
           + +IP    S  + F   + G+ +    + A  +++ P      +  L+ G +       
Sbjct: 257 TAWIP--HDSGVNTFYTANLGNGQAAIGYKAPSVSVAPNTEKVLSTTLWVGPE------- 307

Query: 321 YEKDLAI--PRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPL 378
            + D+A   P  ++ +D+GW +FI++P+F L+   ++ VGN+G AI++ T  V+ + +PL
Sbjct: 308 LQSDMAAVAPHLDLTVDYGWLWFISQPLFKLLQLIHSFVGNWGFAIIIITFIVRGIMYPL 367

Query: 379 AKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIP 438
            K QY S A M+ +QPK+  +RE+      Q + + M+ LYK+  +NPL GC+P+L+Q+P
Sbjct: 368 TKAQYTSMAKMRMLQPKLQAMRERIGDD-KQRMSQEMMALYKSEKVNPLGGCFPLLIQMP 426

Query: 439 VFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMS 498
           +F A+Y ++  S+E+R APF  WI DLAA D           P+Y        I PI+M 
Sbjct: 427 IFLALYYMLMGSVELRQAPFALWIHDLAAPD-----------PYY--------ILPILMG 467

Query: 499 LSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIM 557
           ++MF   KMSP    D  Q  I+ +MPV+F      FP+GL++Y+  SN+++I+QQ +I 
Sbjct: 468 VTMFFIQKMSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIY 527

Query: 558 K 558
           +
Sbjct: 528 R 528


>gi|309973500|gb|ADO96701.1| Inner membrane translocation protein YidC [Haemophilus influenzae
           R2846]
          Length = 541

 Score =  220 bits (561), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 126/376 (33%), Positives = 211/376 (56%), Gaps = 31/376 (8%)

Query: 186 VTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYSDIEKSSISN 244
           + N S   I   P G++     +++ N       G      D +  +  ++D++ +++S 
Sbjct: 182 IDNQSGQAIEVEPYGQLKHSIVESSGNVAMPTYTGGAYSSSDTNYKKYSFADMQDNNLS- 240

Query: 245 FHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA-KFSANEITILPGKSIT 303
                 W+ +   Y+ S +IP+++   ++Q   ++D      +  +    +TI  G   T
Sbjct: 241 IDTKAGWVAVLQHYFVSAWIPNQDV--NNQLYTITDSKNNVASIGYRGPVVTIPSGSQET 298

Query: 304 TTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIA 363
            T+ L+ G    P + +    +A    ++ +D+GW +FIAKP+F L+++   +V N+G+A
Sbjct: 299 ITSSLWTG----PKLQNQMATVA-NNLDLTVDYGWAWFIAKPLFWLLTFIQGIVSNWGLA 353

Query: 364 IMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHN 423
           I+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++LYK   
Sbjct: 354 IICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGDD-RQRMSQEMMKLYKEEK 412

Query: 424 INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY 483
           +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A D           P+Y
Sbjct: 413 VNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQD-----------PYY 461

Query: 484 LPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPAGLIIYW 542
                   I PI+M +SMF+  KMSP P  D  Q  ++N+MP+VF+F    FP+GL++YW
Sbjct: 462 --------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLVFMFFFLWFPSGLVLYW 513

Query: 543 SWSNVISIVQQAVIMK 558
             SN+I+I QQ +I +
Sbjct: 514 LVSNLITIAQQQLIYR 529


>gi|253997709|ref|YP_003049773.1| 60 kDa inner membrane insertion protein [Methylotenera mobilis
           JLW8]
 gi|253984388|gb|ACT49246.1| 60 kDa inner membrane insertion protein [Methylotenera mobilis
           JLW8]
          Length = 554

 Score =  220 bits (560), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 132/343 (38%), Positives = 191/343 (55%), Gaps = 54/343 (15%)

Query: 234 YSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR--YQAKFSA 291
           + D+ K  + N   ++ W+GI   Y+ S +IP              DG AR  Y  K S+
Sbjct: 237 FKDMAKEPL-NITTNDGWVGILQHYFVSAWIPK-------------DGLARKFYTEKLSS 282

Query: 292 NEI---------TILPGKSITTTNFLFAGAKEFPTIHHYEKDL--AIPRFEMLIDWGWFY 340
           N           TI PG ++T    L++G +        + DL  A P  E  +D+GW  
Sbjct: 283 NIFRIGTKSTLSTIQPGATLTVPARLYSGPQT-------KNDLIAAAPGLEYSVDYGWLT 335

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
            IA P+F L+S  ++LV N+G+AI+L T+ +K  FF L+   Y S A M+ + P++  ++
Sbjct: 336 VIASPLFWLLSKIHSLVQNWGVAIILLTILIKAAFFKLSASGYRSMAQMRELAPRLQSMK 395

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           EKF     Q +Q AM+ LYK   INP+ GC+PIL+Q+PVF A+Y V+  S+E+RHAPF+G
Sbjct: 396 EKFGDDR-QKMQMAMMDLYKKEKINPMGGCFPILIQVPVFIALYWVLLGSIELRHAPFFG 454

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMIL 520
           WI+DL+A D           PFY        + PI+M  +M +Q K++P P D  QA ++
Sbjct: 455 WIQDLSAID-----------PFY--------VLPILMGATMIVQTKLNPKPTDPMQAKVM 495

Query: 521 NWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
            WMPVVF      FPAGL++YW  +NV+SI QQ  + KM  AE
Sbjct: 496 TWMPVVFSVFFFFFPAGLVLYWLVNNVLSIAQQWYVNKMIHAE 538


>gi|229846058|ref|ZP_04466170.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae 7P49H1]
 gi|229811062|gb|EEP46779.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae 7P49H1]
          Length = 541

 Score =  220 bits (560), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 126/376 (33%), Positives = 211/376 (56%), Gaps = 31/376 (8%)

Query: 186 VTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYSDIEKSSISN 244
           + N S   I   P G++     +++ N       G      D +  +  ++D++ +++S 
Sbjct: 182 IDNQSGQAIEVEPYGQLKHSIIESSGNVAMPTYTGGAYSSSDTNYKKYSFADMQDNNLS- 240

Query: 245 FHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA-KFSANEITILPGKSIT 303
                 W+ +   Y+ S +IP+++   ++Q   ++D      +  +    +TI  G   T
Sbjct: 241 IDTKAGWVAVLQHYFVSAWIPNQDV--NNQLYTITDSKNNVASIGYRGPVVTIPAGSQET 298

Query: 304 TTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIA 363
            T+ L+ G    P + +    +A    ++ +D+GW +FIAKP+F L+++   +V N+G+A
Sbjct: 299 ITSSLWTG----PKLQNQMATVA-NNLDLTVDYGWAWFIAKPLFWLLTFIQGIVSNWGLA 353

Query: 364 IMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHN 423
           I+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++LYK   
Sbjct: 354 IICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGDD-RQRMSQEMMKLYKEEK 412

Query: 424 INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY 483
           +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A D           P+Y
Sbjct: 413 VNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQD-----------PYY 461

Query: 484 LPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPAGLIIYW 542
                   I PI+M +SMF+  KMSP P  D  Q  ++N+MP+VF+F    FP+GL++YW
Sbjct: 462 --------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLVFMFFFLWFPSGLVLYW 513

Query: 543 SWSNVISIVQQAVIMK 558
             SN+I+I QQ +I +
Sbjct: 514 LVSNLITIAQQQLIYR 529


>gi|329123023|ref|ZP_08251594.1| YidC/Oxa1 family membrane protein insertase [Haemophilus aegyptius
           ATCC 11116]
 gi|327471954|gb|EGF17394.1| YidC/Oxa1 family membrane protein insertase [Haemophilus aegyptius
           ATCC 11116]
          Length = 541

 Score =  220 bits (560), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 120/327 (36%), Positives = 195/327 (59%), Gaps = 30/327 (9%)

Query: 234 YSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA-KFSAN 292
           +SD++ +++S       W+ +   Y+ S +IP+++   ++Q   ++D      +  +   
Sbjct: 231 FSDMQDNNLS-IDTKAGWVAVLQHYFVSAWIPNQDV--NNQLYTITDSKNNVASIGYRGP 287

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
            +TI  G   T T+ L+ G    P + +    +A    ++ +D+GW +FIAKP+F L+++
Sbjct: 288 VVTIPAGSQETITSSLWIG----PKLQNQMATVA-NNLDLTVDYGWAWFIAKPLFWLLTF 342

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
              +V N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + 
Sbjct: 343 IQGIVSNWGLAIICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGDD-RQRMS 401

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           + M++LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A D   
Sbjct: 402 QEMMKLYKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQD--- 458

Query: 473 IFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFAL 531
                   P+Y        I PI+M +SMF+  KMSP P  D  Q  ++N+MP+VF+F  
Sbjct: 459 --------PYY--------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLVFMFFF 502

Query: 532 SSFPAGLIIYWSWSNVISIVQQAVIMK 558
             FPAGL++YW  SN+I+I QQ +I +
Sbjct: 503 LWFPAGLVLYWLVSNLITIAQQQLIYR 529


>gi|319897488|ref|YP_004135685.1| inner membrane protein oxaa [Haemophilus influenzae F3031]
 gi|317432994|emb|CBY81365.1| Inner membrane protein oxaA [Haemophilus influenzae F3031]
          Length = 541

 Score =  220 bits (560), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 126/376 (33%), Positives = 211/376 (56%), Gaps = 31/376 (8%)

Query: 186 VTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYSDIEKSSISN 244
           + N S   I   P G++     +++ N       G      + +  +  +SD++ +++S 
Sbjct: 182 IDNQSGQAIEVEPYGQLKHSIVESSGNVAMPTYTGGAYSSSETNYKKYSFSDMQDNNLS- 240

Query: 245 FHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA-KFSANEITILPGKSIT 303
                 W+ +   Y+ S +IP+++   ++Q   ++D      +  +    +TI  G   T
Sbjct: 241 IDTKAGWVAVLQHYFVSAWIPNQDV--NNQLYTITDSKNNVASIGYRGPVVTIPAGSQET 298

Query: 304 TTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIA 363
            T+ L+ G    P + +    +A    ++ +D+GW +FIAKP+F L+++   +V N+G+A
Sbjct: 299 ITSSLWTG----PKLQNQMATVA-NNLDLTVDYGWAWFIAKPLFWLLTFIQGIVSNWGLA 353

Query: 364 IMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHN 423
           I+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++LYK   
Sbjct: 354 IICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGDD-RQRMSQEMMKLYKEEK 412

Query: 424 INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY 483
           +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A D           P+Y
Sbjct: 413 VNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQD-----------PYY 461

Query: 484 LPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPAGLIIYW 542
                   I PI+M +SMF+  KMSP P  D  Q  ++N+MP+VF+F    FP+GL++YW
Sbjct: 462 --------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLVFMFFFLWFPSGLVLYW 513

Query: 543 SWSNVISIVQQAVIMK 558
             SN+I+I QQ +I +
Sbjct: 514 LVSNLITIAQQQLIYR 529


>gi|145637306|ref|ZP_01792967.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae PittHH]
 gi|145269558|gb|EDK09500.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae PittHH]
          Length = 541

 Score =  220 bits (560), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 126/376 (33%), Positives = 210/376 (55%), Gaps = 31/376 (8%)

Query: 186 VTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYSDIEKSSISN 244
           + N S   I   P G++     + + N       G      D +  +  ++D++ +++S 
Sbjct: 182 IDNQSGQAIEVEPYGQLKHSIVENSGNVAMPTYTGGAYSSSDTNYKKYSFADMQDNNLS- 240

Query: 245 FHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA-KFSANEITILPGKSIT 303
                 W+ +   Y+ S +IP+++   ++Q   ++D      +  +    +TI  G   T
Sbjct: 241 IDTKAGWVAVLQHYFVSAWIPNQDV--NNQLYTITDSKNNVASIGYRGPVVTIPSGSQET 298

Query: 304 TTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIA 363
            T+ L+ G    P + +    +A    ++ +D+GW +FIAKP+F L+++   +V N+G+A
Sbjct: 299 ITSSLWTG----PKLQNQMATVA-NNLDLTVDYGWAWFIAKPLFWLLTFIQGIVSNWGLA 353

Query: 364 IMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHN 423
           I+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++LYK   
Sbjct: 354 IICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGDD-RQRMSQEMMKLYKEEK 412

Query: 424 INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY 483
           +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A D           P+Y
Sbjct: 413 VNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQD-----------PYY 461

Query: 484 LPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPAGLIIYW 542
                   I PI+M +SMF+  KMSP P  D  Q  ++N+MP+VF+F    FP+GL++YW
Sbjct: 462 --------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLVFMFFFLWFPSGLVLYW 513

Query: 543 SWSNVISIVQQAVIMK 558
             SN+I+I QQ +I +
Sbjct: 514 LVSNLITIAQQQLIYR 529


>gi|126208888|ref|YP_001054113.1| putative inner membrane protein translocase component YidC
           [Actinobacillus pleuropneumoniae L20]
 gi|126097680|gb|ABN74508.1| inner membrane protein OxaA [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
          Length = 493

 Score =  220 bits (560), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 128/399 (32%), Positives = 218/399 (54%), Gaps = 34/399 (8%)

Query: 164 NNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIA 222
           + +L+ +T  L    Y   +   V N +   +   P G+I +H    ++ +  +      
Sbjct: 113 DGVLYTKTFVLKRGSYDVAVNFNVKNQTAATVEVQPYGQI-KHTLLESSGSLTMPTYTGG 171

Query: 223 VLGDKSLVEQKYS--DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
                    +KYS  D+EK+++ + +    W+ +   Y+ S ++P+++   ++ +   ++
Sbjct: 172 AYSSAETNYKKYSFQDMEKANL-DINTKAGWVALLQHYFVSAWVPNQDAE-NTIYSRTNN 229

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
           G A     +     TI P    T T+ L+ G K+       E +      ++ +D+GW +
Sbjct: 230 GIATI--GYRGPVTTIAPNSEATITSQLWTGPKD-----QKEMEATAANLDLTVDYGWAW 282

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           FIAKP+F L+++  ++V N+G+AI+  T+ VK + +PL K QY S A M+ +QPKI E+R
Sbjct: 283 FIAKPLFALLTFIQSIVTNWGLAIIGVTIVVKTILYPLTKAQYTSMARMRMLQPKIQEMR 342

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E+F     Q + + M++LYK   +NP+ GC PIL+Q+P+F A+Y     ++E+RHAPF+G
Sbjct: 343 ERFGDD-RQRMSQEMMKLYKEEKVNPMGGCLPILIQMPIFIALYWTFMEAVELRHAPFFG 401

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMI 519
           WI+DL+A D           P+Y        I P++M  SMF+  KMSP P  D  Q  +
Sbjct: 402 WIQDLSAQD-----------PYY--------ILPLLMGASMFLLQKMSPSPVTDPVQQKV 442

Query: 520 LNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           + +MPV+F      FP+GL++YW  SN+I+IVQQ +I +
Sbjct: 443 MTFMPVMFTVFFLWFPSGLVLYWLTSNIITIVQQWLIYR 481


>gi|15603030|ref|NP_246102.1| putative inner membrane protein translocase component YidC
           [Pasteurella multocida subsp. multocida str. Pm70]
 gi|38503177|sp|Q9CLQ2|OXAA_PASMU RecName: Full=Inner membrane protein oxaA
 gi|12721513|gb|AAK03249.1| YidC [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 541

 Score =  220 bits (560), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 152/502 (30%), Positives = 252/502 (50%), Gaps = 52/502 (10%)

Query: 71  VELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYV--- 127
           + L+N      ++  G       L  Y  +++SN+P   L + +N  + Y A+   V   
Sbjct: 66  ITLENDVFRLEVDTLGGDVVHSELLKYDAELNSNTPFTLLTNKAN--HVYIAQSGLVGKD 123

Query: 128 ---STANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEH-YLFKIV 183
              + A           + L  G+       +  VF+  + + F +   L    Y   + 
Sbjct: 124 GIDTKAGRANYQVDGDTFKLADGQ---NELAVPFVFEK-DGVTFRKIFVLKRGAYDIAVN 179

Query: 184 DTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS--DIEKSS 241
             + N S   I   P G+ +RH     T    +               +KYS  D+EK++
Sbjct: 180 FEIDNQSDKTIEVEPYGQ-LRHTLVEDTGNVAMPTYTGGAYSSSETNYKKYSFADMEKAN 238

Query: 242 ISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILP-GK 300
           +S       W+ +   Y+ S +IP+++    +Q   L+D      +      +T +P G 
Sbjct: 239 LS-ISTKAGWVAVLQHYFVSAWIPNQDAD--NQLYSLTDKANNLASIGYRGPVTAIPAGA 295

Query: 301 SITTTNFLFAGAK---EFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLV 357
             T  + L+ G K   +  T+ ++         ++ +D+GW +FIAKP+F L+++  ++V
Sbjct: 296 KETIRSSLWTGPKLQDQMATVANH--------LDLSVDYGWAWFIAKPLFWLLTFIQSIV 347

Query: 358 GNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQ 417
            N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F +   Q + + M++
Sbjct: 348 QNWGLAIIGVTLVVKAILYPLTKAQYTSMAKMRMLQPKLQEMRERFGED-RQRMSQEMMK 406

Query: 418 LYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLF 477
           LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A D        
Sbjct: 407 LYKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQD-------- 458

Query: 478 GILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPA 536
              P+Y        I PI+M  SMF+  KMSP P AD  Q  I+N+MP++F+     FP+
Sbjct: 459 ---PYY--------ILPILMGASMFLLQKMSPTPVADPTQQKIMNFMPLIFMVFFLWFPS 507

Query: 537 GLIIYWSWSNVISIVQQAVIMK 558
           GL++YW  SN+I+I QQ +I +
Sbjct: 508 GLVLYWLVSNLITIAQQQLIYR 529


>gi|307246347|ref|ZP_07528425.1| Inner membrane protein oxaA [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307255333|ref|ZP_07537145.1| Inner membrane protein oxaA [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307259783|ref|ZP_07541503.1| Inner membrane protein oxaA [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306852757|gb|EFM84984.1| Inner membrane protein oxaA [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306861720|gb|EFM93702.1| Inner membrane protein oxaA [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306866173|gb|EFM98041.1| Inner membrane protein oxaA [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
          Length = 533

 Score =  219 bits (559), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 128/399 (32%), Positives = 218/399 (54%), Gaps = 34/399 (8%)

Query: 164 NNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIA 222
           + +L+ +T  L    Y   +   V N +   +   P G+I +H    ++ +  +      
Sbjct: 153 DGVLYTKTFVLKRGSYDVAVNFNVKNQTAATVEVQPYGQI-KHTLLESSGSLTMPTYTGG 211

Query: 223 VLGDKSLVEQKYS--DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
                    +KYS  D+EK+++ + +    W+ +   Y+ S ++P+++   ++ +   ++
Sbjct: 212 AYSSAETNYKKYSFQDMEKANL-DINTKAGWVALLQHYFVSAWVPNQDAE-NTIYSRTNN 269

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
           G A     +     TI P    T T+ L+ G K+       E +      ++ +D+GW +
Sbjct: 270 GIATI--GYRGPVTTIAPNSEATITSQLWTGPKD-----QKEMEATAANLDLTVDYGWVW 322

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           FIAKP+F L+++  ++V N+G+AI+  T+ VK + +PL K QY S A M+ +QPKI E+R
Sbjct: 323 FIAKPLFALLTFIQSIVTNWGLAIIGVTIVVKTILYPLTKAQYTSMARMRMLQPKIQEMR 382

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E+F     Q + + M++LYK   +NP+ GC PIL+Q+P+F A+Y     ++E+RHAPF+G
Sbjct: 383 ERFGDD-RQRMSQEMMKLYKEEKVNPMGGCLPILIQMPIFIALYWTFMEAVELRHAPFFG 441

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMI 519
           WI+DL+A D           P+Y        I P++M  SMF+  KMSP P  D  Q  +
Sbjct: 442 WIQDLSAQD-----------PYY--------ILPLLMGASMFLLQKMSPSPVTDPVQQKV 482

Query: 520 LNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           + +MPV+F      FP+GL++YW  SN+I+IVQQ +I +
Sbjct: 483 MTFMPVMFTVFFLWFPSGLVLYWLTSNIITIVQQWLIYR 521


>gi|320354720|ref|YP_004196059.1| protein translocase subunit YidC [Desulfobulbus propionicus DSM
           2032]
 gi|320123222|gb|ADW18768.1| protein translocase subunit yidC [Desulfobulbus propionicus DSM
           2032]
          Length = 549

 Score =  219 bits (559), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 166/572 (29%), Positives = 276/572 (48%), Gaps = 40/572 (6%)

Query: 5   WNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQA 64
           +  F+AI LS +I+  +Q F+V P   +     +  Q     NQ     A       A  
Sbjct: 4   YRAFLAIVLSFLILIGYQYFFVKPVPPQPQAPGQATQAASSANQQTAGGAPAAATGIAAT 63

Query: 65  LS------MSPRVELKNPSLIGSINLKGAQFDDLNLRGYH-LDVSSNSPIVTLLSPSNTK 117
            S      ++  V +  P     IN +G       L+ Y   +     P+  ++      
Sbjct: 64  PSTVAVDPLAHDVTVDTPLYTAVINEQGGGVKGFVLKSYRSTNAEDAGPMQLIIGKGPAD 123

Query: 118 NAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISL-DE 176
                 LD         LP      N ++      T  + +    A+ I   RT++   +
Sbjct: 124 APVLFSLD---NGAGTVLPTYTADKNAVTLTNQGDTGTLTMTAALADGIAIVRTLTFRGD 180

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMR----HKPQTATNTFGVQEGFIAVLGDKSLVEQ 232
            YL  +   V+N +   ++ SP   ++     H  +T+   F     ++    ++ LVE 
Sbjct: 181 SYLINVEYKVSNTTDRPVQVSPALTMVNEPFAHASETSKYLFAGPAAYV----NEKLVET 236

Query: 233 KYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSAN 292
           K   + ++ +       SW G  D Y+ +   P+     + +   L     + +   S  
Sbjct: 237 KAKKLTEAPVV-LQGKVSWTGYVDNYFMTTVAPAVG---NGRTITLQGSEQQVRTVLSEG 292

Query: 293 EITILP--GKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLM 350
             TI P  GKS   T  L+ G K+   +     DLA       +D+GWF  +AKPM  L+
Sbjct: 293 IQTIGPHEGKSFAYT--LYFGPKKLQVLQTAGSDLA-----KAVDFGWFDVLAKPMLWLL 345

Query: 351 SYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQV 410
           ++F+    N+G+AI+L T+ +KL+F+P+ +K   S  NM+ +QPKI +LRE+FK  P ++
Sbjct: 346 NFFHQFSHNYGVAIILLTILIKLIFWPITQKGMKSMKNMQKLQPKIAKLRERFKDDPAKM 405

Query: 411 LQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADP 470
            Q+ M+ LYKT+ +NP+ GC P+L+QIP FFA+Y+V+  ++E+RHAPF  WI DL+A D 
Sbjct: 406 NQE-MMTLYKTYKVNPVGGCLPMLIQIPFFFALYRVLMAAIELRHAPFMLWINDLSAPDR 464

Query: 471 TNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFA 530
             I        F +P    + I  ++M  SM++Q KM+P  AD  QA I+ ++P+VF F 
Sbjct: 465 LWI-------GFDIPYLHGIPILTLLMGASMYLQQKMTPTTADPTQARIMQFLPIVFTFM 517

Query: 531 LSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
             +F +GL++YW  +N++SI+QQ +I + + A
Sbjct: 518 FINFASGLVLYWFVNNLLSILQQYLINRQNKA 549


>gi|190150778|ref|YP_001969303.1| inner membrane protein OxaA [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|303250854|ref|ZP_07337047.1| putative inner membrane protein translocase component YidC
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|303253770|ref|ZP_07339905.1| putative inner membrane protein translocase component YidC
           [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|307248474|ref|ZP_07530494.1| Inner membrane protein oxaA [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|254772740|sp|B3H2D6|OXAA_ACTP7 RecName: Full=Inner membrane protein oxaA
 gi|189915909|gb|ACE62161.1| inner membrane protein OxaA [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|302647354|gb|EFL77575.1| putative inner membrane protein translocase component YidC
           [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|302650269|gb|EFL80432.1| putative inner membrane protein translocase component YidC
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|306855042|gb|EFM87225.1| Inner membrane protein oxaA [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
          Length = 542

 Score =  219 bits (559), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 128/399 (32%), Positives = 218/399 (54%), Gaps = 34/399 (8%)

Query: 164 NNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIA 222
           + +L+ +T  L    Y   +   V N +   +   P G+I +H    ++ +  +      
Sbjct: 162 DGVLYTKTFVLKRGSYDVAVNFNVKNQTAATVEVQPYGQI-KHTLLESSGSLTMPTYTGG 220

Query: 223 VLGDKSLVEQKYS--DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
                    +KYS  D+EK+++ + +    W+ +   Y+ S ++P+++   ++ +   ++
Sbjct: 221 AYSSAETNYKKYSFQDMEKANL-DINTKAGWVALLQHYFVSAWVPNQDAE-NTIYSRTNN 278

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
           G A     +     TI P    T T+ L+ G K+       E +      ++ +D+GW +
Sbjct: 279 GIATI--GYRGPVTTIAPNSEATITSQLWTGPKD-----QKEMEATAANLDLTVDYGWAW 331

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           FIAKP+F L+++  ++V N+G+AI+  T+ VK + +PL K QY S A M+ +QPKI E+R
Sbjct: 332 FIAKPLFALLTFIQSIVTNWGLAIIGVTIVVKTILYPLTKAQYTSMARMRMLQPKIQEMR 391

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E+F     Q + + M++LYK   +NP+ GC PIL+Q+P+F A+Y     ++E+RHAPF+G
Sbjct: 392 ERFGDD-RQRMSQEMMKLYKEEKVNPMGGCLPILIQMPIFIALYWTFMEAVELRHAPFFG 450

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMI 519
           WI+DL+A D           P+Y        I P++M  SMF+  KMSP P  D  Q  +
Sbjct: 451 WIQDLSAQD-----------PYY--------ILPLLMGASMFLLQKMSPSPVTDPVQQKV 491

Query: 520 LNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           + +MPV+F      FP+GL++YW  SN+I+IVQQ +I +
Sbjct: 492 MTFMPVMFTVFFLWFPSGLVLYWLTSNIITIVQQWLIYR 530


>gi|46143583|ref|ZP_00134946.2| COG0706: Preprotein translocase subunit YidC [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
          Length = 542

 Score =  219 bits (559), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 128/399 (32%), Positives = 218/399 (54%), Gaps = 34/399 (8%)

Query: 164 NNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIA 222
           + +L+ +T  L    Y   +   V N +   +   P G+I +H    ++ +  +      
Sbjct: 162 DGVLYTKTFVLKRGSYDVAVNFNVKNQTAATVEVQPYGQI-KHTLLESSGSLTMPTYTGG 220

Query: 223 VLGDKSLVEQKYS--DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
                    +KYS  D+EK+++ + +    W+ +   Y+ S ++P+++   ++ +   ++
Sbjct: 221 AYSSAETNYKKYSFQDMEKANL-DINTKAGWVALLQHYFVSAWVPNQDAE-NTIYSRTNN 278

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
           G A     +     TI P    T T+ L+ G K+       E +      ++ +D+GW +
Sbjct: 279 GIATI--GYRGPVTTIAPNSEATITSQLWTGPKD-----QKEMEATAANLDLTVDYGWAW 331

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           FIAKP+F L+++  ++V N+G+AI+  T+ VK + +PL K QY S A M+ +QPKI E+R
Sbjct: 332 FIAKPLFALLTFIQSIVTNWGLAIIGVTIVVKTILYPLTKAQYTSMARMRMLQPKIQEMR 391

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E+F     Q + + M++LYK   +NP+ GC PIL+Q+P+F A+Y     ++E+RHAPF+G
Sbjct: 392 ERFGDD-RQRMSQEMMKLYKEEKVNPMGGCLPILIQMPIFIALYWTFMEAVELRHAPFFG 450

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMI 519
           WI+DL+A D           P+Y        I P++M  SMF+  KMSP P  D  Q  +
Sbjct: 451 WIQDLSAQD-----------PYY--------ILPLLMGASMFLLQKMSPSPVTDPVQQKV 491

Query: 520 LNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           + +MPV+F      FP+GL++YW  SN+I+IVQQ +I +
Sbjct: 492 MTFMPVMFTVFFLWFPSGLVLYWLTSNIITIVQQWLIYR 530


>gi|260581921|ref|ZP_05849717.1| membrane protein insertase, YidC/Oxa1 family domain [Haemophilus
           influenzae NT127]
 gi|260095114|gb|EEW79006.1| membrane protein insertase, YidC/Oxa1 family domain [Haemophilus
           influenzae NT127]
          Length = 541

 Score =  219 bits (559), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 119/327 (36%), Positives = 195/327 (59%), Gaps = 30/327 (9%)

Query: 234 YSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA-KFSAN 292
           +SD++ +++S       W+ +   Y+ S +IP+++   ++Q   ++D      +  +   
Sbjct: 231 FSDMQDNNLS-IDTKAGWVAVLQHYFVSAWIPNQDV--NNQLYTITDSKNNVASIGYRGP 287

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
            +TI  G   T T+ L+ G    P + +    +A    ++ +D+GW +FIAKP+F L+++
Sbjct: 288 VVTIPAGSQETITSSLWTG----PKLQNQMATVA-NNLDLTVDYGWAWFIAKPLFWLLTF 342

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
              +V N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + 
Sbjct: 343 IQGIVSNWGLAIICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGDD-RQRMS 401

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           + M++LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A D   
Sbjct: 402 QEMMKLYKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQD--- 458

Query: 473 IFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFAL 531
                   P+Y        I PI+M +SMF+  KMSP P  D  Q  ++N+MP+VF+F  
Sbjct: 459 --------PYY--------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLVFMFFF 502

Query: 532 SSFPAGLIIYWSWSNVISIVQQAVIMK 558
             FP+GL++YW  SN+I+I QQ +I +
Sbjct: 503 LWFPSGLVLYWLVSNLITIAQQQLIYR 529


>gi|238899054|ref|YP_002924736.1| protein involved in protein translocation and folding, substrates
           includes ATP synthase, SecYEG, LacY [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
 gi|229466814|gb|ACQ68588.1| protein involved in protein translocation and folding, substrates
           includes ATP synthase, SecYEG, LacY [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
          Length = 547

 Score =  219 bits (559), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 130/413 (31%), Positives = 227/413 (54%), Gaps = 39/413 (9%)

Query: 156 IKLVFKNANNILFERTISLDEH-YLFKIVDTVTNNSIDQIRFSPRGRIM------RHKPQ 208
           I L F + N ++  +T  L  + Y  +++  + N S   + F+  G++       +H+  
Sbjct: 150 IPLTFTDKNGLVLTKTFILKRNDYAIRVLYRINNASSTPLEFNFFGQLKQSTQLPKHR-D 208

Query: 209 TATNTFGVQEGFIAVLGDKSLVEQKYS--DIEKSSISNFHESNSWLGISDKYWASVFIPS 266
           TA++ F +     A    K    +KYS  DIE +++ N      W+ +  +Y+A+ +IP+
Sbjct: 209 TASSNFALHTYRGAAYSSKEDKYKKYSFSDIEDANL-NITTQGGWVAMLQQYFATAWIPN 267

Query: 267 KETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLA 326
              +     ++L  GH    + F +  + + PG+    +  L+ G    P +      +A
Sbjct: 268 AGETHDFYSRHL--GHGLVASGFKSLPVLVNPGEQKELSATLWVG----PELQDKMAVIA 321

Query: 327 IPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVST 386
            P  ++ +D+GW +FI++P+F L+ + +  VGN+G++I+L T  V+ + +PL K QY S 
Sbjct: 322 -PHLDLTVDYGWLWFISQPLFKLLKFIHGFVGNWGLSIILITFIVRGIMYPLTKAQYTSM 380

Query: 387 ANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKV 446
           A M+ +QPK+ E+RE+      Q + + M+ LYK+  +NPL GC P+++Q+P+F A+Y +
Sbjct: 381 AKMRMLQPKLTEMRERIGDD-RQRMSQEMMALYKSEKVNPLGGCLPLIIQMPIFLALYYM 439

Query: 447 ISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMK 506
           +  S+E+RHAPF  WI DL+A D           P+Y        I PI+M L+M+   K
Sbjct: 440 LMGSVELRHAPFILWIHDLSAQD-----------PYY--------ILPILMGLTMYFIQK 480

Query: 507 MSPPP-ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           MSP    D  Q  I+N+MPV+F      FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 481 MSPSTITDPMQKKIMNFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYR 533


>gi|300705597|ref|YP_003747200.1| cytoplasmic insertase, essential for proper integration of ATPase
           into the membrane [Ralstonia solanacearum CFBP2957]
 gi|299073261|emb|CBJ44620.1| cytoplasmic insertase, essential for proper integration of ATPase
           into the membrane [Ralstonia solanacearum CFBP2957]
          Length = 554

 Score =  219 bits (559), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 123/329 (37%), Positives = 188/329 (57%), Gaps = 28/329 (8%)

Query: 234 YSDIEKSSISNFHESNS-WLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSAN 292
           ++DI+K        ++S W+ +   Y+AS +IP+   S   ++         Y+      
Sbjct: 244 FADIDKGKAQVPGATDSGWVAMVQHYFASAWIPA--ASVKREYYVDRVDTNFYRIGIQEP 301

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
             T+ PG S++ T  LFAG +E   +         P  +++ D+GW   IAKP+F L+  
Sbjct: 302 LGTVAPGASLSATARLFAGPQEARMLEGIT-----PGLDLVKDYGWLTVIAKPLFWLLEK 356

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
            + L+GN+G +I+  TV +KL+FFPL+   Y S A MK++QP++  +RE+ K   PQ + 
Sbjct: 357 IHALLGNWGWSIVALTVLIKLVFFPLSATSYRSMAKMKDLQPRMTAIRERHKGD-PQKMN 415

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           + M+ LY+T  +NPL GC PIL+QIPVF A+Y  +  S+EMR AP+ GW+ DLA+ D   
Sbjct: 416 QEMMTLYRTEKVNPLGGCLPILIQIPVFMALYWALLSSVEMRGAPWLGWVHDLASPD--- 472

Query: 473 IFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALS 532
                   PFY        I PI+M++SMF+Q K++P P D  QA ++ +MP+ F     
Sbjct: 473 --------PFY--------ILPILMAVSMFVQTKLNPTPPDPVQAKMMMFMPLAFSVMFF 516

Query: 533 SFPAGLIIYWSWSNVISIVQQAVIMKMHG 561
            FPAGL++YW  +N +SI QQ  I +M G
Sbjct: 517 FFPAGLVLYWVVNNCLSIAQQWSINRMLG 545


>gi|307250692|ref|ZP_07532629.1| Inner membrane protein oxaA [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307257502|ref|ZP_07539268.1| Inner membrane protein oxaA [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306857300|gb|EFM89419.1| Inner membrane protein oxaA [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306864014|gb|EFM95931.1| Inner membrane protein oxaA [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
          Length = 533

 Score =  219 bits (558), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 128/399 (32%), Positives = 218/399 (54%), Gaps = 34/399 (8%)

Query: 164 NNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIA 222
           + +L+ +T  L    Y   +   V N +   +   P G+I +H    ++ +  +      
Sbjct: 153 DGVLYTKTFVLKRGSYDVAVNFNVKNQTAATVEVQPYGQI-KHTLLESSGSLTMPTYTGG 211

Query: 223 VLGDKSLVEQKYS--DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
                    +KYS  D+EK+++ + +    W+ +   Y+ S ++P+++   ++ +   ++
Sbjct: 212 AYSSAETNYKKYSFQDMEKANL-DINTKAGWVALLQHYFVSAWVPNQDAE-NTIYSRTNN 269

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
           G A     +     TI P    T T+ L+ G K+       E +      ++ +D+GW +
Sbjct: 270 GIATI--GYRGPVTTIAPNSEATITSQLWTGPKD-----QKEMEATAANLDLTVDYGWAW 322

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           FIAKP+F L+++  ++V N+G+AI+  T+ VK + +PL K QY S A M+ +QPKI E+R
Sbjct: 323 FIAKPLFALLTFIQSIVTNWGLAIIGVTIVVKTILYPLTKAQYTSMARMRMLQPKIQEMR 382

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E+F     Q + + M++LYK   +NP+ GC PIL+Q+P+F A+Y     ++E+RHAPF+G
Sbjct: 383 ERFGDD-RQRMSQEMMKLYKEEKVNPMGGCLPILIQMPIFIALYWTFMEAVELRHAPFFG 441

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMI 519
           WI+DL+A D           P+Y        I P++M  SMF+  KMSP P  D  Q  +
Sbjct: 442 WIQDLSAQD-----------PYY--------ILPLLMGASMFLLQKMSPSPVTDPVQQKV 482

Query: 520 LNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           + +MPV+F      FP+GL++YW  SN+I+IVQQ +I +
Sbjct: 483 MTFMPVMFTVFFLWFPSGLVLYWLTSNIITIVQQWLIYR 521


>gi|119900278|ref|YP_935491.1| propable 60 Kd inner-membrane protein [Azoarcus sp. BH72]
 gi|119672691|emb|CAL96605.1| propable 60 Kd inner-membrane protein [Azoarcus sp. BH72]
          Length = 538

 Score =  219 bits (558), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 147/499 (29%), Positives = 235/499 (47%), Gaps = 42/499 (8%)

Query: 70  RVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVST 129
           RV++    L   ++ +G     L L  +      +     LL     ++ Y AE   + T
Sbjct: 62  RVKVVTDVLQAEVSAEGGSIVRLELEKHRATTDRSRGF--LLLDDGERHLYAAESGLIGT 119

Query: 130 ANNIELPNSNTVWNLISGKILTPTTPIKLVFK----NANNILFERTISLDE-HYLFKIVD 184
                LP   T + L +G  +      +LV +      N +   + ++     YL  +  
Sbjct: 120 G----LPTHRTRFALPAGDQVLKDGEDRLVLRLEAPEQNGVKVTKVMTFHRGSYLVDVNY 175

Query: 185 TVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQE--GFIAVLGDKSLVEQKYSDIEKSS 241
            + N   + ++     +  R  KP      FGV    G           + K+SDI++  
Sbjct: 176 EIANGGAEPVKAHAYYQFTRDGKPAEQVEAFGVTTFTGPAYYTDAAKFQKVKFSDIDEGK 235

Query: 242 ISNFHESN-SWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGK 300
                 +N  W+ +   Y+   ++P  E     ++     G   Y A    +   + PG 
Sbjct: 236 AKFAKTANDGWVAMVQHYFVGAWLP--EAGVEREYFARKVGGDLYSAGAIESVADVQPGA 293

Query: 301 SITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF 360
           +      L+ G +E   + +       P  ++++D+GW   IA P+F  +S  + L GN+
Sbjct: 294 TGNAQARLYVGPQEQDKLENIA-----PGLDLVVDYGWLTVIAAPLFWALSALHKLTGNW 348

Query: 361 GIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYK 420
           G AI+L TV +K LFFPL+   Y S A M+ + P++  ++E +     + +Q+ M+ LY+
Sbjct: 349 GWAIILVTVALKALFFPLSAASYKSMAKMRVLGPRLQRMKELYGNDKVK-MQQEMMNLYR 407

Query: 421 THNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL 480
           T  INPL GC PIL+QIPVF A+Y V+  S+EMR AP+ GWI+DL+A DP  I       
Sbjct: 408 TEKINPLGGCLPILVQIPVFIALYWVLLGSVEMRQAPWLGWIQDLSAKDPYFIL------ 461

Query: 481 PFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLII 540
                        PIIM +SM +QMK++P P D  QA ++  MP+VF F    FP+GL++
Sbjct: 462 -------------PIIMGVSMLVQMKLNPTPPDPIQAKVMMAMPIVFTFMFLWFPSGLVL 508

Query: 541 YWSWSNVISIVQQAVIMKM 559
           YW  +NV+SI QQ  I +M
Sbjct: 509 YWVVNNVLSIAQQWQITRM 527


>gi|329894825|ref|ZP_08270625.1| OxaI/YidC membrane insertion protein [gamma proteobacterium
           IMCC3088]
 gi|328922719|gb|EGG30053.1| OxaI/YidC membrane insertion protein [gamma proteobacterium
           IMCC3088]
          Length = 554

 Score =  219 bits (558), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 115/313 (36%), Positives = 178/313 (56%), Gaps = 27/313 (8%)

Query: 246 HESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTT 305
               SW+ +   Y+ S +IP+ +       +   DG     A F +    + PG + TT+
Sbjct: 260 QTQGSWIALIQHYFLSAWIPNPDKIHTYTTRVTKDGFNI--AGFLSPATVVAPGATATTS 317

Query: 306 NFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIM 365
             L+ G K+      Y  +   P  E+ +D+GW ++IA+P+F L++  + LVGN+G+AI+
Sbjct: 318 AQLYVGPKD-----QYTLEKISPFLELSVDYGWLWWIAQPLFWLLTKIHGLVGNWGVAII 372

Query: 366 LTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNIN 425
           L TV +K  FF L+   Y S ANM+ +QPK+ ++RE++     Q   +AM++LYK   IN
Sbjct: 373 LLTVLIKGAFFKLSAASYRSMANMRRVQPKMADIREQYADD-KQKQSQAMMELYKKEKIN 431

Query: 426 PLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLP 485
           P+ GC PIL+Q+PVF A+Y  +  S+E+RHAPF  WI DL+  DP  +            
Sbjct: 432 PMGGCLPILVQMPVFIALYWTLMESVELRHAPFALWINDLSVMDPYFVL----------- 480

Query: 486 GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWS 545
                   PI+M  SM+   K++PPP D  QA ++ W+P+VF F    FPAGL++YW  +
Sbjct: 481 --------PILMGASMWFMQKLNPPPPDPMQAKLMQWLPIVFTFFFLWFPAGLVLYWVVN 532

Query: 546 NVISIVQQAVIMK 558
           N++S+ QQ +I K
Sbjct: 533 NLLSMTQQYIITK 545


>gi|307253082|ref|ZP_07534965.1| Inner membrane protein oxaA [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307264104|ref|ZP_07545701.1| Inner membrane protein oxaA [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|306859451|gb|EFM91481.1| Inner membrane protein oxaA [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306870582|gb|EFN02329.1| Inner membrane protein oxaA [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 533

 Score =  219 bits (558), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 128/399 (32%), Positives = 218/399 (54%), Gaps = 34/399 (8%)

Query: 164 NNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIA 222
           + +L+ +T  L    Y   +   V N +   +   P G+I +H    ++ +  +      
Sbjct: 153 DGVLYTKTFVLKRGSYDVAVNFNVKNQTAATVEVQPYGQI-KHTLLESSGSLTMPTYTGG 211

Query: 223 VLGDKSLVEQKYS--DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
                    +KYS  D+EK+++ + +    W+ +   Y+ S ++P+++   ++ +   ++
Sbjct: 212 AYSSAETNYKKYSFQDMEKANL-DINTKAGWVALLQHYFVSAWVPNQDAE-NTIYSRTNN 269

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
           G A     +     TI P    T T+ L+ G K+       E +      ++ +D+GW +
Sbjct: 270 GIATI--GYRGPVTTIAPNSEATITSQLWTGPKD-----QKEMEATAANLDLTVDYGWAW 322

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           FIAKP+F L+++  ++V N+G+AI+  T+ VK + +PL K QY S A M+ +QPKI E+R
Sbjct: 323 FIAKPLFALLTFIQSIVTNWGLAIIGVTIVVKTILYPLTKAQYTSMARMRMLQPKIQEMR 382

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E+F     Q + + M++LYK   +NP+ GC PIL+Q+P+F A+Y     ++E+RHAPF+G
Sbjct: 383 ERFGDD-RQRMSQEMMKLYKEEKVNPMGGCLPILIQMPIFIALYWTFMEAVELRHAPFFG 441

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMI 519
           WI+DL+A D           P+Y        I P++M  SMF+  KMSP P  D  Q  +
Sbjct: 442 WIQDLSAQD-----------PYY--------ILPLLMGASMFLLQKMSPSPVTDPVQQKV 482

Query: 520 LNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           + +MPV+F      FP+GL++YW  SN+I+IVQQ +I +
Sbjct: 483 MTFMPVMFTVFFLWFPSGLVLYWLTSNIITIVQQWLIYR 521


>gi|167587875|ref|ZP_02380263.1| putative inner membrane protein translocase component YidC
           [Burkholderia ubonensis Bu]
          Length = 504

 Score =  219 bits (558), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 160/499 (32%), Positives = 247/499 (49%), Gaps = 57/499 (11%)

Query: 80  GSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSN 139
           G I+ +G     L L+    D       +TL       + Y A    +      + PN N
Sbjct: 41  GEIDTRGGTLAKLTLKK-QGDGKQPDLYITLFD-HTASHTYLARTGLLGG----DFPNHN 94

Query: 140 TVWNLISGKILTPTT------PIKLVFKN--ANNILFERTISLDEHYLFKIVDTVTNNSI 191
            V++ ++     PTT       +KL F++     +   +T +         VDT  +N +
Sbjct: 95  DVYSQVNAG---PTTLSGDQNALKLSFESPVKGGVKVVKTYTFTRGSYVIDVDTKIDN-V 150

Query: 192 DQIRFSPRGRIMRHKPQTATNTFGVQEGFI--AVLGD-KSLVEQKYSDIEKSSISNFHES 248
                SP   +   +  TA  T      F+  AV  D K   +  +SD++K+  +NF +S
Sbjct: 151 GTAPVSPTVYMELVRDNTAVETPMFSHTFLGPAVYTDSKHFQKIDFSDLDKNK-ANFEKS 209

Query: 249 --NSWLGISDKYWASVFIPS---KETSFHSQFKYLSDGHARYQAKFSANEITILPGKSIT 303
             N W+ +   Y+AS +IP    K   +  +F       A Y+         I PG+S  
Sbjct: 210 ADNGWVAMVQHYFASAWIPKQGVKRDIYAEKFD-----PALYRVGVKQPVGAIAPGQSAD 264

Query: 304 TTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIA 363
            +  LFAG +E   +         P  E++ D+GW   IAKP+F L+   +  VGN+G A
Sbjct: 265 VSARLFAGPEEERMLEGIA-----PGLELVKDYGWVTIIAKPLFWLLEKIHGFVGNWGWA 319

Query: 364 IMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHN 423
           I+L T+ +K +FFPL+   Y S A MK I P++  LRE+FK S PQ +  A+++LYKT  
Sbjct: 320 IVLLTLLIKAVFFPLSAASYKSMARMKEITPRMQALRERFK-SDPQKMNAALMELYKTEK 378

Query: 424 INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY 483
           +NP  GC P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  D           PF+
Sbjct: 379 VNPFGGCLPVVIQIPVFISLYWVLLASVEMRGAPWILWIHDLSQRD-----------PFF 427

Query: 484 LPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWS 543
                   I P++M++SMF+Q K++P P D  QA ++ +MP+ F      FPAGL++Y+ 
Sbjct: 428 --------ILPVLMAVSMFVQTKLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVLYYV 479

Query: 544 WSNVISIVQQAVIMKMHGA 562
            +NV+SI QQ  I +  G 
Sbjct: 480 VNNVLSIAQQYYITRKLGG 498


>gi|325577779|ref|ZP_08148054.1| YidC/Oxa1 family membrane protein insertase [Haemophilus
           parainfluenzae ATCC 33392]
 gi|325160524|gb|EGC72650.1| YidC/Oxa1 family membrane protein insertase [Haemophilus
           parainfluenzae ATCC 33392]
          Length = 542

 Score =  219 bits (558), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 125/376 (33%), Positives = 214/376 (56%), Gaps = 31/376 (8%)

Query: 186 VTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYSDIEKSSISN 244
           + N S   I   P G++     +++ N       G      + +  +  +SD++  ++S 
Sbjct: 183 IVNQSGSAIEVEPYGQLKHTLVESSGNVAMPTYTGGAYSSSETNYKKYSFSDMKDKNLS- 241

Query: 245 FHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA-KFSANEITILPGKSIT 303
                 W+ +   Y+ S +IP+++   ++Q   ++D      +  +    ++I  G + T
Sbjct: 242 IDTKAGWVAVLQHYFVSAWIPNQDV--NNQLYSITDSKNNVASIGYRGPVVSIPAGATET 299

Query: 304 TTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIA 363
            T+ L+ G    P + +   ++A    ++ +D+GW +FIAKP+F L+++  ++V N+G+A
Sbjct: 300 ITSSLWTG----PKLQNKMAEVA-NHLDLTVDYGWAWFIAKPLFWLLTFIQSIVSNWGVA 354

Query: 364 IMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHN 423
           I+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++LYK   
Sbjct: 355 IICVTLVVKAILYPLTKAQYTSMAKMRMLQPKMQEMRERFGDD-RQRMSQEMMKLYKEEK 413

Query: 424 INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY 483
           +NPL GC P++LQ+P+F A+Y     ++E+RHAPF+GWI+DL+A D           P+Y
Sbjct: 414 VNPLGGCLPLILQMPIFIALYWTFMEAVELRHAPFFGWIQDLSAQD-----------PYY 462

Query: 484 LPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPAGLIIYW 542
                   I PI+M  SMF+  KMSP P AD  Q  ++N+MP++F+F    FPAGL++YW
Sbjct: 463 --------ILPILMGGSMFLLQKMSPTPVADPMQQKVMNFMPLIFMFFFLWFPAGLVLYW 514

Query: 543 SWSNVISIVQQAVIMK 558
             SN+I+IVQQ +I +
Sbjct: 515 LVSNLITIVQQQMIYR 530


>gi|255020154|ref|ZP_05292223.1| OxaI/YidC membrane insertion protein [Acidithiobacillus caldus ATCC
           51756]
 gi|254970296|gb|EET27789.1| OxaI/YidC membrane insertion protein [Acidithiobacillus caldus ATCC
           51756]
          Length = 538

 Score =  219 bits (557), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 153/506 (30%), Positives = 257/506 (50%), Gaps = 65/506 (12%)

Query: 65  LSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTK----NAY 120
           L+ +P V        GS++L G     L L+ Y    S  +P   +L+P + +     + 
Sbjct: 80  LAAAPSVPFATQVYQGSVSLLGGDIVHLGLKHYPTSSSDKAP-YPILTPESARLTLQQSG 138

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKI-LTPTTPIKLVFKN-ANNILFERTISLD-EH 177
           F  LD                  ++ G+  L   T   L+F+  A  +  E+T+    + 
Sbjct: 139 FRALD----------------GQILQGRYRLLQDTGHTLIFQGEAGPLRIEKTLEFAPDS 182

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           YL      VTN        S   +I+R+    +     +  G + ++ + S  E+ +SD+
Sbjct: 183 YLIHETVRVTNGGSSDWNGSYLDQILRNDRSESHWFMSIFTGAV-LMHNGSFSEKSFSDL 241

Query: 238 EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITIL 297
            +S   ++  S  W G++D Y+    +P  + +           +AR +   S   + + 
Sbjct: 242 -RSHPEDWSGSG-WAGMTDHYFLEAILPEPKAT--------GQIYARAEGPNSVAGVAVA 291

Query: 298 -----PGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
                PG+S T    L+ G KE  T+    + L     E  +D+GWF  IA+PM  ++S+
Sbjct: 292 LPRLAPGQSTTIEQDLYLGPKEQKTLSSLGRGL-----EQTVDYGWFAIIAEPMHGVLSW 346

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
           F++  GN+G+AI+L  + VK+LFF  +   Y S ANM+ +QPK++++++++ +   Q + 
Sbjct: 347 FHSWTGNWGLAIVLLVLAVKILFFYPSAISYRSMANMRKLQPKLEQIKKQYGEDR-QKMG 405

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
            AM++LY++  +NP+AGC PI++Q+PVF A+Y V+  S+ +R APF  WI DLAA D   
Sbjct: 406 AAMMELYRSEKVNPMAGCLPIVIQMPVFIALYWVLVESVSLRMAPFVLWIHDLAAPD--- 462

Query: 473 IFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALS 532
                   P+Y        I P++M +SMFIQ +++P P D  Q  IL+ +PV+F    S
Sbjct: 463 --------PYY--------ILPLLMGVSMFIQQRLNPAPMDPMQKKILSALPVIFAIFFS 506

Query: 533 SFPAGLIIYWSWSNVISIVQQAVIMK 558
            FPAGL++YW  +NV+SI QQ +I +
Sbjct: 507 FFPAGLVLYWLTNNVVSIAQQYLITR 532


>gi|319775066|ref|YP_004137554.1| Inner membrane protein oxaA [Haemophilus influenzae F3047]
 gi|317449657|emb|CBY85863.1| Inner membrane protein oxaA [Haemophilus influenzae F3047]
          Length = 541

 Score =  219 bits (557), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 126/376 (33%), Positives = 211/376 (56%), Gaps = 31/376 (8%)

Query: 186 VTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYSDIEKSSISN 244
           + N S   I   P G++     +++ N       G      + +  +  +SD++ +++S 
Sbjct: 182 IDNQSGQAIEVEPYGQLKHSIIESSGNVAMPTYTGGAYSSSETNYKKYSFSDMQDNNLS- 240

Query: 245 FHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA-KFSANEITILPGKSIT 303
                 W+ +   Y+ S +IP+++   ++Q   ++D      +  +  + +TI  G   T
Sbjct: 241 IDTKAGWVAVLQHYFVSAWIPNQDV--NNQLYTITDSKNNVASIGYRGSVVTIPAGSQET 298

Query: 304 TTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIA 363
            T+ L+ G    P + +    +A    ++ +D+GW +FIAKP+F L+++   +V N+G+A
Sbjct: 299 ITSSLWTG----PKLQNQMATVA-NNLDLTVDYGWAWFIAKPLFWLLTFIQGIVSNWGLA 353

Query: 364 IMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHN 423
           I+  T+ VK + +PL K QY S A M+ +QPK+ E+RE F     Q + + M++LYK   
Sbjct: 354 IICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRECFGDD-RQRMSQEMMKLYKEEK 412

Query: 424 INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY 483
           +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A D           P+Y
Sbjct: 413 VNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQD-----------PYY 461

Query: 484 LPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPAGLIIYW 542
                   I PI+M +SMF+  KMSP P  D  Q  ++N+MP+VF+F    FP+GL++YW
Sbjct: 462 --------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLVFMFFFLWFPSGLVLYW 513

Query: 543 SWSNVISIVQQAVIMK 558
             SN+I+I QQ +I +
Sbjct: 514 LVSNLITIAQQQLIYR 529


>gi|312797629|ref|YP_004030551.1| 60 kDa inner membrane protein YIDC [Burkholderia rhizoxinica HKI
           454]
 gi|312169404|emb|CBW76407.1| 60 kDa inner membrane protein YIDC [Burkholderia rhizoxinica HKI
           454]
          Length = 554

 Score =  219 bits (557), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 145/447 (32%), Positives = 230/447 (51%), Gaps = 54/447 (12%)

Query: 134 ELPNSNTVWNLISGKI----------LTPTTPIKLVFKNANNILFERTISLDEHYLFKIV 183
           + PN N V+ ++ G            ++  +P+K   K      F R       Y+  + 
Sbjct: 142 DFPNHNDVFTVVPGPTSLTDGANTVSISLESPVKAGVKVVKTYTFTRG-----SYVIGVD 196

Query: 184 DTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFI--AVLGDKSLVEQ-KYSDIEKS 240
             + N     ++ +    ++R      T  F     FI  AV  ++   ++  +SD++K 
Sbjct: 197 TKIENVGAAPVKPTVYMELVRDDTPVETPRF--SHTFIGPAVYTEQHKFQKMSFSDLDKG 254

Query: 241 SISNFHES--NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILP 298
              ++  S  N W+ +   Y+AS +IP KE +   QF       A Y+        +I P
Sbjct: 255 K-QDYAPSADNGWVAMVQHYFASAWIP-KEGA-QRQFYADKFSQALYRVGMKEPVQSIAP 311

Query: 299 GKSITTTNFLFAGAKEFPTIHHYEKDLA--IPRFEMLIDWGWFYFIAKPMFMLMSYFYNL 356
           G+S+     LFAG +E       E+ L    P  E++ D+GW   IAKP+F L+   +  
Sbjct: 312 GQSVNVAARLFAGPQE-------ERKLEKIAPGLELVKDYGWVTIIAKPLFWLLEKIHGF 364

Query: 357 VGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMI 416
           VGN+G AI+L T+ +K +FFPL+   Y S A MK I P++ ++RE+FK S PQ +  A++
Sbjct: 365 VGNWGWAIVLLTLLIKAVFFPLSAASYKSMARMKEITPRMQQIRERFK-SDPQKMNAALM 423

Query: 417 QLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTL 476
           +LYK+  +NP  GC PI++QIPVF ++Y V+  S+EMR AP+  WI DL+  DP  I   
Sbjct: 424 ELYKSEKVNPFGGCLPIVIQIPVFISLYWVLLSSVEMRGAPWVLWIHDLSQQDPYFIL-- 481

Query: 477 FGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPA 536
                            P++M++SMF+Q K++P P D  QA ++ +MP+ F      FPA
Sbjct: 482 -----------------PVLMAVSMFVQTKLNPTPPDPVQAKMMMFMPIAFSVMFFFFPA 524

Query: 537 GLIIYWSWSNVISIVQQAVIMKMHGAE 563
           GL++Y+  +NV+SI QQ  I +M G +
Sbjct: 525 GLVLYYVVNNVLSIAQQYYITRMMGKD 551


>gi|197120418|ref|YP_002140845.1| preprotein translocase subunit YidC [Geobacter bemidjiensis Bem]
 gi|254772787|sp|B5EGX9|OXAA_GEOBB RecName: Full=Inner membrane protein oxaA
 gi|197089778|gb|ACH41049.1| preprotein translocase subunit YidC [Geobacter bemidjiensis Bem]
          Length = 537

 Score =  219 bits (557), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 128/360 (35%), Positives = 197/360 (54%), Gaps = 42/360 (11%)

Query: 199 RGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKY 258
            GR   H P T      + EG + V         K  ++ K+ +  + +  +W   +DKY
Sbjct: 216 EGRYEVHAPST------LSEGKVKV--------DKLDNLLKNPV-QYGKDIAWSAFADKY 260

Query: 259 WASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTI 318
           +    I  K +   SQ +     +   Q    +  +T+ PG+       ++ G K+   +
Sbjct: 261 FMDGIIADKGSI--SQVRITRPANDAIQRDIVSPTVTVAPGQRSAVNYAVYYGPKDLDIL 318

Query: 319 HHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPL 378
                 L   R + +ID+GWF  IAKP+   + + Y   GN+GIAI++ T  +KL+FFPL
Sbjct: 319 K-----LQGNRLDEVIDYGWFGPIAKPLVHSLKFLYKYTGNYGIAIIIITFILKLVFFPL 373

Query: 379 AKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIP 438
             K Y S  +M+ +QPK+ EL+EKFK      + +A+++LYKTH +NPL GC P+++QIP
Sbjct: 374 THKSYKSMKDMQKLQPKMTELKEKFKNDR-DAMNRAVMELYKTHKVNPLGGCLPMVVQIP 432

Query: 439 VFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMS 498
           VFF +Y+ +  S+E+RHAPF+ WI DL+A D           P+Y        + PIIM 
Sbjct: 433 VFFGLYRALMYSIELRHAPFYLWITDLSAKD-----------PYY--------VTPIIMG 473

Query: 499 LSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           ++MFIQ KM+P   D  QA ++  +P+VF F   +FP+GL+IYW  +NV++I QQ  I K
Sbjct: 474 VTMFIQQKMTPTNMDPVQAKMMLMLPIVFTFMFLNFPSGLVIYWLVNNVLTIAQQMYINK 533


>gi|223041690|ref|ZP_03611886.1| inner membrane protein OxaA [Actinobacillus minor 202]
 gi|198246541|gb|ACH82230.1| inner membrane protein OxaA [Actinobacillus minor 202]
          Length = 554

 Score =  219 bits (557), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 152/514 (29%), Positives = 256/514 (49%), Gaps = 57/514 (11%)

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
           A++ S    + +++  L  +++  G    D +L  +H ++ SN+P   L    N+K  Y 
Sbjct: 59  AESNSKGKTITIESDVLRLTVDTLGGDVIDSDLLKHHAELHSNTPFELL--QDNSKVLYI 116

Query: 122 AELDYVSTANNIELPNSNTVWNLISG--KILTPTTPIK--LVFKNANNILFERTISLDEH 177
           A+   +   N I+  N    +   +   K+      I   L F+  + +++ +T +L   
Sbjct: 117 AQSGLIG-KNGIDTNNGRAQYQTTADSFKLADGQNEISVPLTFEK-DGVVYTKTFTLKRG 174

Query: 178 YLFKIVD-TVTNNSIDQIRFSPRGRIMRHK----------PQTATNTFGVQEGFIAVLGD 226
                VD  + NNS + +   P G+ ++H           P      +   E        
Sbjct: 175 SYNVGVDFNIKNNSAEAVEVQPYGQ-LKHTLVESSGSLTMPTYTGGAYSSSETNYKKYSF 233

Query: 227 KSLVEQKYSDIEKSSISNFH---ESNS-WLGISDKYWASVFIPSKETSFHSQFKYLSDGH 282
           + + ++K    E+  I+N     ESN+ W+ I   Y+ S ++P ++       +   +G 
Sbjct: 234 QEMADEKKRKAEQG-IANGGLSIESNTGWVAILQHYFVSAWVPQQDKPMTIYTRVSDNGV 292

Query: 283 ARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLA--IPRFEMLIDWGWFY 340
           A     +     T+ P    T +  L+ G K+       +K++A      ++  D+GW +
Sbjct: 293 ATI--GYRGALTTVAPNSDATISTHLWTGPKD-------QKEMAETAAHLDLTADYGWAW 343

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           FIAKP+F L++    +V N+G+AI+  T+ VK L +PL K QY S A M+ +QP+I E+R
Sbjct: 344 FIAKPLFWLLTNIQKVVINWGLAIICVTIVVKTLLYPLTKAQYTSMAKMRMLQPRIQEMR 403

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E+F     Q + + M++LYK   +NP+ GC PIL+Q+P+F A+Y     ++E+RHAPF+G
Sbjct: 404 ERFGDD-RQRMSQEMMKLYKEEKVNPMGGCLPILIQMPIFIALYWTFMEAVELRHAPFFG 462

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMI 519
           WI+DL+A D           P+Y        I P++M  SMF+  KMSP P AD  Q  +
Sbjct: 463 WIQDLSAQD-----------PYY--------ILPLLMGGSMFLLQKMSPTPVADPVQQKV 503

Query: 520 LNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQ 553
           + +MPV+F      FP+GL++YW  SN I+I QQ
Sbjct: 504 MTFMPVMFTVFFLWFPSGLVLYWLTSNCITIAQQ 537


>gi|301154699|emb|CBW14162.1| cytoplasmic insertase into membrane protein, Sec system
           [Haemophilus parainfluenzae T3T1]
          Length = 542

 Score =  218 bits (556), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 124/376 (32%), Positives = 214/376 (56%), Gaps = 31/376 (8%)

Query: 186 VTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYSDIEKSSISN 244
           + N S   I   P G++     +++ N       G      + +  +  +SD++  ++S 
Sbjct: 183 IVNQSGSAIEVEPYGQLKHTLVESSGNVAMPTYTGGAYSSSETNYKKYSFSDMKDKNLS- 241

Query: 245 FHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA-KFSANEITILPGKSIT 303
                 W+ +   Y+ S +IP+++   ++Q   ++D      +  +    +++  G + T
Sbjct: 242 IDTKAGWVAVLQHYFVSAWIPNQDV--NNQLYSITDSKNNVASIGYRGPVVSVPAGATET 299

Query: 304 TTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIA 363
            T+ L+ G    P + +   ++A    ++ +D+GW +FIAKP+F L+++  ++V N+G+A
Sbjct: 300 ITSSLWTG----PKLQNKMAEVA-NHLDLTVDYGWAWFIAKPLFWLLTFIQSIVSNWGVA 354

Query: 364 IMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHN 423
           I+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++LYK   
Sbjct: 355 IICVTLVVKAILYPLTKAQYTSMAKMRMLQPKMQEMRERFGDD-RQRMSQEMMKLYKEEK 413

Query: 424 INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY 483
           +NPL GC P++LQ+P+F A+Y     ++E+RHAPF+GWI+DL+A D           P+Y
Sbjct: 414 VNPLGGCLPLILQMPIFIALYWTFMEAVELRHAPFFGWIQDLSAQD-----------PYY 462

Query: 484 LPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPAGLIIYW 542
                   I PI+M  SMF+  KMSP P AD  Q  ++N+MP++F+F    FPAGL++YW
Sbjct: 463 --------ILPILMGGSMFLLQKMSPTPVADPMQQKVMNFMPLIFMFFFLWFPAGLVLYW 514

Query: 543 SWSNVISIVQQAVIMK 558
             SN+I+IVQQ +I +
Sbjct: 515 LVSNLITIVQQQMIYR 530


>gi|299068432|emb|CBJ39656.1| cytoplasmic insertase, essential for proper integration of ATPase
           into the membrane [Ralstonia solanacearum CMR15]
          Length = 553

 Score =  218 bits (556), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 119/329 (36%), Positives = 188/329 (57%), Gaps = 28/329 (8%)

Query: 234 YSDIEKSSISNFHESNS-WLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSAN 292
           ++DI+K        ++S W+ +   Y+AS +IP+           +      Y+      
Sbjct: 243 FADIDKGKAQVPAPTDSGWVAMVQHYFASAWIPAANVKREYYVNRVDTNF--YRIGLQEP 300

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
             T+ PG S++TT  LFAG ++   +     +   P  +++ D+GW   +AKP+F L+  
Sbjct: 301 LGTVAPGASVSTTARLFAGPQQARML-----EAITPGLDLVKDYGWLTIVAKPLFWLLEK 355

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
            + L+GN+G +I+  TV +KL+FFPL+   Y S A MK++QP++  +RE+ K   PQ + 
Sbjct: 356 IHALLGNWGWSIVALTVLIKLVFFPLSATSYRSMAKMKDLQPRMTAIRERHKGD-PQKMN 414

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           + M+ LY+T  +NPL GC PI++QIPVF A+Y  +  S+EMR AP+ GW+ DLA+ D   
Sbjct: 415 QEMMTLYRTEKVNPLGGCLPIMIQIPVFMALYWALLSSVEMRGAPWLGWVHDLASPD--- 471

Query: 473 IFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALS 532
                   PFY        I PI+M++SMF+Q +++P P D  QA ++ +MP+ F     
Sbjct: 472 --------PFY--------ILPILMAVSMFVQTRLNPTPPDPVQAKMMMFMPIAFSVMFF 515

Query: 533 SFPAGLIIYWSWSNVISIVQQAVIMKMHG 561
            FPAGL++YW  +N +SI QQ  I +M G
Sbjct: 516 FFPAGLVLYWVVNNCLSIAQQWSINRMLG 544


>gi|145640676|ref|ZP_01796259.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae R3021]
 gi|145274602|gb|EDK14465.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae 22.4-21]
          Length = 541

 Score =  218 bits (556), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 125/376 (33%), Positives = 211/376 (56%), Gaps = 31/376 (8%)

Query: 186 VTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYSDIEKSSISN 244
           + N S   I   P G++     +++ N       G      + +  +  ++D++ +++S 
Sbjct: 182 IDNQSGQAIEVEPYGQLKHSIVESSGNVAMPTYTGGAYSSSETNYKKYSFADMQDNNLS- 240

Query: 245 FHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA-KFSANEITILPGKSIT 303
                 W+ +   Y+ S +IP+++   ++Q   ++D      +  +    +TI  G   T
Sbjct: 241 IGTKAGWVAVLQHYFVSAWIPNQDV--NNQLYTITDSKNNVASIGYRGPVVTIPSGSQET 298

Query: 304 TTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIA 363
            T+ L+ G    P + +    +A    ++ +D+GW +FIAKP+F L+++   +V N+G+A
Sbjct: 299 ITSSLWTG----PKLQNQMATVA-NNLDLTVDYGWAWFIAKPLFWLLTFIQGIVSNWGLA 353

Query: 364 IMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHN 423
           I+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++LYK   
Sbjct: 354 IICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGDD-RQRMSQEMMKLYKEEK 412

Query: 424 INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY 483
           +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A D           P+Y
Sbjct: 413 VNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQD-----------PYY 461

Query: 484 LPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPAGLIIYW 542
                   I PI+M +SMF+  KMSP P  D  Q  ++N+MP+VF+F    FP+GL++YW
Sbjct: 462 --------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLVFMFFFLWFPSGLVLYW 513

Query: 543 SWSNVISIVQQAVIMK 558
             SN+I+I QQ +I +
Sbjct: 514 LVSNLITIAQQQLIYR 529


>gi|187930818|ref|YP_001901305.1| putative inner membrane protein translocase component YidC
           [Ralstonia pickettii 12J]
 gi|309780186|ref|ZP_07674937.1| membrane protein insertase, YidC/Oxa1 family [Ralstonia sp.
           5_7_47FAA]
 gi|254773015|sp|B2U820|OXAA_RALPJ RecName: Full=Inner membrane protein oxaA
 gi|187727708|gb|ACD28873.1| 60 kDa inner membrane insertion protein [Ralstonia pickettii 12J]
 gi|308920889|gb|EFP66535.1| membrane protein insertase, YidC/Oxa1 family [Ralstonia sp.
           5_7_47FAA]
          Length = 554

 Score =  218 bits (556), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 122/338 (36%), Positives = 191/338 (56%), Gaps = 29/338 (8%)

Query: 225 GDKSLVEQKYSDIEKSSISNFHESNS-WLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
           GDK   +  ++DI+K        +NS W+ +   Y+AS +IP+           +     
Sbjct: 236 GDK-FHKITFADIDKGKAQVPAPTNSGWVAMVQHYFASAWIPADNVKREYYVNRVDTNF- 293

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
            Y+        T+ PG S++TT  LFAG ++   +     +   P  +++ D+GW   +A
Sbjct: 294 -YRIGIQEPLGTVAPGASVSTTARLFAGPQQARML-----EAITPGLDLVKDYGWLTIVA 347

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           KP+F L+   + L+GN+G +I+  TV +KL+FFPL+   Y S A MK++QP++  +RE+ 
Sbjct: 348 KPLFWLLEKIHALLGNWGWSIVALTVLIKLVFFPLSATSYRSMAKMKDLQPRMTAIRERH 407

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
           K   PQ + + M+ LY+T  +NPL GC PI++QIPVF A+Y  +  S+EMR AP+ GW+ 
Sbjct: 408 KGD-PQKMNQEMMTLYRTEKVNPLGGCLPIVIQIPVFMALYWALLSSVEMRGAPWIGWVH 466

Query: 464 DLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWM 523
           DL+  D           PFY        I P++M++SMF+Q K++P P D  QA ++ +M
Sbjct: 467 DLSTPD-----------PFY--------ILPVLMAVSMFVQTKLNPTPPDPVQAKVMMFM 507

Query: 524 PVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHG 561
           P+ F      FPAGL++YW  +N +SI QQ  I +M G
Sbjct: 508 PIAFSVMFFFFPAGLVLYWVVNNCLSIAQQWSINRMLG 545


>gi|51244707|ref|YP_064591.1| hypothetical protein DP0855 [Desulfotalea psychrophila LSv54]
 gi|50875744|emb|CAG35584.1| conserved hypothetical membrane protein [Desulfotalea psychrophila
           LSv54]
          Length = 553

 Score =  218 bits (556), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 167/569 (29%), Positives = 272/569 (47%), Gaps = 53/569 (9%)

Query: 8   FVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTV------KQPNQVDNSYAAVLIDDR 61
            +AI +S  I++ +Q  Y +P +++        QT       KQ   +    A V+    
Sbjct: 7   LLAIVISFAILFGYQ--YFFPGLDQPVQTTSETQTTVNGTSAKQAGAIQEITAPVIPVVA 64

Query: 62  AQALSMSPRVELKNPSL-IGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN-- 118
           +      PR  + +  L   +I+  G       L+      + +SP + L++ S T    
Sbjct: 65  SAKYDRVPRDIVVDTDLYTATISEAGGALKSFVLKEQKETNAEDSPGMQLVNNSKTDGYP 124

Query: 119 -------AYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERT 171
                  A  + L Y S  + +    SN    LI            +  K++  ++ ER 
Sbjct: 125 LTFSWGGAAPSNLLYTSQDSEVRF-GSNGKARLI------------MTAKSSTGLVIERV 171

Query: 172 ISLDEH-YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIA--VLGDKS 228
            + D+  YLF +   V N S   ++ S +   +    ++  +    +  F+   V  D  
Sbjct: 172 YTFDKKTYLFDLDVRVVNQSGQALQGSAQLHQVSVPYESTEDNPAARFLFMGPVVYADGE 231

Query: 229 LVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAK 288
           L E    D+E    S F     WLG   +Y+ S+ +P        Q  + + G A     
Sbjct: 232 LTEIDPKDLEDGPQS-FMGDIQWLGYESRYFMSMIVPY---GLDGQ-TFTTSGGADLTKS 286

Query: 289 FSANEI-TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMF 347
           F A  + T+  G        +  G K+   +     DL     +  +++GWF  IAKP  
Sbjct: 287 FIAGGLDTLAAGAEKEYKYHVLYGPKKVEMLKSAGYDL-----DKAVNFGWFDIIAKPTL 341

Query: 348 MLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSP 407
            L+++F++   N+GIAI+L T+  K +F+P+ +K   S  NM+ +QPK+  L+EK K  P
Sbjct: 342 WLLNFFHSFTHNYGIAIILVTIMFKGIFWPITQKGMKSMKNMQKLQPKMAALKEKHKDDP 401

Query: 408 PQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAA 467
            + + K ++ LYK + +NPL GC P++LQIPVFFA+YKV+ +S+E+RHAPF  WI DL+A
Sbjct: 402 TR-MNKEVMSLYKAYKVNPLGGCLPMVLQIPVFFALYKVLLLSIELRHAPFMFWITDLSA 460

Query: 468 ADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVF 527
            D   I        F LP    + +  ++M  SMF+Q K SP  AD  QA I+ ++PVVF
Sbjct: 461 PDRLWI-------GFNLPYLGGLPVLTLLMGASMFLQQKFSPTTADPTQAKIMMFLPVVF 513

Query: 528 VFALSSFPAGLIIYWSWSNVISIVQQAVI 556
            F   +F +GL++YW  +N++SI+QQ +I
Sbjct: 514 TFMFLNFASGLVLYWFVNNLLSILQQVLI 542


>gi|165976859|ref|YP_001652452.1| putative inner membrane protein translocase component YidC
           [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
 gi|254772741|sp|B0BR23|OXAA_ACTPJ RecName: Full=Inner membrane protein oxaA
 gi|165876960|gb|ABY70008.1| 60 kD inner-membrane protein [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
          Length = 542

 Score =  218 bits (556), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 126/398 (31%), Positives = 218/398 (54%), Gaps = 32/398 (8%)

Query: 164 NNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFI 221
           + +L+ +T  L    Y   +   V N +   +   P G+I     +++ + T     G  
Sbjct: 162 DGVLYTKTFVLKRGSYDVAVNFNVKNQTAATVEVQPYGQIKYTLLESSGSLTMPTYTGGA 221

Query: 222 AVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDG 281
               + +  +  + D+EK+++ + +    W+ +   Y+ S ++P+++   ++ +   ++G
Sbjct: 222 YSSAETNYKKYSFQDMEKANL-DINTKAGWVALLQHYFVSAWVPNQDAE-NTIYSRTNNG 279

Query: 282 HARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYF 341
            A     +     TI P    T T+ L+ G K+       E +      ++ +D+GW +F
Sbjct: 280 IATI--GYRGPVTTIAPNSEATITSQLWTGPKD-----QKEMEATAANLDLTVDYGWAWF 332

Query: 342 IAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELRE 401
           IAKP+F L+++  ++V N+G+AI+  T+ VK + +PL K QY S A M+ +QPKI E+RE
Sbjct: 333 IAKPLFALLTFIQSIVTNWGLAIIGVTIVVKTILYPLTKAQYTSMARMRMLQPKIQEMRE 392

Query: 402 KFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGW 461
           +F     Q + + M++LYK   +NP+ GC PIL+Q+P+F A+Y     ++E+RHAPF+GW
Sbjct: 393 RFGDD-RQRMSQEMMKLYKEEKVNPMGGCLPILIQMPIFIALYWTFMEAVELRHAPFFGW 451

Query: 462 IKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMIL 520
           I+DL+A D           P+Y        I P++M  SMF+  KMSP P  D  Q  ++
Sbjct: 452 IQDLSAQD-----------PYY--------ILPLLMGASMFLLQKMSPSPVTDPVQQKVM 492

Query: 521 NWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
            +MPV+F      FP+GL++YW  SN+I+IVQQ +I +
Sbjct: 493 TFMPVMFTVFFLWFPSGLVLYWLTSNIITIVQQWLIYR 530


>gi|68249585|ref|YP_248697.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae 86-028NP]
 gi|229843940|ref|ZP_04464081.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae 6P18H1]
 gi|81335986|sp|Q4QLR0|OXAA_HAEI8 RecName: Full=Inner membrane protein oxaA
 gi|68057784|gb|AAX88037.1| preprotein translocase subunit YidC [Haemophilus influenzae
           86-028NP]
 gi|229812934|gb|EEP48622.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae 6P18H1]
          Length = 541

 Score =  218 bits (556), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 118/327 (36%), Positives = 195/327 (59%), Gaps = 30/327 (9%)

Query: 234 YSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA-KFSAN 292
           ++D++ +++S       W+ +   Y+ S +IP+++   ++Q   ++D      +  +   
Sbjct: 231 FADMQDNNLS-IDTKAGWVAVLQHYFVSAWIPNQDV--NNQLYTITDSKNNVASIGYRGP 287

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
            +TI  G   T T+ L+ G    P + +    +A    ++ +D+GW +FIAKP+F L+++
Sbjct: 288 VVTIPAGSQETITSSLWTG----PKLQNQMATVA-NNLDLTVDYGWAWFIAKPLFWLLTF 342

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
              +V N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + 
Sbjct: 343 IQGIVSNWGLAIICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGDD-RQRMS 401

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           + M++LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A D   
Sbjct: 402 QEMMKLYKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQD--- 458

Query: 473 IFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFAL 531
                   P+Y        I PI+M +SMF+  KMSP P  D  Q  ++N+MP+VF+F  
Sbjct: 459 --------PYY--------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLVFMFFF 502

Query: 532 SSFPAGLIIYWSWSNVISIVQQAVIMK 558
             FP+GL++YW  SN+I+I QQ +I +
Sbjct: 503 LWFPSGLVLYWLVSNLITIAQQQLIYR 529


>gi|307261914|ref|ZP_07543574.1| Inner membrane protein oxaA [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|306868385|gb|EFN00202.1| Inner membrane protein oxaA [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
          Length = 533

 Score =  218 bits (555), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 126/398 (31%), Positives = 218/398 (54%), Gaps = 32/398 (8%)

Query: 164 NNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFI 221
           + +L+ +T  L    Y   +   V N +   +   P G+I     +++ + T     G  
Sbjct: 153 DGVLYTKTFVLKRGSYDVAVNFNVKNQTAATVEVQPYGQIKYTLLESSGSLTMPTYTGGA 212

Query: 222 AVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDG 281
               + +  +  + D+EK+++ + +    W+ +   Y+ S ++P+++   ++ +   ++G
Sbjct: 213 YSSAETNYKKYSFQDMEKANL-DINTKAGWVALLQHYFVSAWVPNQDAE-NTIYSRTNNG 270

Query: 282 HARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYF 341
            A     +     TI P    T T+ L+ G K+       E +      ++ +D+GW +F
Sbjct: 271 IATI--GYRGPVTTIAPNSEATITSQLWTGPKD-----QKEMEATAANLDLTVDYGWAWF 323

Query: 342 IAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELRE 401
           IAKP+F L+++  ++V N+G+AI+  T+ VK + +PL K QY S A M+ +QPKI E+RE
Sbjct: 324 IAKPLFALLTFIQSIVTNWGLAIIGVTIVVKTILYPLTKAQYTSMARMRMLQPKIQEMRE 383

Query: 402 KFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGW 461
           +F     Q + + M++LYK   +NP+ GC PIL+Q+P+F A+Y     ++E+RHAPF+GW
Sbjct: 384 RFGDD-RQRMSQEMMKLYKEEKVNPMGGCLPILIQMPIFIALYWTFMEAVELRHAPFFGW 442

Query: 462 IKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMIL 520
           I+DL+A D           P+Y        I P++M  SMF+  KMSP P  D  Q  ++
Sbjct: 443 IQDLSAQD-----------PYY--------ILPLLMGASMFLLQKMSPSPVTDPVQQKVM 483

Query: 521 NWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
            +MPV+F      FP+GL++YW  SN+I+IVQQ +I +
Sbjct: 484 TFMPVMFTVFFLWFPSGLVLYWLTSNIITIVQQWLIYR 521


>gi|328675234|gb|AEB27909.1| OxaI/YidC membrane insertion protein [Francisella cf. novicida
           3523]
          Length = 551

 Score =  218 bits (555), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 125/339 (36%), Positives = 199/339 (58%), Gaps = 34/339 (10%)

Query: 228 SLVEQKYSDIEKS----SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
           S  ++ + DI K+    ++ N  +   W+     Y+ S +IP + T+    +K L +G  
Sbjct: 239 SFRKESFKDISKTNGQPTVIN-SDGQGWVAFLQHYFVSAWIP-QSTNAKIYYKNL-NGDV 295

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
                F+   +TI P +S   ++ L+ G    P I     DLA P  E  +D+G   F +
Sbjct: 296 FEAGAFTG--VTIAPNQSENISSILYTG----PIIKANLVDLA-PNLEKTLDYGMLSFFS 348

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           + +F +M++ ++LVGN+G+AI+L T  +KL+F+PL+ K Y S A M+ +QP+I  L+E +
Sbjct: 349 EIIFWVMNHIHSLVGNWGLAIILVTCLIKLIFYPLSAKSYRSMAKMRMLQPRIKRLQETY 408

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
           K    Q L K M++LYK   +NPL+GC P+L+QIP+F ++Y V+  S+E+R APF  WI 
Sbjct: 409 KDDR-QALGKKMMELYKEEKVNPLSGCLPMLIQIPIFISLYWVLLESVELRQAPFIFWIH 467

Query: 464 DLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWM 523
           DL+  DP            Y        + P++M LSMF+Q K+SP PAD  QA ++ ++
Sbjct: 468 DLSMKDP------------YF-------VLPVLMGLSMFLQQKLSPAPADPMQAKVMMFL 508

Query: 524 PVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           PV+F F  +SFP+GL++YW  +N+ISI QQ +I + + A
Sbjct: 509 PVIFTFLFASFPSGLVLYWLTNNLISISQQWIITRHYQA 547


>gi|183597176|ref|ZP_02958669.1| hypothetical protein PROSTU_00419 [Providencia stuartii ATCC 25827]
 gi|188023490|gb|EDU61530.1| hypothetical protein PROSTU_00419 [Providencia stuartii ATCC 25827]
          Length = 549

 Score =  218 bits (555), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 155/573 (27%), Positives = 285/573 (49%), Gaps = 59/573 (10%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
           +RN      + +S ++  AW++       ++   + K +QT +Q +   +   AV    +
Sbjct: 4   QRNLLLIALLFVSFLVWQAWES-------DKAAQDLKTVQTTQQTDMPSSDSQAVTSSGQ 56

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
            + ++      +K   L   IN +G   D+ +L  Y   + S SP   L +  +    Y 
Sbjct: 57  GKLIT------VKTDVLDLRINTRGGDIDEADLLAYPATLHSESPFRLLETTPDF--IYQ 108

Query: 122 AELDYVSTANNIELPNSNT---VWNLISGKILTPTTP----IKLVFKNANNILFERTISL 174
           A+   +         NSN    V+++ S   +         + + F + N +++++T  L
Sbjct: 109 AQSGLIGQHGPDNPDNSNGQRPVYSVESSSFILADGQDELRVPMTFTDKNGVVYQKTYVL 168

Query: 175 DE-HYLFKIVDTVTNNSIDQIRFSPRGRIMR-----HKPQTATNTFGVQEGFIAVLGDKS 228
              HY   +   + N +   +  +  G++ +      +  T ++ F +     A      
Sbjct: 169 KRGHYNVDVEYNIQNPTAQALNLAFFGQLKQTIQLPKERDTGSSNFALHTYRGAAYSSDE 228

Query: 229 LVEQKYS--DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQ 286
              +KYS  DIE   + N      W+ +  +Y+A+ ++P+  ++ +S F  +  G     
Sbjct: 229 SNYKKYSFSDIEDKKL-NVTTKGGWVAMLQQYFATAWVPA--SNENSTFYTIDLGQKEAI 285

Query: 287 AKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPM 346
             + +  +TI    + T ++ L+ G    P I     ++A P  ++ +D+GW +FI++P+
Sbjct: 286 IGYKSQPLTIAANGAGTYSSTLWVG----PEIQSEMAEVA-PHLDLTVDYGWLWFISQPL 340

Query: 347 FMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQS 406
           F L+ + +  VGN+GIAI++ T  V+ + +PL K QY S A M+ +QPK+  +RE+    
Sbjct: 341 FKLLKFIHGFVGNWGIAIIIITFIVRGIMYPLTKAQYTSMAKMRLLQPKLAAMRERIGDD 400

Query: 407 PPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLA 466
             Q + + M+ LYK   +NPL GC P+L+Q+P+F A+Y ++  S+E+RHAPF+GWI+DL+
Sbjct: 401 -KQRMSQEMMALYKAEKVNPLGGCLPLLIQMPIFLALYYMLMGSVELRHAPFFGWIQDLS 459

Query: 467 AADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPV 525
           A D           P+Y        I P++M ++MF+  KMSP    D  Q  I+ +MPV
Sbjct: 460 AQD-----------PYY--------ILPVLMGVTMFVIQKMSPTAVTDPMQQKIMTYMPV 500

Query: 526 VFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           VF      FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 501 VFTIFFLWFPSGLVLYYIVSNLVTIIQQQIIYR 533


>gi|217970730|ref|YP_002355964.1| hypothetical protein Tmz1t_2331 [Thauera sp. MZ1T]
 gi|217508057|gb|ACK55068.1| 60 kDa inner membrane insertion protein [Thauera sp. MZ1T]
          Length = 552

 Score =  218 bits (554), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 151/507 (29%), Positives = 245/507 (48%), Gaps = 55/507 (10%)

Query: 69  PRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVS 128
           PR  ++   L   ++ +G     L L+ +     +    V LL    T++ Y A+   + 
Sbjct: 74  PRAVVETDLLRAEVSAQGGDIVRLELKQHKASGEAGGNFV-LLDDGTTRHQYAAQSGLIG 132

Query: 129 TANNIELPNSNTVWNLISGKILTP----TTPIKLVFKNANNILFERTISLDE-HYLFKIV 183
                 LP   T++ L +G++          ++L     N +   + +      YL  + 
Sbjct: 133 EG----LPTHKTLFQLPAGELRLKDGENGVELRLQAPEQNGVQVTKVMRFARGSYLIDVS 188

Query: 184 DTVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQE--GFIAVLGDKSLVEQKYSDIEKS 240
             + N S   +      ++ R   P      FGV    G           + +++DI   
Sbjct: 189 YEIRNGSGQALAPHAYFQLTRDGNPAEQVEAFGVTTFTGPAFYTDANKFQKVQFADITDG 248

Query: 241 SISNFHES--NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILP 298
             + F ++  + W+ +   Y+   ++P        Q +Y +   A     FSA    ILP
Sbjct: 249 D-AKFPKTAADGWVAMVQHYFVGAWLPKA----GEQREYFA--RALGNNLFSAG--VILP 299

Query: 299 GKSITT------TNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
             SI T      +  L+AG +E   +         P  ++++D+GW   IA P+F ++S+
Sbjct: 300 VASIATGAEGAVSTRLYAGPQEQDKLEGIA-----PGLDLVVDYGWLTVIAAPLFWVLSW 354

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
           F+NL GN+G AI+L TV +K +FFPL+   Y S A M+ + P++  ++E +     + +Q
Sbjct: 355 FHNLTGNWGWAIILVTVAIKAIFFPLSAASYKSMAKMRVLGPRLQRMKEMYGNDKAK-MQ 413

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           + M+ LY+T  INPL GC PIL+QIPVF A+Y V+  S+EMRHAP+ GWI+DL+A DP  
Sbjct: 414 QEMMNLYRTEKINPLGGCLPILVQIPVFIALYWVLLGSVEMRHAPWLGWIQDLSAKDPYF 473

Query: 473 IFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALS 532
           I                    PIIM +SM +QMK++P P D  QA ++  MP++F F   
Sbjct: 474 IL-------------------PIIMGVSMLVQMKLNPTPPDPIQAKVMMAMPIIFTFMFL 514

Query: 533 SFPAGLIIYWSWSNVISIVQQAVIMKM 559
            FP+GL++YW  +N +SI QQ  I +M
Sbjct: 515 WFPSGLVLYWVVNNCLSIAQQWQITRM 541


>gi|119947213|ref|YP_944893.1| 60 kDa inner membrane insertion protein [Psychromonas ingrahamii
           37]
 gi|166977402|sp|A1T0M9|OXAA_PSYIN RecName: Full=Inner membrane protein oxaA
 gi|119865817|gb|ABM05294.1| protein translocase subunit yidC [Psychromonas ingrahamii 37]
          Length = 566

 Score =  218 bits (554), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 166/527 (31%), Positives = 252/527 (47%), Gaps = 54/527 (10%)

Query: 47  NQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSP 106
           + V NS      D  +  L  S  V + N  L  +I+L G      +L  +   + S++P
Sbjct: 59  DGVPNSPQQSSTDATSTELPASQSVTIANDELRLTISLVGGDIIKADLLQHDATLDSDTP 118

Query: 107 IVTLLSPSNTKNAYFAELDYVST---ANNIELP---NSNTVWNLISGKILTPTTPIKLVF 160
              L   S     Y A+   +     AN    P    ++T   L  G+    T    L F
Sbjct: 119 YRLL--DSGNGFTYIAQSGLIGQGPDANKNGRPLYDTTDTESVLADGQAEVSTM---LHF 173

Query: 161 KNANNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEG 219
            +A+  +F +T +L    Y+  +   + N +   +      ++     +T ++  G    
Sbjct: 174 VDADGNIFIKTFTLKRGEYVTNVAYQIENKTDSPLNVQLYAQLR----ETLSDDSGSMVM 229

Query: 220 FIAVLGDKSLVEQKYSDIEKSSISNFHES-------NSWLGISDKYWASVFIPSKETSFH 272
            +   G  S  E +Y   EK S S+  +          W+ +   Y+ S +IPS      
Sbjct: 230 PVYRGGAFSTTETRY---EKYSFSDMQDGPLQKTTEGGWVAMLQHYFVSAWIPSPTDQNV 286

Query: 273 SQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEM 332
                + D  A     F A   TI P         L+ G    P I   E  L     ++
Sbjct: 287 LYSNIIQDKEAAI--GFKAPSKTIAPQSVAELETNLWVG----PKIQE-EMALVAKNLDL 339

Query: 333 LIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNI 392
            +D+GW +FIA+P+F L+ +F  +VGN+G+AI+L T  VK   +PL K QY S A M+ +
Sbjct: 340 TVDYGWLWFIAQPLFKLLLFFQGIVGNWGVAIILITFTVKGALYPLTKAQYTSMAKMRLL 399

Query: 393 QPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLE 452
           QPKI ELRE+F +   Q + KAM++LYK   +NPL GC+PILLQ+P+F A+Y  +  S+E
Sbjct: 400 QPKIKELREQFGED-RQKVSKAMMELYKKEKVNPLGGCFPILLQMPIFIALYWSLMESVE 458

Query: 453 MRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPA 512
           +RHAPF  WI+DL+  D           P+Y        I PI+M +SMF   KMSP   
Sbjct: 459 LRHAPFMLWIQDLSVQD-----------PYY--------ILPILMGVSMFFIQKMSPTTV 499

Query: 513 -DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
            D  Q  ++ +MPV+F F    FPAGL++YW  SNV++++QQ +I +
Sbjct: 500 QDPMQQKVMQFMPVIFTFFFLWFPAGLVLYWLMSNVVTLIQQTLIYR 546


>gi|242241427|ref|YP_002989608.1| inner membrane protein translocase component YidC [Dickeya dadantii
           Ech703]
 gi|242133484|gb|ACS87786.1| 60 kDa inner membrane insertion protein [Dickeya dadantii Ech703]
          Length = 543

 Score =  218 bits (554), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 146/503 (29%), Positives = 246/503 (48%), Gaps = 47/503 (9%)

Query: 71  VELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTA 130
           + +K   L  +IN +G   ++ +L  Y  D+ S  P   L     T  A+  +     T 
Sbjct: 60  ITVKTDVLSLTINTRGGDIEEADLLAYPADLGSKQPFKLL----ETTQAFTYQAQSGLTG 115

Query: 131 NNIELPNSNTVWNLISG-----KILTPTTPIK--LVFKNANNILFERTISLDE-HYLFKI 182
            N     +N    L S      ++      I+  L + +AN I + +T +L    Y   +
Sbjct: 116 KNGPDNPANGSRPLFSATQDHFELADGQNDIRIPLTYTDANGISYTKTFALKRGEYALNV 175

Query: 183 VDTVTNNSIDQIRFSPRGRIMR------HKPQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
              V N S   +  +  G++ +      H+  T +N F +     A L       +KYS 
Sbjct: 176 EYGVNNTSAQPLELTLFGQLKQSIDLPSHR-DTGSNNFALHTYRGAALSSSDDKYRKYSF 234

Query: 237 IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITI 296
            +     N      W+ +  +Y+AS +IP+   +  + F   + G+      F A  + +
Sbjct: 235 SDMKENLNVATQGGWVAMLQQYFASAWIPAAGGA--NTFYTSNLGNGLAAIGFKATPVIV 292

Query: 297 LPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNL 356
            PG   T    L+ G    P I      +A P  ++ +D+GW +FI++P+F L+ + ++ 
Sbjct: 293 QPGSQQTLGATLWVG----PEIQDKMAAVA-PHLDLTVDYGWLWFISQPLFKLLKFLHSF 347

Query: 357 VGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMI 416
           +GN+G +I+  T  V+ + +PL K QY S A M+ +QPK+  +RE+      Q + + M+
Sbjct: 348 IGNWGFSIIAITFIVRGIMYPLTKAQYTSMAKMRMLQPKLQAMRERIGDD-KQRMSQEMM 406

Query: 417 QLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTL 476
            LYK   +NPL GC+P+++Q+P+F A+Y ++  S+E+RHAPF  WI DL+A D       
Sbjct: 407 ALYKAEKVNPLGGCFPLVIQMPIFLALYYMLMGSVELRHAPFALWIHDLSAQD------- 459

Query: 477 FGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFP 535
               P+Y        + PI+M L+MF   KMSP    D  Q  I+ +MPV+F      FP
Sbjct: 460 ----PYY--------VLPILMGLTMFFIQKMSPTTVTDPMQQKIMTYMPVMFTVFFLWFP 507

Query: 536 AGLIIYWSWSNVISIVQQAVIMK 558
           +GL++Y+  SN+++IVQQ +I +
Sbjct: 508 SGLVLYYIVSNLVTIVQQQLIYR 530


>gi|254282101|ref|ZP_04957069.1| inner membrane protein, 60 kDa [gamma proteobacterium NOR51-B]
 gi|219678304|gb|EED34653.1| inner membrane protein, 60 kDa [gamma proteobacterium NOR51-B]
          Length = 572

 Score =  217 bits (553), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 145/500 (29%), Positives = 249/500 (49%), Gaps = 45/500 (9%)

Query: 71  VELKNPSLIGSINLKGAQFDDLNLRGYHLDVSS-NSPIVTLLSPSNTKNAYFAELDYVST 129
           + +K  +L   I+L G    ++ L  +   +   N P   +L   N +  Y A+   V +
Sbjct: 97  IAVKTETLELVIDLNGGDIIEVALPRFPEQIDDPNQPF--MLLEQNDRRTYIAQSGLVGS 154

Query: 130 ANNIELPNSNTVWNLISGKILTPTTPIKLVFK---NANNILFERTISLD-EHYLFKIVDT 185
            + I+ P      +  S    TP  P+ +      N++ +   +  +LD E Y+  +  +
Sbjct: 155 -DGIDHPQRAHYVSAQSEYTATPGQPLSIELAWAGNSSELAITKRFTLDPESYVVDVEYS 213

Query: 186 VTNNSIDQIRFSPRGRIMRHK---PQTATNTFGVQEGFIAVLG--DKSLVEQKYSDIEKS 240
           VTNN   + +  P  ++ R     P   T+  G++    A L   D    +  + DI   
Sbjct: 214 VTNNRGSRWQAVPFAQLKRDNTPPPNADTSGLGMKPFLGAALTQPDDRFTKFDFGDIADE 273

Query: 241 SISNFHES--NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILP 298
               F ++    W+ +   Y+ S +I +   S +   +  + G       F++  + +  
Sbjct: 274 P---FRKTLPGGWIALMQHYFVSAWIANPNQSHNYSTRQTTSGFNI--VGFTSPALAVDS 328

Query: 299 GKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVG 358
           G + +    L+ G K+      Y+        ++ +D+GW ++IA+P+F L++   ++VG
Sbjct: 329 GNTGSAGYRLYVGPKD-----QYQLAELSDHLDLTVDYGWLWWIAQPLFWLLTKIQSVVG 383

Query: 359 NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQL 418
           N+G+AI+L TV VK  FF L+   Y S A M+ +QPK+ ++RE++     +  Q  M++L
Sbjct: 384 NWGVAIILLTVLVKGAFFKLSATSYRSMARMRKLQPKMVDIREQYADDKSKQSQ-MMMEL 442

Query: 419 YKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFG 478
           Y+   +NP+ GC PIL+Q+PVF A+Y V+  S+E+RHAPF  WIKDL+  DP  +     
Sbjct: 443 YRKEKVNPMGGCLPILIQMPVFIALYWVLMESVELRHAPFVLWIKDLSVMDPYFVL---- 498

Query: 479 ILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGL 538
                          P++M  SMF   K++PPP D  QA I+ W+PV+F F    FPAGL
Sbjct: 499 ---------------PLMMGASMFFMQKLNPPPPDPMQAKIMQWLPVIFTFFFLWFPAGL 543

Query: 539 IIYWSWSNVISIVQQAVIMK 558
           ++YW  +N++S+ QQ VI +
Sbjct: 544 VLYWVVNNLLSMTQQYVITR 563


>gi|92115431|ref|YP_575359.1| putative inner membrane protein translocase component YidC
           [Chromohalobacter salexigens DSM 3043]
 gi|91798521|gb|ABE60660.1| protein translocase subunit yidC [Chromohalobacter salexigens DSM
           3043]
          Length = 575

 Score =  217 bits (553), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 126/352 (35%), Positives = 192/352 (54%), Gaps = 37/352 (10%)

Query: 215 GVQEGFIAVLGDK-SLVEQKYS-----DIEKSSISNFHESNSWLGISDKYWASVFIP--S 266
           GV  G  + LG   S  E  Y      DI     +N      W+ +   Y+ S ++P  +
Sbjct: 237 GVSMGMKSFLGATFSTQESNYEKISFEDIRDGEFNNVESEGGWVAMIQHYFTSAWVPEQN 296

Query: 267 KETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLA 326
           +E  +++      D   R  A F+     I PG++      L+ G    P I    + +A
Sbjct: 297 QENLYYANI----DSRDRNVAAFAGPSQQIAPGETTRMAATLYMG----PKIQDRLEAIA 348

Query: 327 IPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVST 386
            P  E+ +D+GW +FIA P+F L++  ++L+GN+G +I+L TV VK++ FPL+ K Y S 
Sbjct: 349 -PHLELTVDFGWLWFIANPLFWLLAKIHSLIGNWGWSIVLLTVIVKIVLFPLSAKAYKSM 407

Query: 387 ANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKV 446
           A M+ + P++  ++E++     Q + + M++ Y+   INPL GC PI++Q+PVF A+Y +
Sbjct: 408 AKMRKMGPEMKRIKEQYGDD-RQKMSQEMMKFYQKEKINPLGGCLPIVVQMPVFIALYWM 466

Query: 447 ISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMK 506
           +  S+E+RHAPF  WI DL+A DP  I                    PIIM  SMF+Q  
Sbjct: 467 LLESVELRHAPFILWINDLSAQDPYFIL-------------------PIIMGASMFVQQL 507

Query: 507 MSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           ++P P D  QA I+  +PVVF F    FPAGL+IYW  +NVISI+QQ +I +
Sbjct: 508 LNPTPPDPMQAKIMKMLPVVFTFFFLWFPAGLVIYWICNNVISILQQWIITR 559


>gi|163859332|ref|YP_001633630.1| putative inner membrane protein translocase component YidC
           [Bordetella petrii DSM 12804]
 gi|254772752|sp|A9IJB7|OXAA_BORPD RecName: Full=Inner membrane protein oxaA
 gi|163263060|emb|CAP45363.1| yidC [Bordetella petrii]
          Length = 563

 Score =  217 bits (553), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 150/486 (30%), Positives = 246/486 (50%), Gaps = 40/486 (8%)

Query: 81  SINLKGAQFDDLNLRGYHLDVSSNSPIVTL-LSPSNTKNAYFAELDYVSTANNIELPNSN 139
           + +  GAQ     L  Y      N P V L  SP  T   Y  +   V   N    PN  
Sbjct: 98  TFDTTGAQLIRAELLKYPTSGQPNKPTVLLDRSPELT---YVVQSGLVGAPNGQSFPNHQ 154

Query: 140 TVWNLISGKILTPTTPIKLVFK-NANNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFS 197
           T + L+S         +++VF+ ++  +   +T +L    Y   +  ++ N S   +  S
Sbjct: 155 TPFRLVSTDHELKGDSLQVVFEADSGGLKVTKTYTLHRGRYDIDVQHSLANTSDAPLAPS 214

Query: 198 PRGRIMRHKPQTA-TNTFGVQEGFIAVLGDKSLVEQ-KYSDIEKSSISNFHES-NSWLGI 254
              ++ R     A T++F      +AV  ++   ++  +SDI K   S   ++ N WL +
Sbjct: 215 LYLQLERDGNDPADTSSFYHTFTGVAVYSEQDKFQKITFSDIAKGKGSYIKQADNGWLAV 274

Query: 255 SDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKE 314
              Y+A+ ++P +     ++   L      Y A+      T+ PG +    + L+ G ++
Sbjct: 275 VQHYFATAWVPPQGKQRTNEL--LQVQPNLYAARSIEAVGTVQPGATAQVDSRLWVGPQD 332

Query: 315 FPTIHHYEKDLAI--PRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVK 372
                  +K +A   P  E+++D+GW   IAKP+F L+++ ++L+GN+G AI+  TV +K
Sbjct: 333 -------QKAMAAVAPGLELVVDYGWLTIIAKPLFSLLTWLHSLLGNWGWAIVALTVIIK 385

Query: 373 LLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWP 432
            +FFPLA   Y S A MK + P++  L+EK+     Q L +AM+++Y+T  INPL GC P
Sbjct: 386 AVFFPLAAASYRSMARMKQVAPRLQALKEKYGDD-RQKLNQAMMEMYRTEKINPLGGCLP 444

Query: 433 ILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGI 492
           +++QIPVF A+Y V+  S+EMR AP+  W+ DL+  DP  I                   
Sbjct: 445 MVVQIPVFIALYWVLLASVEMRGAPWILWVHDLSVRDPYFIL------------------ 486

Query: 493 WPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQ 552
            P +M  +MF+Q+K++P P D  QA ++  MP+VF   +  FPAGL++YW  +N +SI Q
Sbjct: 487 -PAVMMATMFLQIKLNPTPPDPIQAKVMMIMPLVFGGMMFFFPAGLVLYWCVNNTLSIAQ 545

Query: 553 QAVIMK 558
           Q  I +
Sbjct: 546 QWTITR 551


>gi|73543142|ref|YP_297662.1| putative inner membrane protein translocase component YidC
           [Ralstonia eutropha JMP134]
 gi|123623711|sp|Q46VL6|OXAA_RALEJ RecName: Full=Inner membrane protein oxaA
 gi|72120555|gb|AAZ62818.1| protein translocase subunit yidC [Ralstonia eutropha JMP134]
          Length = 555

 Score =  217 bits (553), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 156/489 (31%), Positives = 237/489 (48%), Gaps = 44/489 (8%)

Query: 80  GSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSN 139
             I+  G     L L   H       P+V  L   +T   Y A    +      +LPN  
Sbjct: 94  AEIDTAGGILSRLELLNEH--EKDGKPVV--LFERDTTRTYMARSGLIGG----DLPNHT 145

Query: 140 TVWNLISG-KILTPTTPIKLVF-KNANNILFERTISLDE-HYLFKIVDTVTNNSIDQIRF 196
           TV+    G + L     +++    + N + F +T    +  Y+      VTN+    +  
Sbjct: 146 TVFTATPGPRTLDGADKLEVTLTADKNGVKFVKTYVFHKGSYVVDARFAVTNDGTAPVSP 205

Query: 197 SPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ-KYSDIEKSSISNFHESNS-WLGI 254
           +    + R   +   + F       A+  D     +  + DI K   S    + S W+ +
Sbjct: 206 TLYMELARDGSKVEQSQFYSTFTGPAIYTDADKYHKITFDDIAKGKASTPAATTSGWVAM 265

Query: 255 SDKYWASVFIP--SKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGA 312
              Y+AS +IP   KE SF+ Q          Y+         I PG ++TT   LFAG 
Sbjct: 266 VQHYFASAWIPQAGKEHSFYVQ----QIDPNLYRVGIQQPLGQIAPGATVTTDARLFAGP 321

Query: 313 KEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVK 372
           +E   +         P  E++ D+GW   +AKP+F L+   +  + N+G +I+  TV +K
Sbjct: 322 QEERMLEKI-----TPGLELVKDYGWLTILAKPLFWLLEKLHGFLNNWGWSIIALTVLIK 376

Query: 373 LLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWP 432
           L+FFPL+   Y S   MK++QP++  +RE+ K  P Q +   M+ LYKT  +NPL GC P
Sbjct: 377 LVFFPLSAASYKSMGKMKDLQPRMTSIRERHKGDP-QKMNAEMMALYKTEKVNPLGGCLP 435

Query: 433 ILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGI 492
           I++QIPVF A+Y V+  S+EMR AP+ GWI DL+  D           PFY        I
Sbjct: 436 IVIQIPVFIALYWVLLSSVEMRGAPWLGWIHDLSVPD-----------PFY--------I 476

Query: 493 WPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQ 552
            PI+M++SMF+Q +++P P D  QA ++  MP+VF F    FPAGL++YW  +N++SI Q
Sbjct: 477 LPIVMAVSMFVQTRLNPTPPDPVQAKVMMIMPLVFSFMFFFFPAGLVLYWVVNNILSIAQ 536

Query: 553 QAVIMKMHG 561
           Q  I +M G
Sbjct: 537 QWQINRMLG 545


>gi|303247340|ref|ZP_07333613.1| membrane protein insertase, YidC/Oxa1 family [Desulfovibrio
           fructosovorans JJ]
 gi|302491254|gb|EFL51143.1| membrane protein insertase, YidC/Oxa1 family [Desulfovibrio
           fructosovorans JJ]
          Length = 537

 Score =  217 bits (553), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 150/497 (30%), Positives = 241/497 (48%), Gaps = 55/497 (11%)

Query: 71  VELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSP-SNTKNAYFAELDYVST 129
           + +  P      N  G      +L+ Y   ++++SP+V L++  ++ K      L+   T
Sbjct: 73  LTVDTPLYTAVFNSTGGLLSRFSLKQYRQTIAADSPLVDLINEKAHAKAPLGLILNGTPT 132

Query: 130 ANNIELPNSNTVWNLISGKIL---TPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTV 186
             N+E       W++  G +    + T  +  V +  + I+         +YL     ++
Sbjct: 133 WQNVE-------WSVQGGDVTLDASGTASVTFVGRMGDTIIKRVLTFSGSNYLIDEKLSL 185

Query: 187 TNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFH 246
           +N   +  R      +   +     +++   +   A   D S +E  +S+ + +      
Sbjct: 186 SNTGANPARERLSMTVAVDRLSAEGDSYNPTQ---AAFYDTSGLELFHSEKKLAEGIADE 242

Query: 247 ESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTN 306
           +   W  I   Y+    IP   T    + K + DG  R        EI     + +T + 
Sbjct: 243 KPVEWGAIMSNYFLVGVIPDT-TDLRGKAK-IEDGLFRLAVDKDGLEIPAGGRQDLTISY 300

Query: 307 FLFAGAKEFPTI--HHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAI 364
           +L   A +F  +  HH             ID+GWF FIAKP+  L+ +FYN VGN+G+AI
Sbjct: 301 YLGPKAPKFLAMAPHH---------LSAAIDYGWFDFIAKPLVKLLHFFYNYVGNYGVAI 351

Query: 365 MLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNI 424
           +L TV +K +F+PL+ K Y S   MK +QP + +LREK+K    Q + + M+QLYKT+ +
Sbjct: 352 ILLTVLIKAIFWPLSHKSYKSMEQMKKLQPLLSQLREKYKDD-RQKMNEEMMQLYKTYKV 410

Query: 425 NPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG--------WIKDLAAADPTNIFTL 476
           NP  GC P+++QIPVFF +Y+ +  S+E+RHA F          W+ DL+A D       
Sbjct: 411 NPAGGCLPMVVQIPVFFGLYQALLHSIELRHAAFITYFPFTHHIWLADLSAKD------- 463

Query: 477 FGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPA 536
               P+Y        I P+IM  +MF+Q KM+P P D  QA I+  MPV+F F   +FP+
Sbjct: 464 ----PYY--------ITPLIMGATMFLQQKMTPAPGDPTQAKIMLLMPVIFTFMFLNFPS 511

Query: 537 GLIIYWSWSNVISIVQQ 553
           GL++YW  +NVISI QQ
Sbjct: 512 GLVVYWLVNNVISIAQQ 528


>gi|254372056|ref|ZP_04987549.1| hypothetical protein FTCG_01195 [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|151569787|gb|EDN35441.1| hypothetical protein FTCG_01195 [Francisella novicida GA99-3549]
 gi|328676141|gb|AEB27011.1| OxaI/YidC membrane insertion protein [Francisella cf. novicida Fx1]
          Length = 551

 Score =  217 bits (553), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 125/339 (36%), Positives = 199/339 (58%), Gaps = 34/339 (10%)

Query: 228 SLVEQKYSDIEKS----SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
           S  ++ + DI K+    ++ N  +   W+     Y+ S +IP + T+    +K L +G+ 
Sbjct: 239 SFRKESFKDISKTNGQPTVIN-SDGQGWVAFLQHYFVSAWIP-QSTNAKIYYKNL-NGNV 295

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
                F+    TI P +S   ++ L+ G    P I     DLA P  E  +D+G   F +
Sbjct: 296 FEAGAFTG--ATIAPNQSENISSILYTG----PIIKANLVDLA-PNLEKTLDYGMLSFFS 348

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           + +F +M++ ++LVGN+G+AI+L T  +KL+F+PL+ K Y S A M+ +QP+I  L+E +
Sbjct: 349 EIIFWVMNHIHSLVGNWGLAIILVTCLIKLIFYPLSAKSYRSMAKMRMLQPRIKRLQETY 408

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
           K    Q L K M++LYK   +NPL+GC P+L+QIP+F ++Y V+  S+E+R APF  WI 
Sbjct: 409 KDDR-QALGKKMMELYKEEKVNPLSGCLPMLIQIPIFISLYWVLLESVELRQAPFIFWIH 467

Query: 464 DLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWM 523
           DL+  DP            Y        + P++M LSMF+Q K+SP PAD  QA ++ ++
Sbjct: 468 DLSMKDP------------YF-------VLPVLMGLSMFLQQKLSPAPADPMQAKVMMFL 508

Query: 524 PVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           PV+F F  +SFP+GL++YW  +N+ISI QQ +I + + A
Sbjct: 509 PVIFTFLFASFPSGLVLYWLTNNLISISQQWIITRHYQA 547


>gi|71909810|ref|YP_287397.1| protein translocase subunit yidC [Dechloromonas aromatica RCB]
 gi|123746663|sp|Q477Q4|OXAA_DECAR RecName: Full=Inner membrane protein oxaA
 gi|71849431|gb|AAZ48927.1| protein translocase subunit yidC [Dechloromonas aromatica RCB]
          Length = 547

 Score =  217 bits (552), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 165/556 (29%), Positives = 262/556 (47%), Gaps = 58/556 (10%)

Query: 21  WQNFYVY--PRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSL 78
           W+N+  Y  P+  +             P+    + AA      A  +S +    +    L
Sbjct: 20  WENWQKYNQPKPADAVAAAPVSGAAPTPSAALQAKAAPGTPPVATPVSTAETFSITTDLL 79

Query: 79  IGSINLKGAQFDDLNLRGY--HLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELP 136
             +I+ +G     L L  Y  H D+  N  +       + K+ Y A+   +       LP
Sbjct: 80  KATISAQGGDLVSLELLNYKEHDDIQKNFDLF------DAKHQYLAQAGLIGEG----LP 129

Query: 137 NSNTVWNLISG--KILTPTTPIKLVFKNA--NNILFERTISLDE-HYLFKIVDTVTNNSI 191
              T +  + G  K+   T  +K+  ++A  N I   + ++     YL  I   V N S 
Sbjct: 130 THRTTFKHVGGATKLADGTDELKVRLESADQNGIKVAKILTFKRGSYLIDIAWEVANGSD 189

Query: 192 DQIRFSPRGRIMRHK--PQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISN----F 245
             I      ++ R    P   T       G  AV  D      KY  +    I++    F
Sbjct: 190 KAIAPHAYYQLQRDDLAPAGETKMVSTFTG-PAVFTDAD----KYQKVTFEHIADNKAKF 244

Query: 246 HES--NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSIT 303
            ++  N WL +   Y+ S ++P  +T      + + +G   +QA        I PG    
Sbjct: 245 TKTADNGWLAMVQHYFVSAWVPKDKTQREFYMRKV-EGSNVFQAGVIVPVAEIAPGAKGE 303

Query: 304 TTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIA 363
            +  L+AG    P +    K +A P  ++++D+GW   +A P+F  +   + LVGN+G A
Sbjct: 304 ASVSLYAG----PQMQSALKQVA-PGLDLVVDYGWLTVVAAPIFWALEAIHKLVGNWGWA 358

Query: 364 IMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHN 423
           I++ T+ +K +FFPL+   Y S A MK + P++ +L+E+F     Q L + M++LY+T  
Sbjct: 359 IVVLTIMIKAVFFPLSAASYKSMAKMKMLTPRLAQLKERFGDDK-QRLNQEMMKLYQTEK 417

Query: 424 INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY 483
           +NPL GC PIL+QIPVF A+Y V+  ++EMR AP+  WIKDLA+ADP  I          
Sbjct: 418 VNPLGGCLPILVQIPVFIALYWVLLGAVEMRGAPWILWIKDLASADPYYIL--------- 468

Query: 484 LPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWS 543
                     P+IM +SMF+Q K++P P D  QA ++  MP++F F    FPAGL++YW 
Sbjct: 469 ----------PVIMMVSMFVQTKLNPTPPDPIQAKVMMMMPLIFGFMFFWFPAGLVLYWV 518

Query: 544 WSNVISIVQQAVIMKM 559
            +NV+SI QQ  I ++
Sbjct: 519 VNNVLSIAQQWQITRL 534


>gi|322515695|ref|ZP_08068668.1| YidC/Oxa1 family membrane protein insertase [Actinobacillus ureae
           ATCC 25976]
 gi|322118240|gb|EFX90532.1| YidC/Oxa1 family membrane protein insertase [Actinobacillus ureae
           ATCC 25976]
          Length = 542

 Score =  217 bits (552), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 128/399 (32%), Positives = 216/399 (54%), Gaps = 34/399 (8%)

Query: 164 NNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIA 222
           + +L+ +T  L    Y   +   V N S   I   P G+ ++H    ++ +  +      
Sbjct: 162 DGVLYTKTFVLKRGSYDVAVNFNVKNQSAQAIEVQPYGQ-LKHTLVESSGSLTMPTYTGG 220

Query: 223 VLGDKSLVEQKYS--DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
                    +KYS  ++ K ++ N      W+ +   Y+ S ++P+++   +S +   ++
Sbjct: 221 AYSSSETNYKKYSFDEMAKENL-NIGTKAGWVAVLQHYFVSAWVPNQDAQ-NSLYSRTNN 278

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
           G A    +    E+   P    T T+ L+ G K+       E +      ++ +D+GW +
Sbjct: 279 GIATIGYRGPVTEVA--PNSEATITSQLWTGPKD-----QKEMEATAATLDLTVDYGWAW 331

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           FIAKP+F L+++  ++V N+G+AI+  T+ VK++ +PL K QY S A M+ +QPKI E+R
Sbjct: 332 FIAKPLFALLTFIQSIVTNWGLAIIGVTLVVKMILYPLTKAQYTSMAKMRMLQPKIQEMR 391

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E+F     Q + + M++LYK   +NP+ GC PIL+Q+P+F A+Y     ++E+RHAPF+G
Sbjct: 392 ERFGDD-RQRMSQEMMKLYKDEKVNPMGGCLPILIQMPIFIALYWTFMEAVELRHAPFFG 450

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMI 519
           WI+DL+A D           P+Y        I P++M  SMF+  KMSP P AD  Q  +
Sbjct: 451 WIQDLSAQD-----------PYY--------ILPLLMGGSMFLLQKMSPTPVADPVQKKV 491

Query: 520 LNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           + +MPV+F      FP+GL++YW  SN+I+I QQ +I +
Sbjct: 492 MTFMPVLFTVFFLWFPSGLVLYWLTSNLITIAQQWLIYR 530


>gi|209519687|ref|ZP_03268476.1| 60 kDa inner membrane insertion protein [Burkholderia sp. H160]
 gi|209499904|gb|EDZ99970.1| 60 kDa inner membrane insertion protein [Burkholderia sp. H160]
          Length = 552

 Score =  217 bits (552), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 156/502 (31%), Positives = 250/502 (49%), Gaps = 63/502 (12%)

Query: 80  GSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSN 139
           G I+ +G     L+L     D      ++TL   +N  + Y A    +      + PN N
Sbjct: 89  GEIDTRGGTVSRLSLVK-QGDGKQPDLVITLFDRTN-NHTYLARTGLLGG----DFPNHN 142

Query: 140 TVWNLISGKILTPTTPIKLV-FKNANNILFE----------RTISLDE-HYLFKIVDTVT 187
            V+ L+      P  P +LV  +N+  + FE          +T +     Y+  +   V 
Sbjct: 143 DVFTLM------PNQPTQLVDGQNSFQMSFESPEKGGLKVIKTYTFTRGSYVIGVETKVQ 196

Query: 188 NNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIA---VLGDKSLVEQKYSDIEKSSISN 244
           N     +       ++R      T  F     FI       +    +  +SD++K+   +
Sbjct: 197 NVGTTAVTPQVYMELVRDDQPVETPRF--SHTFIGPAVYTNEHHFQKMTFSDLDKNK-QD 253

Query: 245 FHES--NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSI 302
           F  S  + W+ +   Y+AS +IP  +     +F       + Y+        TI PG+++
Sbjct: 254 FATSANDGWVAMVQHYFASAWIP--QEGVKREFYAEKIDPSLYRVGMKQALPTIQPGQTV 311

Query: 303 TTTNFLFAGAKEFPTIHHYEKDLA--IPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF 360
           + +  LFAG +E       EK LA   P  +++ D+GW   IAKP+F L+S  + LVGN+
Sbjct: 312 SVSARLFAGPEE-------EKMLAGIAPGLDLVKDYGWVTIIAKPLFWLLSKIHGLVGNW 364

Query: 361 GIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYK 420
           G +I+L T+ +K +FFPL+   Y S A MK I P++  LRE+FK   PQ +  A+++LYK
Sbjct: 365 GWSIVLLTLLIKAVFFPLSAASYKSMARMKAITPRMQALRERFKGD-PQKMNAALMELYK 423

Query: 421 THNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL 480
           T  +NP  GC P+++QIPVF ++Y V+  S+EMR AP+  WI+DL+  DP  I       
Sbjct: 424 TEKVNPFGGCLPVVIQIPVFISLYWVLLSSVEMRGAPWILWIQDLSQQDPYFIL------ 477

Query: 481 PFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLII 540
                        PI+M++SMF+Q +++P P D  QA ++ +MP+ F      FPAGL++
Sbjct: 478 -------------PILMAVSMFLQTRLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVL 524

Query: 541 YWSWSNVISIVQQAVIMKMHGA 562
           Y+  +NV+SI QQ  I +M G+
Sbjct: 525 YYVVNNVLSIAQQYYITRMMGS 546


>gi|206890197|ref|YP_002249042.1| inner membrane protein OxaA [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206742135|gb|ACI21192.1| inner membrane protein OxaA [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 513

 Score =  216 bits (551), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 122/347 (35%), Positives = 191/347 (55%), Gaps = 59/347 (17%)

Query: 222 AVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDG 281
            +L +   +E   S I++++   + E   W+   DKY+ S  +P  +             
Sbjct: 210 VILKEADRIELNPSKIKETN--TYKEGVKWIAQEDKYFFSAIVPVTK------------- 254

Query: 282 HARYQAKFSANEITILP--GKSITTTNF--------LFAGAKEFPTIHHYEKDLAIPRFE 331
                    AN+  +LP  G ++T   F        +FA  KE+  +  +   L     E
Sbjct: 255 ---------ANQFVVLPYNGDALTGVEFNDGINSYRVFAAPKEYDYLKKFNVGL-----E 300

Query: 332 MLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKN 391
            ++D+G+F  IA+P+F  +   Y+L+GN+GIAI++ T+ V++ F P+  +   S   +  
Sbjct: 301 HIVDFGFFSIIARPLFWFLKLLYSLIGNYGIAIIILTILVRIPFIPIVNRGQKSMQKLSE 360

Query: 392 IQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISL 451
           +QPK+ +L+E++K  P Q LQK M++LYK + INP++GC P+LLQIPVFFA+YK+++I++
Sbjct: 361 LQPKLMQLKEQYKNDP-QRLQKEMMELYKKYKINPMSGCLPMLLQIPVFFALYKILTIAI 419

Query: 452 EMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP 511
           E+R APF  WI DL+A D           P+Y        + PIIM  +M IQ KM+P  
Sbjct: 420 ELRQAPFMFWIHDLSAKD-----------PYY--------VLPIIMGATMLIQQKMTPST 460

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           AD  Q  I+  +PVVF F   SFP+GL++YW  +N+  I QQ  I K
Sbjct: 461 ADPTQQKIMLLLPVVFTFLFLSFPSGLVLYWLINNLFGIAQQFYINK 507


>gi|167626982|ref|YP_001677482.1| hypothetical protein Fphi_0760 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|189036351|sp|B0TW73|OXAA_FRAP2 RecName: Full=Inner membrane protein oxaA
 gi|167596983|gb|ABZ86981.1| conserved membrane protein of unknown function [Francisella
           philomiragia subsp. philomiragia ATCC 25017]
          Length = 551

 Score =  216 bits (551), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 124/342 (36%), Positives = 201/342 (58%), Gaps = 34/342 (9%)

Query: 225 GDKSLVEQKYSDIEKS----SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
            + S  ++ + DI K+    ++ N  +   W+     Y+ S +IP    S  S+  Y + 
Sbjct: 236 ANDSFRKESFKDISKTNGQPTVIN-SQGLGWVAFIQHYFVSAWIPQ---SNDSKIYYKNL 291

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
            +  ++A  +   I+I P +S +  + L++G    P I     DLA P  E  +D+G   
Sbjct: 292 NNDVFEAG-AYTGISIAPNQSESIDSVLYSG----PIIKANLVDLA-PNLEKTLDYGMLS 345

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           F ++ +F +M+  ++LVGN+G+AI+L T  +KL+F+PL+ K Y S A M+ +QP++  L+
Sbjct: 346 FFSEIIFWVMNQIHSLVGNWGLAIILVTCLIKLIFYPLSAKSYRSMAKMRMLQPRVKRLQ 405

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E +K    QVL K M+++YK   +NPL+GC P+L+QIP+F ++Y V+  S+E+R APF  
Sbjct: 406 ETYKDDR-QVLGKKMMEMYKEEKVNPLSGCLPMLIQIPIFISLYWVLLESVELRQAPFIF 464

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMIL 520
           WI DL+  DP  +                    PI+M +SMF+Q K+SP PAD  QA I+
Sbjct: 465 WIHDLSMKDPYFVL-------------------PILMGISMFLQQKLSPAPADPMQAKIM 505

Query: 521 NWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
            ++PV+F F  +SFP+GL++YW  +NVISI+QQ +I + + A
Sbjct: 506 MFLPVIFTFLFASFPSGLVLYWLTNNVISILQQWIITRHYQA 547


>gi|118496688|ref|YP_897738.1| membrane protein of unknown function [Francisella tularensis subsp.
           novicida U112]
 gi|194323997|ref|ZP_03057772.1| 60Kd inner membrane protein [Francisella tularensis subsp. novicida
           FTE]
 gi|166975866|sp|A0Q419|OXAA_FRATN RecName: Full=Inner membrane protein oxaA
 gi|118422594|gb|ABK88984.1| conserved membrane protein of unknown function [Francisella
           novicida U112]
 gi|194321894|gb|EDX19377.1| 60Kd inner membrane protein [Francisella tularensis subsp. novicida
           FTE]
          Length = 551

 Score =  216 bits (551), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 125/339 (36%), Positives = 198/339 (58%), Gaps = 34/339 (10%)

Query: 228 SLVEQKYSDIEKS----SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
           S  ++ + DI K+    ++ N  +   W+     Y+ S +IP + T+    +K L +G  
Sbjct: 239 SFRKESFKDISKTNGQPTVIN-SDGQGWVAFLQHYFVSAWIP-QSTNAKIYYKNL-NGDV 295

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
                F+    TI P +S   ++ L+ G    P I     DLA P  E  +D+G   F +
Sbjct: 296 FEAGAFTG--ATIAPNQSENISSILYTG----PIIKANLVDLA-PNLEKTLDYGMLSFFS 348

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           + +F +M++ ++LVGN+G+AI+L T  +KL+F+PL+ K Y S A M+ +QP+I  L+E +
Sbjct: 349 EIIFWVMNHIHSLVGNWGLAIILVTCLIKLIFYPLSAKSYRSMAKMRMLQPRIKRLQETY 408

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
           K    Q L K M++LYK   +NPL+GC P+L+QIP+F ++Y V+  S+E+R APF  WI 
Sbjct: 409 KDDR-QALGKKMMELYKEEKVNPLSGCLPMLIQIPIFISLYWVLLESVELRQAPFIFWIH 467

Query: 464 DLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWM 523
           DL+  DP            Y        + P++M LSMF+Q K+SP PAD  QA ++ ++
Sbjct: 468 DLSMKDP------------YF-------VLPVLMGLSMFLQQKLSPAPADPMQAKVMMFL 508

Query: 524 PVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           PV+F F  +SFP+GL++YW  +N+ISI QQ +I + + A
Sbjct: 509 PVIFTFLFASFPSGLVLYWLTNNLISISQQWIITRHYQA 547


>gi|26986751|ref|NP_742176.1| putative inner membrane protein translocase component YidC
           [Pseudomonas putida KT2440]
 gi|60392875|sp|P0A140|OXAA_PSEPK RecName: Full=Inner membrane protein oxaA
 gi|60392876|sp|P0A141|OXAA_PSEPU RecName: Full=Inner membrane protein oxaA
 gi|24981341|gb|AAN65640.1|AE016190_6 inner membrane protein, 60 kDa [Pseudomonas putida KT2440]
 gi|45709|emb|CAA44417.1| unnamed protein product [Pseudomonas putida]
 gi|313496415|gb|ADR57781.1| OxaA [Pseudomonas putida BIRD-1]
          Length = 560

 Score =  216 bits (551), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 132/379 (34%), Positives = 209/379 (55%), Gaps = 31/379 (8%)

Query: 182 IVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS--DIEK 239
           ++D  +  + +   F+   R     P ++T T G      A L   S   +K S  DI+K
Sbjct: 200 LIDNQSGQAWNGNMFAQLKRDASGDPSSSTAT-GTATYLGAALWTASEPYKKVSMKDIDK 258

Query: 240 SSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPG 299
            S+   + S  W+     Y+ + +IP+K  +   Q +   D    Y   ++   I++  G
Sbjct: 259 GSLKE-NVSGGWVAWLQHYFVTAWIPAKSDNNVVQTR--KDSQGNYIIGYTGPVISVPAG 315

Query: 300 KSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGN 359
             + T+  L+AG    P I    K+L+ P  E+ +D+G+ +FIA+P+F L+ + ++L+GN
Sbjct: 316 GKVETSALLYAG----PKIQSKLKELS-PGLELTVDYGFLWFIAQPIFWLLQHIHSLLGN 370

Query: 360 FGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLY 419
           +G +I++ T+ +K LFFPL+   Y S A M+ + PK+  L+E+F     Q + +AM++LY
Sbjct: 371 WGWSIIVLTMLIKGLFFPLSAASYRSMARMRAVAPKLAALKERFGDD-RQKMSQAMMELY 429

Query: 420 KTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGI 479
           K   INPL GC PIL+Q+PVF A+Y V+  S+EMR AP+  WI DL+  D          
Sbjct: 430 KKEKINPLGGCLPILVQMPVFLALYWVLLESVEMRQAPWILWITDLSIKD---------- 479

Query: 480 LPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLI 539
            PF+        I PIIM  +MFIQ +++P P D  QA ++  MP++F F    FPAGL+
Sbjct: 480 -PFF--------ILPIIMGATMFIQQRLNPTPPDPMQAKVMKMMPIIFTFFFLWFPAGLV 530

Query: 540 IYWSWSNVISIVQQAVIMK 558
           +YW  +N +SI QQ  I +
Sbjct: 531 LYWVVNNCLSISQQWYITR 549


>gi|254368609|ref|ZP_04984625.1| inner-membrane protein [Francisella tularensis subsp. holarctica
           FSC022]
 gi|157121512|gb|EDO65703.1| inner-membrane protein [Francisella tularensis subsp. holarctica
           FSC022]
          Length = 551

 Score =  216 bits (551), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 125/339 (36%), Positives = 198/339 (58%), Gaps = 34/339 (10%)

Query: 228 SLVEQKYSDIEKS----SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
           S  ++ + DI K+    ++ N  +   W+     Y+ S +IP + T+    +K L +G  
Sbjct: 239 SFRKESFKDISKTNGQPTVIN-SDGQGWVAFLQHYFVSAWIP-QSTNAKIYYKNL-NGDV 295

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
                F+    TI P +S   ++ L+ G    P I     DLA P  E  +D+G   F +
Sbjct: 296 FEAGAFTG--ATIAPNQSENISSILYTG----PIIKANLVDLA-PNLEKTLDYGMLSFFS 348

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           + +F +M++ ++LVGN+G+AI+L T  +KL+F+PL+ K Y S A M+ +QP+I  L+E +
Sbjct: 349 EIIFWVMNHIHSLVGNWGLAIILVTCLIKLIFYPLSAKSYRSMAKMRMLQPRIKRLQETY 408

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
           K    Q L K M++LYK   +NPL+GC P+L+QIP+F ++Y V+  S+E+R APF  WI 
Sbjct: 409 KDDR-QALGKKMMELYKEEKVNPLSGCLPMLIQIPIFISLYWVLLESVELRQAPFIFWIH 467

Query: 464 DLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWM 523
           DL+  DP            Y        + P++M LSMF+Q K+SP PAD  QA ++ ++
Sbjct: 468 DLSMKDP------------YF-------VLPVLMGLSMFLQQKLSPAPADPMQAKVMMFL 508

Query: 524 PVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           PV+F F  +SFP+GL++YW  +N+ISI QQ +I + + A
Sbjct: 509 PVIFTFLFASFPSGLVLYWLTNNLISISQQWIITRHYQA 547


>gi|187932218|ref|YP_001892203.1| hypothetical membrane protein [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|254772786|sp|B2SE60|OXAA_FRATM RecName: Full=Inner membrane protein oxaA
 gi|187713127|gb|ACD31424.1| hypothetical membrane protein [Francisella tularensis subsp.
           mediasiatica FSC147]
          Length = 551

 Score =  216 bits (551), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 125/339 (36%), Positives = 198/339 (58%), Gaps = 34/339 (10%)

Query: 228 SLVEQKYSDIEKS----SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
           S  ++ + DI K+    ++ N  +   W+     Y+ S +IP + T+    +K L +G  
Sbjct: 239 SFRKESFKDISKTNGQPTVIN-SDGQGWVAFLQHYFVSAWIP-QSTNAKIYYKNL-NGDV 295

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
                F+    TI P +S   ++ L+ G    P I     DLA P  E  +D+G   F +
Sbjct: 296 FEAGAFTG--ATIAPNQSENISSILYTG----PIIKANLVDLA-PNLEKTLDYGMLSFFS 348

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           + +F +M++ ++LVGN+G+AI+L T  +KL+F+PL+ K Y S A M+ +QP+I  L+E +
Sbjct: 349 EIIFWVMNHIHSLVGNWGLAIILVTCLIKLIFYPLSAKSYRSMAKMRMLQPRIKRLQETY 408

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
           K    Q L K M++LYK   +NPL+GC P+L+QIP+F ++Y V+  S+E+R APF  WI 
Sbjct: 409 KDDR-QALGKKMMELYKEEKVNPLSGCLPMLIQIPIFISLYWVLLESVELRQAPFIFWIH 467

Query: 464 DLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWM 523
           DL+  DP            Y        + P++M LSMF+Q K+SP PAD  QA ++ ++
Sbjct: 468 DLSMKDP------------YF-------VLPVLMGLSMFLQQKLSPAPADPMQAKVMMFL 508

Query: 524 PVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           PV+F F  +SFP+GL++YW  +N+ISI QQ +I + + A
Sbjct: 509 PVIFTFLFASFPSGLVLYWLTNNLISISQQWIITRHYQA 547


>gi|56707390|ref|YP_169286.1| inner-membrane protein [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|110669861|ref|YP_666418.1| inner-membrane protein [Francisella tularensis subsp. tularensis
           FSC198]
 gi|134302668|ref|YP_001122637.1| inner-membrane protein of unknown function [Francisella tularensis
           subsp. tularensis WY96-3418]
 gi|224456465|ref|ZP_03664938.1| hypothetical protein FtultM_01268 [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|254370910|ref|ZP_04986915.1| inner-membrane protein [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254874228|ref|ZP_05246938.1| inner-membrane protein [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|81677123|sp|Q5NI56|OXAA_FRATT RecName: Full=Inner membrane protein oxaA
 gi|122971083|sp|Q14JK8|OXAA_FRAT1 RecName: Full=Inner membrane protein oxaA
 gi|166975867|sp|A4J015|OXAA_FRATW RecName: Full=Inner membrane protein oxaA
 gi|56603882|emb|CAG44866.1| Inner-membrane protein [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|110320194|emb|CAL08249.1| Inner-membrane protein [Francisella tularensis subsp. tularensis
           FSC198]
 gi|134050445|gb|ABO47516.1| inner-membrane protein of unknown function [Francisella tularensis
           subsp. tularensis WY96-3418]
 gi|151569153|gb|EDN34807.1| inner-membrane protein [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254840227|gb|EET18663.1| inner-membrane protein [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282158529|gb|ADA77920.1| hypothetical protein NE061598_01330 [Francisella tularensis subsp.
           tularensis NE061598]
          Length = 551

 Score =  216 bits (551), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 125/339 (36%), Positives = 198/339 (58%), Gaps = 34/339 (10%)

Query: 228 SLVEQKYSDIEKS----SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
           S  ++ + DI K+    ++ N  +   W+     Y+ S +IP + T+    +K L +G  
Sbjct: 239 SFRKESFKDISKTNGQPTVIN-SDGQGWVAFLQHYFVSAWIP-QSTNAKIYYKNL-NGDV 295

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
                F+    TI P +S   ++ L+ G    P I     DLA P  E  +D+G   F +
Sbjct: 296 FEAGAFTG--ATIAPNQSENISSILYTG----PIIKANLVDLA-PNLEKTLDYGMLSFFS 348

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           + +F +M++ ++LVGN+G+AI+L T  +KL+F+PL+ K Y S A M+ +QP+I  L+E +
Sbjct: 349 EIIFWVMNHIHSLVGNWGLAIILVTCLIKLIFYPLSAKSYRSMAKMRMLQPRIKRLQETY 408

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
           K    Q L K M++LYK   +NPL+GC P+L+QIP+F ++Y V+  S+E+R APF  WI 
Sbjct: 409 KDDR-QALGKKMMELYKEEKVNPLSGCLPMLIQIPIFISLYWVLLESVELRQAPFIFWIH 467

Query: 464 DLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWM 523
           DL+  DP            Y        + P++M LSMF+Q K+SP PAD  QA ++ ++
Sbjct: 468 DLSMKDP------------YF-------VLPVLMGLSMFLQQKLSPAPADPMQAKVMMFL 508

Query: 524 PVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           PV+F F  +SFP+GL++YW  +N+ISI QQ +I + + A
Sbjct: 509 PVIFTFLFASFPSGLVLYWLTNNLISISQQWIITRHYQA 547


>gi|89255612|ref|YP_512973.1| inner-membrane protein [Francisella tularensis subsp. holarctica
           LVS]
 gi|115314117|ref|YP_762840.1| inner membrane protein [Francisella tularensis subsp. holarctica
           OSU18]
 gi|156501560|ref|YP_001427625.1| inner-membrane protein [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|167010123|ref|ZP_02275054.1| inner-membrane protein [Francisella tularensis subsp. holarctica
           FSC200]
 gi|254367007|ref|ZP_04983043.1| conserved inner-membrane protein [Francisella tularensis subsp.
           holarctica 257]
 gi|290953728|ref|ZP_06558349.1| inner membrane protein oxaA [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295312914|ref|ZP_06803635.1| inner membrane protein oxaA [Francisella tularensis subsp.
           holarctica URFT1]
 gi|122325838|sp|Q0BNY1|OXAA_FRATO RecName: Full=Inner membrane protein oxaA
 gi|122501296|sp|Q2A5M8|OXAA_FRATH RecName: Full=Inner membrane protein oxaA
 gi|166975865|sp|A7N9L6|OXAA_FRATF RecName: Full=Inner membrane protein oxaA
 gi|89143443|emb|CAJ78619.1| Inner-membrane protein [Francisella tularensis subsp. holarctica
           LVS]
 gi|115129016|gb|ABI82203.1| inner membrane protein [Francisella tularensis subsp. holarctica
           OSU18]
 gi|134252833|gb|EBA51927.1| conserved inner-membrane protein [Francisella tularensis subsp.
           holarctica 257]
 gi|156252163|gb|ABU60669.1| inner-membrane protein [Francisella tularensis subsp. holarctica
           FTNF002-00]
          Length = 551

 Score =  216 bits (551), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 125/339 (36%), Positives = 198/339 (58%), Gaps = 34/339 (10%)

Query: 228 SLVEQKYSDIEKS----SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
           S  ++ + DI K+    ++ N  +   W+     Y+ S +IP + T+    +K L +G  
Sbjct: 239 SFRKESFKDISKTNGQPTVIN-SDGQGWVAFLQHYFVSAWIP-QSTNAKIYYKNL-NGDV 295

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
                F+    TI P +S   ++ L+ G    P I     DLA P  E  +D+G   F +
Sbjct: 296 FEAGAFTG--ATIAPNQSENISSILYTG----PIIKANLVDLA-PNLEKTLDYGMLSFFS 348

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           + +F +M++ ++LVGN+G+AI+L T  +KL+F+PL+ K Y S A M+ +QP+I  L+E +
Sbjct: 349 EIIFWVMNHIHSLVGNWGLAIILVTCLIKLIFYPLSAKSYRSMAKMRMLQPRIKRLQETY 408

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
           K    Q L K M++LYK   +NPL+GC P+L+QIP+F ++Y V+  S+E+R APF  WI 
Sbjct: 409 KDDR-QALGKKMMELYKEEKVNPLSGCLPMLIQIPIFISLYWVLLESVELRQAPFIFWIH 467

Query: 464 DLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWM 523
           DL+  DP            Y        + P++M LSMF+Q K+SP PAD  QA ++ ++
Sbjct: 468 DLSMKDP------------YF-------VLPVLMGLSMFLQQKLSPAPADPMQAKVMMFL 508

Query: 524 PVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           PV+F F  +SFP+GL++YW  +N+ISI QQ +I + + A
Sbjct: 509 PVIFTFLFASFPSGLVLYWLTNNLISISQQWIITRHYQA 547


>gi|291615646|ref|YP_003518388.1| YidC [Pantoea ananatis LMG 20103]
 gi|291150676|gb|ADD75260.1| YidC [Pantoea ananatis LMG 20103]
 gi|327395912|dbj|BAK13334.1| preprotein translocase subunit YidC [Pantoea ananatis AJ13355]
          Length = 548

 Score =  216 bits (551), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 164/573 (28%), Positives = 268/573 (46%), Gaps = 59/573 (10%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
           +RN      + +S +I  AWQ           ++  K +QT  Q  Q  NS A       
Sbjct: 4   QRNLFLIAFLFVSFMIWQAWQT----------DHAPKPLQT--QTTQNTNSAAGDAAGQG 51

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTL-LSPSNTKNAY 120
             A      + +K   L  +IN +G   D   L  Y   + S+ P   L  +PS    A 
Sbjct: 52  VPASGQGKTITVKTDVLSLTINTRGGDVDQAQLLTYPDKLGSDKPFELLETTPSFVYQAQ 111

Query: 121 --FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHY 178
                 +     NN   P  NT  +            + + F   N +++ +T       
Sbjct: 112 SGLTGRNGPDNPNNGARPLYNTAQDHFELAEGQSELRVPMTFTAENGVVYTKTFVFKRGD 171

Query: 179 LFKIVDTVTNNSIDQ-IRFSPRGRIM------RHKPQTATNTFGVQEGFIAVLGDKSLVE 231
               VD   NN+  Q +  S  G++       +H+  T +N F +   F       S  E
Sbjct: 172 YAVNVDYNINNTSQQPLELSMFGQLKQTIDLPKHR-DTGSNNFALHT-FRGTAYSTS--E 227

Query: 232 QKYSDIEKSSIS-----NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQ 286
            KY  I+  +I+     N   SN W+ +  +Y+A+ ++P  + +       L +G A   
Sbjct: 228 SKYEKIKFDTIADNENLNTTTSNGWVAMLQQYFATAWVPRTQGTNTLYTSNLGNGVAA-- 285

Query: 287 AKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPM 346
             + +  +T+ PG   T    L+ G    P I      +A P  ++ +D+GW +FI++P+
Sbjct: 286 IGYKSAPVTVAPGAQQTLDATLWVG----PEIQDKMAAIA-PHLDLTVDYGWLWFISQPL 340

Query: 347 FMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQS 406
           F L+ + ++ +GN+G +I++ T  V+ + +PL K QY S A M+ +QPKI  +RE+    
Sbjct: 341 FKLLKFIHSFIGNWGFSIIIITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGDD 400

Query: 407 PPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLA 466
             Q   + M+ LYK   +NPL GC P+++Q+P+F A+Y ++S S+E+RHAPF  WI DL+
Sbjct: 401 -KQKQSQEMMALYKAEKVNPLGGCLPLVIQMPIFLALYYMLSGSVELRHAPFILWIHDLS 459

Query: 467 AADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPV 525
           A D           P+Y        I PI+M ++MF   KMSP    D  Q  I+ +MPV
Sbjct: 460 AQD-----------PYY--------ILPILMGITMFFIQKMSPTTVTDPMQQKIMTYMPV 500

Query: 526 VFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           +F      FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 501 IFTVFFLWFPSGLVLYYIVSNLVTILQQQLIYR 533


>gi|88798542|ref|ZP_01114126.1| putative inner membrane protein translocase component YidC
           [Reinekea sp. MED297]
 gi|88778642|gb|EAR09833.1| putative inner membrane protein translocase component YidC
           [Reinekea sp. MED297]
          Length = 559

 Score =  216 bits (551), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 128/390 (32%), Positives = 208/390 (53%), Gaps = 41/390 (10%)

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLG------DKSLVE 231
           Y+  +   +TN   D +R +  G++ R + Q  +   G+  G  + LG      D +  +
Sbjct: 189 YVMDVRFDLTNQGSDTLRTNLFGQLRRDRSQDPSAGSGI--GMRSYLGATFSTEDSAYEK 246

Query: 232 QKYSDIEKSSISNFHESNSWLGISDKYWASVFIPS--KETSFHSQFKYLSDGHARYQAKF 289
            K+ +++     N  +   W+ +   Y+ S +IPS     +F+ Q     D    Y   F
Sbjct: 247 VKFGELDDGRF-NGSKVGGWVAMLQHYFLSAWIPSANDNNAFYGQKGSTGD----YYVGF 301

Query: 290 SANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFML 349
            A  + + PG+S++T   L+ G K+   +     +L     E  +D+GW ++IA+P+F L
Sbjct: 302 QAPTVVVGPGESVSTGAQLYVGPKDQDQLDELADNL-----EKTVDYGWLWWIAQPLFWL 356

Query: 350 MSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQ 409
           M + + L+GN+G +I+L T+ VK++ +PL    Y S   M+   P I ELRE++     Q
Sbjct: 357 MQFIHGLIGNWGWSIVLMTLTVKMVLYPLTASSYRSMGKMRKFAPVISELREQYGDD-RQ 415

Query: 410 VLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAAD 469
            + + M++LY+   +NPL GC P+L+Q+PVF A+Y V+  S+E+R +PF  WI+DL+  D
Sbjct: 416 KMSQEMMKLYQKEKLNPLGGCLPMLVQMPVFIALYWVLMESVELRQSPFIFWIQDLSLKD 475

Query: 470 PTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPA-DKGQAMILNWMPVVFV 528
           P   F L                 P++M  SMF+QM+M   P  D  Q  I+ +MPV+F 
Sbjct: 476 P--FFVL-----------------PLLMGASMFLQMRMQQQPTMDPMQQKIMQFMPVMFT 516

Query: 529 FALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           F    FPAGL +YW  +NVI+IVQQ ++ K
Sbjct: 517 FMFLWFPAGLTLYWFTNNVITIVQQYIVNK 546


>gi|283851181|ref|ZP_06368464.1| 60 kDa inner membrane insertion protein [Desulfovibrio sp. FW1012B]
 gi|283573350|gb|EFC21327.1| 60 kDa inner membrane insertion protein [Desulfovibrio sp. FW1012B]
          Length = 530

 Score =  216 bits (551), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 163/564 (28%), Positives = 261/564 (46%), Gaps = 56/564 (9%)

Query: 3   RNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRA 62
            N    +A+ LS+ ++  W   +++P   +        QT     Q     A       A
Sbjct: 2   ENKRVILAVVLSLAVLVGWN--FLFPAKPQAPKTDTPTQTEAPTAQAPAPAAQRAETLPA 59

Query: 63  QALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFA 122
            A +   +V +  P      N  G   +  +L+GY   ++ +SP+V L+   N K    A
Sbjct: 60  FAPTPGRKVTVNTPLYTAVFNSAGGVLEQFSLKGYRQTIAPDSPLVDLV---NAKAQLKA 116

Query: 123 ELDYVSTANNIELPN-SNTVWNLISGKI-LTPTTPIKLVFKNA-NNILFERTISLD-EHY 178
            L  +        P   N  W++  G + L       L F     + L  RT++     Y
Sbjct: 117 PLGLIVNGT----PTWQNVEWSVEGGDLKLDAAGAGSLSFTGRLGDTLIRRTLTFSGASY 172

Query: 179 LFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIE 238
           L     +++N     ++      +   +   A +++   +   A   D  L  + +S+ +
Sbjct: 173 LIDEKLSLSNTGAAPVKDRLSLTVAVDRLSAADDSYNPTQ---AAFYDTGL--ELFSNEK 227

Query: 239 KSSISNFHESN-SWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITIL 297
           K +     E    W  +   Y+    IP  E     + K+  +    ++     + I I 
Sbjct: 228 KLAEGMTDEKPVQWGAVMSNYFLVGIIPEAE-GLRGKAKFEDE---IFRVALDKDGIEIP 283

Query: 298 PGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLV 357
            G         + G K+   +     +LA       ID+GWF FIAKP+  L+ +FY+ V
Sbjct: 284 AGGRTDLDVRYYLGPKDPKFLAQAPHNLA-----AAIDYGWFDFIAKPLLKLLHFFYDYV 338

Query: 358 GNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQ 417
           GN+G+AI+L TV +K LF+PL+ K Y S   MK +QP + +LREK K    Q + + M+Q
Sbjct: 339 GNYGVAIILLTVLIKGLFWPLSHKSYKSMEQMKRLQPLLTQLREKHKDD-RQKMNEEMMQ 397

Query: 418 LYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG--------WIKDLAAAD 469
           LYKT+ +NP  GC P+++QIPVFF +Y+ +  S+E+RHAPF          W+ DL+A D
Sbjct: 398 LYKTYKVNPAGGCLPMIVQIPVFFGLYQALLHSIELRHAPFIAHLPFTNMIWLADLSAKD 457

Query: 470 PTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVF 529
                      P+Y        I P++M  +MF+Q KM+P P D  QA ++  MPV+F F
Sbjct: 458 -----------PYY--------ITPLVMGATMFLQQKMTPAPGDPTQAKVMLLMPVIFTF 498

Query: 530 ALSSFPAGLIIYWSWSNVISIVQQ 553
              +FP+GL++YW  +NVISI QQ
Sbjct: 499 MFLNFPSGLVVYWLVNNVISIAQQ 522


>gi|208780038|ref|ZP_03247381.1| 60Kd inner membrane protein [Francisella novicida FTG]
 gi|208744042|gb|EDZ90343.1| 60Kd inner membrane protein [Francisella novicida FTG]
          Length = 530

 Score =  216 bits (551), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 126/339 (37%), Positives = 198/339 (58%), Gaps = 34/339 (10%)

Query: 228 SLVEQKYSDIEKS----SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
           S  ++ + DI K+    ++ N  +   W+     Y+ S +IP + T+    +K L +G  
Sbjct: 218 SFRKESFKDISKTNGQPTVIN-SDGQGWVAFLQHYFVSAWIP-QSTNAKIYYKNL-NGDV 274

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
                F+    TI P +S   ++ L+ G    P I     DLA P  E  +D+G   F +
Sbjct: 275 FEAGAFTG--ATIAPNQSENISSILYTG----PIIKANLVDLA-PNLEKTLDYGMLSFFS 327

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           + +F +M++ ++LVGN+G+AI+L T  +KL+F+PL+ K Y S A M+ +QP+I  L+E +
Sbjct: 328 EIIFWVMNHIHSLVGNWGLAIILVTCLIKLIFYPLSAKSYRSMAKMRMLQPRIKRLQETY 387

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
           K    Q L K M++LYK   +NPL+GC P+L+QIP+F ++Y V+  S+E+R APF  WI 
Sbjct: 388 KDDR-QALGKKMMELYKEEKVNPLSGCLPMLIQIPIFISLYWVLLESVELRQAPFIFWIH 446

Query: 464 DLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWM 523
           DL+  DP   F L                 P++M LSMF+Q K+SP PAD  QA ++ ++
Sbjct: 447 DLSMKDP--YFVL-----------------PVLMGLSMFLQQKLSPAPADPMQAKVMMFL 487

Query: 524 PVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           PV+F F  +SFP+GL++YW  +N+ISI QQ +I + + A
Sbjct: 488 PVIFTFLFASFPSGLVLYWLTNNLISISQQWIITRHYQA 526


>gi|145630098|ref|ZP_01785880.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae R3021]
 gi|144984379|gb|EDJ91802.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae R3021]
          Length = 541

 Score =  216 bits (551), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 117/327 (35%), Positives = 194/327 (59%), Gaps = 30/327 (9%)

Query: 234 YSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA-KFSAN 292
           +SD++ +++S       W+ +   Y+ S +IP+++   ++Q   ++D      +  +   
Sbjct: 231 FSDMQDNNLS-IDTKAGWVAVLQHYFVSAWIPNQDV--NNQLYTITDSKNNVASIGYRGP 287

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
            +TI  G   T T+ L+ G    P + +    +A    ++ +D+GW +FIAKP+F L+++
Sbjct: 288 VVTIPSGSQETITSSLWTG----PKLQNQMATVA-NNLDLTVDYGWAWFIAKPLFWLLTF 342

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
              +V N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + 
Sbjct: 343 IQGIVSNWGLAIICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGDD-RQRMS 401

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           + M++LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A D   
Sbjct: 402 QEMMKLYKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQD--- 458

Query: 473 IFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFAL 531
                   P+Y        I PI+M +SMF+  KMSP P  D  Q  ++N+MP++F+   
Sbjct: 459 --------PYY--------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLIFMVFF 502

Query: 532 SSFPAGLIIYWSWSNVISIVQQAVIMK 558
             FP+GL++YW  SN+I+I QQ +I +
Sbjct: 503 LWFPSGLVLYWLVSNLITIAQQQLIYR 529


>gi|77166533|ref|YP_345058.1| 60 kDa inner membrane insertion protein [Nitrosococcus oceani ATCC
           19707]
 gi|254435359|ref|ZP_05048866.1| 60Kd inner membrane protein [Nitrosococcus oceani AFC27]
 gi|123593186|sp|Q3J6L8|OXAA_NITOC RecName: Full=Inner membrane protein oxaA
 gi|76884847|gb|ABA59528.1| protein translocase subunit yidC [Nitrosococcus oceani ATCC 19707]
 gi|207088470|gb|EDZ65742.1| 60Kd inner membrane protein [Nitrosococcus oceani AFC27]
          Length = 545

 Score =  216 bits (551), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 149/509 (29%), Positives = 252/509 (49%), Gaps = 45/509 (8%)

Query: 60  DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSN---- 115
           D A  L+    +E+K   L   I +      ++ L  Y + +   +  VTLL   +    
Sbjct: 66  DTAPILTGQKTIEVKTDLLAIKIGMASGDLYEVQLLNYPVSLKKPNEPVTLLHKRDPDLF 125

Query: 116 -TKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISL 174
            T++   A      T   ++     T + LI  +    +  + L +++ N I   +T   
Sbjct: 126 VTQSGLRAASGPSITHETVQFSAPKTYYELIEDE---SSLKVPLTWEDENGIKVTKTYIF 182

Query: 175 DEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGV-QEGFIAVLGDKSLVEQK 233
                   ++    N  DQ      GR      +T   + G+    ++  +   S  EQ+
Sbjct: 183 QRDSYQIDLNIKIENGTDQAWM---GRAYAQFSRTPPESGGMFARSYVGAV--FSTQEQE 237

Query: 234 YSDIEKSSIS----NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKF 289
           Y  ++   ++    +   S  W+ +   Y+ + ++P ++ + +   K++ +  +RY A  
Sbjct: 238 YQKVDFGDLASQSFDRRSSGGWVAMIQHYFVAAWVPREQGTNYYYGKHVQN--SRYIAGV 295

Query: 290 SANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFML 349
              + TI PG+S      LF G    P I      +A P+  + +D+G    +A+P+F L
Sbjct: 296 MPPQQTIAPGESGQFNLALFTG----PKIQDQLAAVA-PKLNLTVDYGKLTILAEPLFWL 350

Query: 350 MSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQ 409
           MS+F+NLVGN+G AI+L T  VKL+FF L++  Y S A M+ +QP++  L+E++     +
Sbjct: 351 MSWFHNLVGNWGWAIVLLTFVVKLVFFKLSQTSYRSMARMRKLQPRLLALKERYGDDRQK 410

Query: 410 VLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAAD 469
           V Q AM++LY+   +NP+ GC PI++QIPVF A+Y ++  S+E+R APF  WI+DL + D
Sbjct: 411 VGQ-AMMELYRKEKVNPMGGCLPIVVQIPVFIALYWMLLESVELRQAPFIFWIQDLTSKD 469

Query: 470 PTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVF 529
           P  I                    P++M +SMF+Q K+SP P D  QA ++  MPV+F  
Sbjct: 470 PYYIL-------------------PLLMGVSMFVQQKLSPAPTDPIQAKVMALMPVMFTV 510

Query: 530 ALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
               FPAGL++YW  +N++SI QQ  I +
Sbjct: 511 FFVMFPAGLVLYWVVNNILSIAQQWYITR 539


>gi|94312544|ref|YP_585754.1| putative inner membrane protein translocase component YidC
           [Cupriavidus metallidurans CH34]
 gi|166977403|sp|Q1LH91|OXAA_RALME RecName: Full=Inner membrane protein oxaA
 gi|93356396|gb|ABF10485.1| inner membrane insertion protein YidC/OxaA [Cupriavidus
           metallidurans CH34]
          Length = 555

 Score =  216 bits (550), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 157/502 (31%), Positives = 245/502 (48%), Gaps = 49/502 (9%)

Query: 70  RVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVST 129
           +V +    +   I+  G     L L   H      +P+V L    N    Y A    +  
Sbjct: 83  KVTVTTDEVRAEIDTAGGILSRLELLNEH--EKDGAPVVLLERDVN--RTYLARSGLIGG 138

Query: 130 ANNIELPNSNTVWNLISG-KILTPTTPIKLVFKNA--NNILFERTISLDEHYLFKIVDT- 185
               +LPN  TV+ +  G + L P      V   A  N + F +T +   H    +VDT 
Sbjct: 139 ----DLPNHTTVFTVAPGARTLAPGQDKLDVVLTAEKNGVKFVKTYTF--HKGSYVVDTR 192

Query: 186 --VTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ-KYSDIEKSSI 242
             VTN     +  +    + R   +   + F       A+  +     +  + DI K   
Sbjct: 193 FDVTNTGTAAVSPTLYLELARDGSKVEKSQFYSTFTGPAIYTNADKYHKLTFEDIAKGKA 252

Query: 243 S-NFHESNSWLGISDKYWASVFIP--SKETSFHSQFKYLSDGHARYQAKFSANEITILPG 299
           +      N W+ +   Y+AS +IP   K+ SF+++          Y+         + PG
Sbjct: 253 TVPAATDNGWVAMVQHYFASAWIPQTGKQHSFYAE----QIDPNLYRVGIQQPLGQLAPG 308

Query: 300 KSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGN 359
            +++T   LFAG +E   +         P  E++ D+GW   +AKP+F L+   +  +GN
Sbjct: 309 ATVSTDARLFAGPQEERMLEQI-----TPGLELVKDYGWLTILAKPLFWLLEKLHGFLGN 363

Query: 360 FGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLY 419
           +G +I+  TV +KL+FFPL+   Y S   MK++QP++  +RE+ K  P Q + + M+ LY
Sbjct: 364 WGWSIIGLTVLIKLVFFPLSAASYKSMGKMKDLQPRMTAIRERHKGDP-QKMNQEMMALY 422

Query: 420 KTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGI 479
           +T  +NPL GC PI++QIPVF A+Y V+  S+EMR AP+ GWI DL+  D          
Sbjct: 423 RTEKVNPLGGCLPIVIQIPVFIALYWVLLSSVEMRGAPWLGWIHDLSVPD---------- 472

Query: 480 LPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLI 539
            PFY        I PI+M++SMF+Q +++P P D  QA ++  MP+VF F    FPAGL+
Sbjct: 473 -PFY--------ILPIVMAVSMFVQTRLNPTPPDPVQAKVMMIMPLVFSFMFFFFPAGLV 523

Query: 540 IYWSWSNVISIVQQAVIMKMHG 561
           +YW  +N++SI QQ  I +M G
Sbjct: 524 LYWVVNNILSIAQQWQINRMLG 545


>gi|241665033|ref|YP_002983393.1| inner membrane protein translocase component YidC [Ralstonia
           pickettii 12D]
 gi|240867060|gb|ACS64721.1| 60 kDa inner membrane insertion protein [Ralstonia pickettii 12D]
          Length = 554

 Score =  216 bits (550), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 153/506 (30%), Positives = 245/506 (48%), Gaps = 54/506 (10%)

Query: 68  SPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYV 127
           S ++ +    L  +I+  GA    L L    LD   +     +L   + +  Y A    +
Sbjct: 82  SEKIVISTDLLRATIDTDGAIVTKLEL----LDQKDHDGNPMVLFDRSVERTYLARSGLI 137

Query: 128 STANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILF---ERTISLDEHYLFK--- 181
                 + PN  TV+   +G       P  L   N  +I     +    L + Y+FK   
Sbjct: 138 GG----DFPNHTTVFTASAG-------PRDLGTGNDVSITLTADKGGAKLAKTYVFKRGS 186

Query: 182 -IVDT---VTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ-KYSD 236
            ++DT   VTN+    I  +    + R       + F       AV  D     +  ++D
Sbjct: 187 YVIDTRFDVTNDGTAPINPTLYMELARDGGAVEQSRFYSTFTGPAVYTDGDKFHKITFAD 246

Query: 237 IEKSSISNFHESNS-WLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
           I+K        ++S W+ +   Y+AS +IP+           +      Y+        T
Sbjct: 247 IDKGKAQVPAPTDSGWVAMVQHYFASAWIPADNVKREYYVNRVDTNF--YRIGIQEPLGT 304

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           + PG S++ T  LFAG ++   +         P  +++ D+GW   +AKP+F L+   + 
Sbjct: 305 VAPGASVSATARLFAGPQQARMLESIT-----PGLDLVKDYGWLTIVAKPLFWLLEKIHA 359

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
           L+GN+G +I+  TV +KL+FFPL+   Y S A MK++QP++  +RE+ K   PQ + + M
Sbjct: 360 LLGNWGWSIVALTVLIKLVFFPLSATSYRSMAKMKDLQPRMTAIRERHKGD-PQKMNQEM 418

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           + LY+T  +NPL GC PI++QIPVF A+Y  +  S+EMR AP+ GW+ DL+  D      
Sbjct: 419 MTLYRTEKVNPLGGCLPIVIQIPVFMALYWALLSSVEMRGAPWIGWVHDLSTPD------ 472

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFP 535
                PFY        I P++M++SMF+Q K++P P D  QA ++ +MP+ F      FP
Sbjct: 473 -----PFY--------ILPVLMAVSMFVQTKLNPTPPDPVQAKVMMFMPIAFSVMFFFFP 519

Query: 536 AGLIIYWSWSNVISIVQQAVIMKMHG 561
           AGL++YW  +N +SI QQ  I +M G
Sbjct: 520 AGLVLYWVVNNCLSIAQQWSINRMLG 545


>gi|152979764|ref|YP_001345393.1| putative inner membrane protein translocase component YidC
           [Actinobacillus succinogenes 130Z]
 gi|171704505|sp|A6VR61|OXAA_ACTSZ RecName: Full=Inner membrane protein oxaA
 gi|150841487|gb|ABR75458.1| 60 kDa inner membrane insertion protein [Actinobacillus
           succinogenes 130Z]
          Length = 537

 Score =  216 bits (550), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 124/375 (33%), Positives = 205/375 (54%), Gaps = 31/375 (8%)

Query: 186 VTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS-DIEKSSISN 244
           + N S + I   P G+ ++H    ++ +  +               +KYS D  K +  +
Sbjct: 179 IRNQSDETIEVQPYGQ-LKHTLVESSGSMAMPTYTGGAYSSSETNYKKYSFDDMKGANLS 237

Query: 245 FHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITT 304
            +    W+ +   Y+ S +IP+++        Y +  +      F    +T+  G + T 
Sbjct: 238 VNTKAGWVAVLQHYFVSAWIPNQDADNQ---LYTTTNNGMGFIGFRGPTVTVPAGATETV 294

Query: 305 TNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAI 364
              L+ G    P + +   ++A    ++ +D+GW +FIAKP+F L++   +LV N+G+AI
Sbjct: 295 KTALWTG----PKLQNQMGEVA-EHLDLTVDYGWAWFIAKPLFALLTLIQSLVSNWGLAI 349

Query: 365 MLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNI 424
           +  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++LYK   +
Sbjct: 350 IGVTLVVKAILYPLTKAQYTSMAKMRMLQPKLQEMRERFGDD-RQRMSQEMMKLYKEEKV 408

Query: 425 NPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYL 484
           NPL GC P+L+Q+P+F A+Y     ++E+RHAPF+GWI+DL+A D           P+Y 
Sbjct: 409 NPLGGCLPLLIQMPIFIALYWTFMEAVELRHAPFFGWIQDLSAQD-----------PYY- 456

Query: 485 PGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPAGLIIYWS 543
                  I P++M  SMF+  K+SP P AD  Q  ++N+MPV+F      FPAGL++YW 
Sbjct: 457 -------ILPLLMGGSMFLLQKLSPTPVADPMQQKVMNFMPVIFTVFFLWFPAGLVLYWL 509

Query: 544 WSNVISIVQQAVIMK 558
            SNVI+I+QQ +I +
Sbjct: 510 VSNVITIIQQQLIYR 524


>gi|260912766|ref|ZP_05919252.1| YidC/Oxa1 family membrane protein insertase [Pasteurella dagmatis
           ATCC 43325]
 gi|260633144|gb|EEX51309.1| YidC/Oxa1 family membrane protein insertase [Pasteurella dagmatis
           ATCC 43325]
          Length = 541

 Score =  216 bits (550), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 151/501 (30%), Positives = 252/501 (50%), Gaps = 50/501 (9%)

Query: 71  VELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYV--- 127
           + L+N  L   ++  G       L  +  ++ SN+P   L +  N  + Y A+   V   
Sbjct: 66  ITLENDVLRLKVDTLGGDVIHSELLKHDAELDSNTPFTLLTNKQN--HVYIAQSGLVGKD 123

Query: 128 ---STANNIELPNSNTVWNLISGK--ILTPTTPIKLVFKNANNILFERTISLDEH-YLFK 181
              + A           + L  G+  ++ P     LVF+  + + F +   L  + Y   
Sbjct: 124 GIDTKAGRASYQVEGDAFKLAEGQNELVVP-----LVFEK-DGVTFRKVFVLKRNAYDIS 177

Query: 182 IVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS--DIEK 239
           +   + N S   I   P G+ +RH     T    +               +KYS  +++K
Sbjct: 178 VNFEIDNQSEKAIEVEPYGQ-LRHTLVEDTGNVAMPTYTGGAYSSSETNYKKYSFDEMQK 236

Query: 240 SSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA-KFSANEITILP 298
           ++++       W+ +   Y+ S +IP+++    +Q   L+D      +  +      I  
Sbjct: 237 ANLA-VSTKAGWVAVLQHYFVSAWIPNQDAD--NQLYSLTDKANNLASIGYRGPTTVISA 293

Query: 299 GKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVG 358
           G   T T+ L+ G    P +      +A    ++ +D+GW +FIAKP+F L+++  ++V 
Sbjct: 294 GAKETITSSLWTG----PKLQDQMAAVA-NHLDLTVDYGWAWFIAKPLFWLLTFIQSIVH 348

Query: 359 NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQL 418
           N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F +   Q + + M++L
Sbjct: 349 NWGLAIIGVTLVVKAILYPLTKAQYTSMAKMRMLQPKLQEMRERFGED-RQRMSQEMMKL 407

Query: 419 YKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFG 478
           YK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A D         
Sbjct: 408 YKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQD--------- 458

Query: 479 ILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPAG 537
             P+Y        I PI+M  SMF+  KMSP P AD  Q  I+N+MP++F+     FP+G
Sbjct: 459 --PYY--------ILPILMGASMFLLQKMSPTPVADPMQQKIMNFMPLIFMVFFLWFPSG 508

Query: 538 LIIYWSWSNVISIVQQAVIMK 558
           L++YW  SN+I+I QQ +I +
Sbjct: 509 LVLYWLVSNLITIAQQQLIYR 529


>gi|254375202|ref|ZP_04990682.1| inner-membrane protein [Francisella novicida GA99-3548]
 gi|151572920|gb|EDN38574.1| inner-membrane protein [Francisella novicida GA99-3548]
          Length = 551

 Score =  216 bits (549), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 124/339 (36%), Positives = 199/339 (58%), Gaps = 34/339 (10%)

Query: 228 SLVEQKYSDIEKS----SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
           S  ++ + DI K+    ++ N  +   W+     Y+ S +IP + T+    +K L +G+ 
Sbjct: 239 SFRKESFKDISKTNGQPTVIN-SDGQGWVAFLQHYFVSAWIP-QSTNAKIYYKNL-NGNV 295

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
                F+    TI P +S   ++ L+ G    P I     DLA P  E  +D+G   F +
Sbjct: 296 FEAGAFTG--ATIAPNQSENISSILYTG----PIIKANLVDLA-PNLEKTLDYGMLSFFS 348

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           + +F +M++ ++LVGN+G+AI+L T  +KL+F+PL+ K Y S A M+ +QP+I  L+E +
Sbjct: 349 EIIFWVMNHIHSLVGNWGLAIILVTCLIKLIFYPLSAKSYRSMAKMRMLQPRIKRLQETY 408

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
           K    Q L K M++LYK   +NPL+GC P+L+QIP+F ++Y V+  S+E+R +PF  WI 
Sbjct: 409 KDDR-QALGKKMMELYKEEKVNPLSGCLPMLIQIPIFISLYWVLLESVELRQSPFIFWIH 467

Query: 464 DLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWM 523
           DL+  DP            Y        + P++M LSMF+Q K+SP PAD  QA ++ ++
Sbjct: 468 DLSMKDP------------YF-------VLPVLMGLSMFLQQKLSPAPADPMQAKVMMFL 508

Query: 524 PVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           PV+F F  +SFP+GL++YW  +N+ISI QQ +I + + A
Sbjct: 509 PVIFTFLFASFPSGLVLYWLTNNLISISQQWIITRHYQA 547


>gi|148550509|ref|YP_001270611.1| putative inner membrane protein translocase component YidC
           [Pseudomonas putida F1]
 gi|166977400|sp|A5WBB7|OXAA_PSEP1 RecName: Full=Inner membrane protein oxaA
 gi|148514567|gb|ABQ81427.1| protein translocase subunit yidC [Pseudomonas putida F1]
          Length = 560

 Score =  216 bits (549), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 132/379 (34%), Positives = 208/379 (54%), Gaps = 31/379 (8%)

Query: 182 IVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS--DIEK 239
           ++D  +  +     F+   R     P ++T T G      A L   S   +K S  DI+K
Sbjct: 200 LIDNQSGQAWSGNMFAQLKRDASGDPSSSTAT-GTATYLGAALWTASEPYKKVSMKDIDK 258

Query: 240 SSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPG 299
            S+   + S  W+     Y+ + +IP+K  +   Q +   D    Y   ++   I++  G
Sbjct: 259 GSLKE-NVSGGWVAWLQHYFVTAWIPAKSDNNVVQTR--KDSQGNYIIGYTGPVISVPAG 315

Query: 300 KSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGN 359
             + T+  L+AG    P I    K+L+ P  E+ +D+G+ +FIA+P+F L+ + ++L+GN
Sbjct: 316 GKVETSALLYAG----PKIQSKLKELS-PGLELTVDYGFLWFIAQPIFWLLQHIHSLLGN 370

Query: 360 FGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLY 419
           +G +I++ T+ +K LFFPL+   Y S A M+ + PK+  L+E+F     Q + +AM++LY
Sbjct: 371 WGWSIIVLTMLIKGLFFPLSAASYRSMARMRAVAPKLAALKERFGDD-RQKMSQAMMELY 429

Query: 420 KTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGI 479
           K   INPL GC PIL+Q+PVF A+Y V+  S+EMR AP+  WI DL+  D          
Sbjct: 430 KKEKINPLGGCLPILVQMPVFLALYWVLLESVEMRQAPWILWITDLSIKD---------- 479

Query: 480 LPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLI 539
            PF+        I PIIM  +MFIQ +++P P D  QA ++  MP++F F    FPAGL+
Sbjct: 480 -PFF--------ILPIIMGATMFIQQRLNPTPPDPMQAKVMKMMPIIFTFFFLWFPAGLV 530

Query: 540 IYWSWSNVISIVQQAVIMK 558
           +YW  +N +SI QQ  I +
Sbjct: 531 LYWVVNNCLSISQQWYITR 549


>gi|83649689|ref|YP_438124.1| putative inner membrane protein translocase component YidC [Hahella
           chejuensis KCTC 2396]
 gi|123529916|sp|Q2S6M5|OXAA_HAHCH RecName: Full=Inner membrane protein oxaA
 gi|83637732|gb|ABC33699.1| Preprotein translocase subunit YidC [Hahella chejuensis KCTC 2396]
          Length = 570

 Score =  216 bits (549), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 129/366 (35%), Positives = 207/366 (56%), Gaps = 36/366 (9%)

Query: 200 GRIMRHKPQ--TATNTFGVQEGFIAVLG--DKSLVEQKYSDIEKSSISNF--HESNSWLG 253
            +++R K    T +  FG      AV+   +K   +  +SD+E+S  S    + SN W+ 
Sbjct: 220 AKLVRDKSPDPTFSGGFGAASFLGAVVSTPEKPYEKIDFSDMEESGPSGVKVNSSNGWIA 279

Query: 254 ISDKYWASVFIP-SKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGA 312
               Y+ S +IP S +T  H+    L +G   Y   F   E T+ PG++      L+AG 
Sbjct: 280 FIQHYFVSAWIPLSNDT--HTYQTRLRNG--LYLMGFVDPEFTVEPGQTHNVGAKLYAG- 334

Query: 313 KEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVK 372
              P I    K++A P  ++ +D+GW + IAKP+++++ + ++ VGN+GIAI+L TV +K
Sbjct: 335 ---PKIMETLKEVA-PNLDLTVDFGWLWLIAKPLYLVLEFIHDYVGNWGIAIILLTVLIK 390

Query: 373 LLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWP 432
            LFF L+   Y S ANM+ + P++  +RE++     Q + +AM++LYK   INPL GC P
Sbjct: 391 ALFFHLSATSYRSMANMRRVTPEMQRIREQYGDD-RQRMSQAMMELYKKEKINPLGGCLP 449

Query: 433 ILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGI 492
           +L+Q+PVF ++Y V+  S+++R APF+ WI+DL+  DP   F L                
Sbjct: 450 MLVQMPVFISLYWVLLESVQLRQAPFFFWIQDLSIKDP--YFVL---------------- 491

Query: 493 WPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQ 552
            P++M  +MF+Q  ++P P D  QA ++  MP++F      FPAGL++YW  +N++SI Q
Sbjct: 492 -PLLMGAAMFLQTSLNPTPPDPIQARVMKMMPIIFTVFFLWFPAGLVLYWLVNNILSIAQ 550

Query: 553 QAVIMK 558
           Q  I K
Sbjct: 551 QWYITK 556


>gi|241667555|ref|ZP_04755133.1| hypothetical protein FphipA2_02215 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254876100|ref|ZP_05248810.1| inner-membrane protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254842121|gb|EET20535.1| inner-membrane protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 551

 Score =  215 bits (548), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 125/342 (36%), Positives = 201/342 (58%), Gaps = 34/342 (9%)

Query: 225 GDKSLVEQKYSDIEKS----SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
            + S  ++ + DI K+    ++ N  +   W+     Y+ S +IP    S  S+  Y + 
Sbjct: 236 ANDSFRKESFKDISKTNGQPTVIN-SQGLGWVAFIQHYFVSAWIPQ---SNDSKIYYKNL 291

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
            +  ++A  +   I+I P +S +  + L++G    P I     DLA P  E  +D+G   
Sbjct: 292 NNDVFEAG-AYTGISIAPNQSESIDSVLYSG----PIIKANLVDLA-PNLEKTLDYGMLS 345

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           F ++ +F +M+  ++LVGN+G+AI+L T  +KL+F+PL+ K Y S A M+ +QP++  L+
Sbjct: 346 FFSEIIFWVMNQIHSLVGNWGLAIILVTCLIKLIFYPLSAKSYRSMAKMRMLQPRVKRLQ 405

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E +K    Q L K M+++YK   +NPL+GC P+L+QIP+F ++Y V+  S+E+R APF  
Sbjct: 406 ETYKDDR-QALGKKMMEMYKEEKVNPLSGCLPMLIQIPIFISLYWVLLESVELRQAPFIF 464

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMIL 520
           WI DL+  DP   F L                 PI+M +SMF+Q K+SP PAD  QA I+
Sbjct: 465 WIHDLSMKDP--YFVL-----------------PILMGISMFLQQKLSPAPADPMQAKIM 505

Query: 521 NWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
            ++PV+F F  +SFP+GL++YW  +NVISI+QQ +I + + A
Sbjct: 506 MFLPVIFTFLFASFPSGLVLYWLTNNVISILQQWIITRHYQA 547


>gi|145634176|ref|ZP_01789887.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae PittAA]
 gi|148826353|ref|YP_001291106.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae PittEE]
 gi|166975868|sp|A5UD72|OXAA_HAEIE RecName: Full=Inner membrane protein oxaA
 gi|145268620|gb|EDK08613.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae PittAA]
 gi|148716513|gb|ABQ98723.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae PittEE]
          Length = 541

 Score =  215 bits (548), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 123/376 (32%), Positives = 210/376 (55%), Gaps = 31/376 (8%)

Query: 186 VTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYSDIEKSSISN 244
           + N S   I   P G++     +++ N       G      + +  +  ++D++ +++S 
Sbjct: 182 IDNQSGQAIEVEPYGQLKHSIVESSGNVAMPTYTGGAYSSSETNYKKYSFADMQDNNLS- 240

Query: 245 FHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA-KFSANEITILPGKSIT 303
                 W+ +   Y+ S +IP+++   ++Q   ++D      +  +    +TI  G   T
Sbjct: 241 IDTKAGWVAVLQHYFVSAWIPNQDV--NNQLYTITDSKNNVASIGYRGPVVTIPAGSQET 298

Query: 304 TTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIA 363
            T+ L+ G    P + +    +A    ++ +D+GW +FIAKP+F L+++   +V N+G+A
Sbjct: 299 ITSSLWTG----PKLQNQMATVA-NNLDLTVDYGWAWFIAKPLFWLLTFIQGIVSNWGLA 353

Query: 364 IMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHN 423
           I+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++LYK   
Sbjct: 354 IICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGDD-RQRMSQEMMKLYKEEK 412

Query: 424 INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY 483
           +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A D           P+Y
Sbjct: 413 VNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQD-----------PYY 461

Query: 484 LPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPAGLIIYW 542
                   I PI+M +SMF+  KMSP P  D  Q  ++N+MP++F+     FP+GL++YW
Sbjct: 462 --------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLIFMVFFLWFPSGLVLYW 513

Query: 543 SWSNVISIVQQAVIMK 558
             SN+I+I QQ +I +
Sbjct: 514 LVSNLITIAQQQLIYR 529


>gi|294638332|ref|ZP_06716585.1| membrane protein insertase, YidC/Oxa1 family [Edwardsiella tarda
           ATCC 23685]
 gi|291088585|gb|EFE21146.1| membrane protein insertase, YidC/Oxa1 family [Edwardsiella tarda
           ATCC 23685]
          Length = 555

 Score =  215 bits (548), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 153/539 (28%), Positives = 266/539 (49%), Gaps = 55/539 (10%)

Query: 41  QTVKQPNQVDNSYAAVLIDDRAQALSMSPR---VELKNPSLIGSINLKGAQFDDLNLRGY 97
           QT   P  V  +    + D  +QA+  S +   + +K   L  +IN +G   +  +L  Y
Sbjct: 38  QTDHNPQPVAQTAGQSVSDAASQAVPESGQGKLITVKTDVLALTINTRGGDIEQADLLAY 97

Query: 98  HLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIE-----LPNSN-TVWNLISGKILT 151
              + SN+P   L +         + L   S  +N       L N+N T + ++ G+   
Sbjct: 98  PATLGSNTPFQLLETTPQFIYQAQSGLTGKSGPDNPANGPRPLYNANQTSYEMLPGQ--- 154

Query: 152 PTTPIKLVFKNANNILFERTISLDEH-YLFKIVDTVTNNSIDQIRFSPRGRIM------R 204
               I L +   N +++ +T  L  + Y   +   V N+S + +  +  G++       +
Sbjct: 155 DELRIPLTYTAPNGVVYTKTFVLKRNDYAIAVDYKVKNDSHEALDLTLFGQLKQSVDLPK 214

Query: 205 HKPQTATNTFGVQEGFIAVLGDKSLVEQKYS--DIEKSSISNFHESNSWLGISDKYWASV 262
           H+  T ++ F +     A         QKYS  DIE  ++ N      W+ +  +Y+A+ 
Sbjct: 215 HR-DTGSSNFALHTFRGAAYSSSDDKYQKYSFSDIEDKNL-NVQTKGGWVAMLQQYFATA 272

Query: 263 FIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYE 322
           +IP    S  + F   + G+ +    + A  +++ P      +  L+ G +        +
Sbjct: 273 WIP--HDSGVNTFYTANLGNGQAAIGYKAPSVSVAPNTEQVLSTTLWVGPE-------LQ 323

Query: 323 KDLAI--PRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAK 380
            D+A   P  ++ +D+GW +FI++P+F L+   ++ VGN+G AI++ T  V+ + +PL K
Sbjct: 324 SDMAAVAPHLDLTVDYGWLWFISQPLFKLLQLIHSFVGNWGFAIIIITFIVRGIMYPLTK 383

Query: 381 KQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVF 440
            QY S A M+ +QPK+  +RE+      Q + + M+ LYK   +NPL GC+P+L+Q+P+F
Sbjct: 384 AQYTSMAKMRMLQPKLQAMRERIGDD-KQRMSQEMMALYKAEKVNPLGGCFPLLIQMPIF 442

Query: 441 FAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLS 500
            A+Y ++  S+E+R APF  WI DLAA D           P+Y        I PI+M ++
Sbjct: 443 LALYYMLMGSVELRQAPFALWIHDLAAPD-----------PYY--------ILPILMGVT 483

Query: 501 MFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           MF   KMSP    D  Q  I+ +MPV+F      FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 484 MFFIQKMSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYR 542


>gi|104784447|ref|YP_610945.1| putative inner membrane protein translocase component YidC
           [Pseudomonas entomophila L48]
 gi|123079038|sp|Q1I2H4|OXAA_PSEE4 RecName: Full=Inner membrane protein oxaA
 gi|95113434|emb|CAK18162.1| Preprotein translocase subunit YidC [Pseudomonas entomophila L48]
          Length = 561

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 128/365 (35%), Positives = 202/365 (55%), Gaps = 31/365 (8%)

Query: 196 FSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS--DIEKSSISNFHESNSWLG 253
           F+   R     P ++T T G      A L   S   +K S  D++K  +   + +  W+ 
Sbjct: 215 FAQLKRDASSDPSSSTAT-GTATYLGAALWTASEPYKKVSMKDMDKGGLQE-NVAGGWVA 272

Query: 254 ISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAK 313
               Y+ + +IPSK  +   Q +   D    Y   ++   + +  G  + T+  L+AG  
Sbjct: 273 WLQHYFVTAWIPSKSDNNAVQTR--KDSQGNYIIGYTGPALNVPAGGKVETSAMLYAG-- 328

Query: 314 EFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKL 373
             P I    K+L+ P  E+ +D+G+ +FIA+P+F L+ + ++L+GN+G +I++ T+ +K 
Sbjct: 329 --PKIQSKLKELS-PGLELTVDYGFLWFIAQPIFWLLQHIHSLLGNWGWSIIVLTMLIKG 385

Query: 374 LFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPI 433
           LFFPL+   Y S A M+ + PK+ +L+E+F     Q + +AM++LYK   INPL GC PI
Sbjct: 386 LFFPLSAASYRSMARMRAVAPKLAQLKERFGDD-RQKMSQAMMELYKKEKINPLGGCLPI 444

Query: 434 LLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIW 493
           L+Q+PVF A+Y V+  S+EMR AP+  WI DL+  D           PF+        I 
Sbjct: 445 LVQMPVFLALYWVLLESVEMRQAPWMLWITDLSIKD-----------PFF--------IL 485

Query: 494 PIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQ 553
           PIIM  +MFIQ +++P P D  QA ++  MP++F F    FPAGL++YW  +N +SI QQ
Sbjct: 486 PIIMGATMFIQQRLNPTPPDPMQAKVMKMMPIIFTFFFLWFPAGLVLYWVVNNCLSIAQQ 545

Query: 554 AVIMK 558
             I +
Sbjct: 546 WYITR 550


>gi|145632386|ref|ZP_01788121.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae 3655]
 gi|144987293|gb|EDJ93823.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae 3655]
          Length = 541

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 116/327 (35%), Positives = 194/327 (59%), Gaps = 30/327 (9%)

Query: 234 YSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA-KFSAN 292
           +SD++ +++S       W+ +   Y+ S +IP+++   ++Q   ++D      +  +   
Sbjct: 231 FSDMQDNNLS-IDTKAGWVAVLQHYFVSAWIPNQDV--NNQLYTITDSKNNVASIGYRGP 287

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
            ++I  G   T T+ L+ G    P + +    +A    ++ +D+GW +FIAKP+F L+++
Sbjct: 288 VVSIPAGSQETITSSLWTG----PKLQNQMATVA-NNLDLTVDYGWAWFIAKPLFWLLTF 342

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
              +V N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + 
Sbjct: 343 IQGIVSNWGLAIICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGDD-RQRMS 401

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           + M++LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A D   
Sbjct: 402 QEMMKLYKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQD--- 458

Query: 473 IFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFAL 531
                   P+Y        I PI+M +SMF+  KMSP P  D  Q  ++N+MP++F+   
Sbjct: 459 --------PYY--------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLIFMVFF 502

Query: 532 SSFPAGLIIYWSWSNVISIVQQAVIMK 558
             FP+GL++YW  SN+I+I QQ +I +
Sbjct: 503 LWFPSGLVLYWLVSNLITIAQQQLIYR 529


>gi|323700637|ref|ZP_08112549.1| membrane protein insertase, YidC/Oxa1 family [Desulfovibrio sp.
           ND132]
 gi|323460569|gb|EGB16434.1| membrane protein insertase, YidC/Oxa1 family [Desulfovibrio
           desulfuricans ND132]
          Length = 555

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 165/575 (28%), Positives = 265/575 (46%), Gaps = 66/575 (11%)

Query: 9   VAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQV---DNSYAAVLIDDRAQAL 65
           +A+ LS I+++ WQ +   P  E+     +     +Q           AA L  + A   
Sbjct: 11  IALVLSFIVLFGWQ-YLTGPSAEQKAEMARKAAEAEQKTAALTQKTQDAAELAKEAAPVA 69

Query: 66  SMSP----RVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
              P     V +  P        +G   +   L+ Y   +  +SP V L+ P    NA+ 
Sbjct: 70  DFVPTDGVSVTVDTPLYTAVFTSQGGVLEKFILKNYRETIQKDSPFVDLVGP----NAFA 125

Query: 122 -AELDYVSTANNIELPNSNTVWNLISGKILT----PTTPIKLVFKNANNILFERTISLD- 175
              L  + T N+ E           SG  LT      T         +    ER ++   
Sbjct: 126 KGPLGLILTLNDKEYHTWKRGKWAFSGSDLTLAEGDGTKTLTFTGQVDGYRIERVLTFHP 185

Query: 176 EHYLFKIVDTVTN----NSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVE 231
           + YL     TVTN     +   + F+   + M  +      T   +  ++     K + +
Sbjct: 186 DTYLIDESATVTNLTGTGAEGALSFTAAAKSMSDEDDRYNPT---KIAYLTKDTRKEMTD 242

Query: 232 QKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSA 291
           +   D++K  I+   +   W  I   Y+    IP  E +  S    + D   R       
Sbjct: 243 R--DDLKKDGITAPADLK-WGAIESNYFLFAVIPGGENASLS--GGVQDDIFRMAV---T 294

Query: 292 NEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMS 351
           ++ T +P  + T     F G  +   ++    DLA       +++GWF F+AKP+ + ++
Sbjct: 295 DKATFMPNVAKTLKTSYFVGPTDRKMLNAMPNDLADA-----VNFGWFDFLAKPLLVGLN 349

Query: 352 YFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVL 411
           +FY  VGN+G+AI++ TV +KL+F+PL++K Y S   MK +QP + +LREK+     ++ 
Sbjct: 350 FFYGFVGNYGVAIIILTVIIKLIFWPLSQKSYGSMEKMKKLQPMVAKLREKYGDDKQRLN 409

Query: 412 QKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG--------WIK 463
           Q+ M  LYKT+ +NP+ GC P+++QIPVFF +YK +  ++E+RHAPF          W+ 
Sbjct: 410 QETM-ALYKTYKVNPMGGCLPMVVQIPVFFGLYKALLGAVELRHAPFIAHLPFTDLPWLA 468

Query: 464 DLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWM 523
           DL+A D           P+Y        I PIIM  SMF+Q KM+P   D  Q  I+  M
Sbjct: 469 DLSAKD-----------PYY--------ISPIIMGASMFLQQKMTPSAGDPTQQKIMLIM 509

Query: 524 PVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           P+VF F    FP+GL+IYW ++N++SI QQ +I +
Sbjct: 510 PLVFTFMFLQFPSGLVIYWLFNNLLSIGQQLMIAR 544


>gi|170697750|ref|ZP_02888837.1| 60 kDa inner membrane insertion protein [Burkholderia ambifaria
           IOP40-10]
 gi|170137365|gb|EDT05606.1| 60 kDa inner membrane insertion protein [Burkholderia ambifaria
           IOP40-10]
          Length = 553

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 154/493 (31%), Positives = 242/493 (49%), Gaps = 45/493 (9%)

Query: 80  GSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSN 139
           G I+ +G     L L+    D       +TL       + Y A    +      + PN N
Sbjct: 90  GEIDTRGGTLAKLTLK-KQGDGKQPDLYITLFD-HTAGHTYLARTGLLGG----DFPNHN 143

Query: 140 TVWNLISGKILTPT---TPIKLVFKN--ANNILFERTISLDEHYLFKIVDTVTNNSIDQI 194
            V+  ++    + T     +KL F++     +   +T +         VDT  +N +   
Sbjct: 144 DVYTQVNAGPTSLTGDQNALKLSFESPVKGGVKVVKTYTFTRGSYVIGVDTKIDN-VGTA 202

Query: 195 RFSPRGRIMRHKPQTATNTFGVQEGFI--AVLGD-KSLVEQKYSDIEKSSISNFHES--N 249
             +P   +   +  TA  T      F+  AV  D K   +  +SD++K+  +NF ++  N
Sbjct: 203 PVTPTVYMELVRDNTAVETPMFSHTFLGPAVYTDAKHFQKIDFSDLDKNK-ANFEKTADN 261

Query: 250 SWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLF 309
            W+ +   Y+AS +IP +        + +    A Y+         I PG+S      LF
Sbjct: 262 GWVAMVQHYFASAWIPQQGAKRDIYAEKIDP--ALYRVGVKQPVAAIAPGQSADVQARLF 319

Query: 310 AGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTV 369
           AG +E   +         P  E++ D+GW   IAKP+F L+   +  VGN+G AI+L TV
Sbjct: 320 AGPEEERMLEGIA-----PGLELVKDYGWVTIIAKPLFWLLEKIHGFVGNWGWAIVLLTV 374

Query: 370 FVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAG 429
            +K +FFPL+   Y S A MK I P++  LRE+FK S PQ +  A+++LYKT  +NP  G
Sbjct: 375 LIKAVFFPLSAASYKSMARMKEITPRMQALRERFK-SDPQKMNAALMELYKTEKVNPFGG 433

Query: 430 CWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMH 489
           C P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  D           PF+      
Sbjct: 434 CLPVVIQIPVFISLYWVLLASVEMRGAPWILWIHDLSQRD-----------PFF------ 476

Query: 490 VGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVIS 549
             I P++M++SMF+Q  ++P P D  QA ++ +MP+ F      FPAGL++Y+  +NV+S
Sbjct: 477 --ILPVLMAVSMFVQTSLNPTPPDPVQAKMMKFMPIAFSVMFFFFPAGLVLYYVVNNVLS 534

Query: 550 IVQQAVIMKMHGA 562
           I QQ  I +  G 
Sbjct: 535 IAQQYYITRKLGG 547


>gi|167036430|ref|YP_001671661.1| putative inner membrane protein translocase component YidC
           [Pseudomonas putida GB-1]
 gi|189036357|sp|B0KRC1|OXAA_PSEPG RecName: Full=Inner membrane protein oxaA
 gi|166862918|gb|ABZ01326.1| 60 kDa inner membrane insertion protein [Pseudomonas putida GB-1]
          Length = 560

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 131/379 (34%), Positives = 207/379 (54%), Gaps = 31/379 (8%)

Query: 182 IVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS--DIEK 239
           ++D  +  +     F+   R     P ++T T G      A L   S   +K S  DI+K
Sbjct: 200 LIDNQSGQAWSGNMFAQLKRDASGDPSSSTAT-GTATYLGAALWTASEPYKKVSMKDIDK 258

Query: 240 SSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPG 299
             +   + S  W+     Y+ + +IP+K  +   Q +   D    Y   ++   I++  G
Sbjct: 259 GGLKE-NVSGGWVAWLQHYFVTAWIPAKSDNNVVQTR--KDSQGNYIIGYTGPVISVPAG 315

Query: 300 KSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGN 359
             + T+  L+AG    P I    K+L+ P  E+ +D+G+ +FIA+P+F L+ + ++L+GN
Sbjct: 316 GKVETSAMLYAG----PKIQSKLKELS-PGLELTVDYGFLWFIAQPIFWLLQHIHSLLGN 370

Query: 360 FGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLY 419
           +G +I++ T+ +K LFFPL+   Y S A M+ + PK+  L+E+F     Q + +AM++LY
Sbjct: 371 WGWSIIVLTMLIKGLFFPLSAASYRSMARMRAVAPKLAALKERFGDD-RQKMSQAMMELY 429

Query: 420 KTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGI 479
           K   INPL GC PIL+Q+PVF A+Y V+  S+EMR AP+  WI DL+  D          
Sbjct: 430 KKEKINPLGGCLPILVQMPVFLALYWVLLESVEMRQAPWMLWITDLSIKD---------- 479

Query: 480 LPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLI 539
            PF+        I PIIM  +MFIQ +++P P D  QA ++  MP++F F    FPAGL+
Sbjct: 480 -PFF--------ILPIIMGATMFIQQRLNPTPPDPMQAKVMKMMPIIFTFFFLWFPAGLV 530

Query: 540 IYWSWSNVISIVQQAVIMK 558
           +YW  +N +SI QQ  I +
Sbjct: 531 LYWVVNNCLSISQQWYITR 549


>gi|148266439|ref|YP_001233145.1| 60 kDa inner membrane insertion protein [Geobacter uraniireducens
           Rf4]
 gi|189036352|sp|A5G9V4|OXAA_GEOUR RecName: Full=Inner membrane protein oxaA
 gi|146399939|gb|ABQ28572.1| protein translocase subunit yidC [Geobacter uraniireducens Rf4]
          Length = 528

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 120/335 (35%), Positives = 188/335 (56%), Gaps = 28/335 (8%)

Query: 224 LGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
           L D  +  +K +D  K     + ++  W   +DKY+ +  +    +    +   ++  + 
Sbjct: 218 LADDKINTEKVADFSKGP-KQYDKNILWTAFADKYFMNAILSDNNSIAAVRLAKVNTNY- 275

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
             Q   S+  + + PG+S      +F G K+   +          R E  ID+GWF  +A
Sbjct: 276 -LQDDVSSPPLALNPGQSAAVNYRIFYGPKDLEILKGQGS-----RLEEAIDFGWFSALA 329

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           KP+   + +FY+   N+GIAI++ TV +KLLFFPL  K Y S   M+ +QPK+ EL+EKF
Sbjct: 330 KPLLRTLKFFYSYTHNYGIAIIIITVILKLLFFPLTHKSYKSMKEMQKLQPKMAELKEKF 389

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
           K      + +A++ LYKTH +NP+ GC P+++QIPVFFA+YK +  S+E+RHAPF  WI 
Sbjct: 390 KND-RDAMNRAVMDLYKTHKVNPMGGCLPMIVQIPVFFALYKALMFSIELRHAPFMLWIM 448

Query: 464 DLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWM 523
           DL+A D           P+Y        + P+IM ++MF+Q KM+P   D  QA ++  +
Sbjct: 449 DLSAKD-----------PYY--------VTPVIMGVTMFVQQKMTPSNMDPVQAKMMLAL 489

Query: 524 PVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           PVVF F   +FP+GL++YW  +N+++I QQ  I K
Sbjct: 490 PVVFTFMFLNFPSGLVLYWLVNNILTIAQQTYINK 524


>gi|115353266|ref|YP_775105.1| putative inner membrane protein translocase component YidC
           [Burkholderia ambifaria AMMD]
 gi|122321904|sp|Q0BAQ2|OXAA_BURCM RecName: Full=Inner membrane protein oxaA
 gi|115283254|gb|ABI88771.1| protein translocase subunit yidC [Burkholderia ambifaria AMMD]
          Length = 554

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 154/493 (31%), Positives = 242/493 (49%), Gaps = 45/493 (9%)

Query: 80  GSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSN 139
           G I+ +G     L L+    D       +TL       + Y A    +      + PN N
Sbjct: 91  GEIDTRGGTLAKLTLKK-QGDGKQPDLYITLFD-HTAGHTYLARTGLLGG----DFPNHN 144

Query: 140 TVWNLISGKILTPT---TPIKLVFKN--ANNILFERTISLDEHYLFKIVDTVTNNSIDQI 194
            V+  ++    + T     +KL F++     +   +T +         VDT  +N +   
Sbjct: 145 DVYTQVNAGPTSLTGDQNALKLSFESPVKGGVKVVKTYTFTRGSYVIGVDTKIDN-VGTA 203

Query: 195 RFSPRGRIMRHKPQTATNTFGVQEGFI--AVLGD-KSLVEQKYSDIEKSSISNFHES--N 249
             +P   +   +  TA  T      F+  AV  D K   +  +SD++K+  +NF ++  N
Sbjct: 204 PVTPTVYMELVRDNTAVETPMFSHTFLGPAVYTDAKHFQKIDFSDLDKNK-ANFEKAADN 262

Query: 250 SWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLF 309
            W+ +   Y+AS +IP +        + +    A Y+         I PG+S      LF
Sbjct: 263 GWVAMVQHYFASAWIPQQGAKRDIYAEKIDP--ALYRVGVKQPVAAIAPGQSADVQARLF 320

Query: 310 AGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTV 369
           AG +E   +         P  E++ D+GW   IAKP+F L+   +  VGN+G AI+L TV
Sbjct: 321 AGPEEERMLEGIA-----PGLELVKDYGWVTIIAKPLFWLLEKIHGFVGNWGWAIVLLTV 375

Query: 370 FVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAG 429
            +K +FFPL+   Y S A MK I P++  LRE+FK S PQ +  A+++LYKT  +NP  G
Sbjct: 376 LIKAVFFPLSAASYKSMARMKEITPRMQALRERFK-SDPQKMNSALMELYKTEKVNPFGG 434

Query: 430 CWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMH 489
           C P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  D           PF+      
Sbjct: 435 CLPVVIQIPVFISLYWVLLASVEMRGAPWILWIHDLSQRD-----------PFF------ 477

Query: 490 VGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVIS 549
             I P++M++SMF+Q  ++P P D  QA ++ +MP+ F      FPAGL++Y+  +NV+S
Sbjct: 478 --ILPVLMAVSMFVQTSLNPTPPDPVQAKMMKFMPIAFSVMFFFFPAGLVLYYVVNNVLS 535

Query: 550 IVQQAVIMKMHGA 562
           I QQ  I +  G 
Sbjct: 536 IAQQYYITRKLGG 548


>gi|206558829|ref|YP_002229589.1| putative inner membrane protein translocase component YidC
           [Burkholderia cenocepacia J2315]
 gi|254772759|sp|B4E7D5|OXAA_BURCJ RecName: Full=Inner membrane protein oxaA
 gi|198034866|emb|CAR50738.1| putative membrane protein [Burkholderia cenocepacia J2315]
          Length = 552

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 155/493 (31%), Positives = 241/493 (48%), Gaps = 45/493 (9%)

Query: 80  GSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSN 139
           G I+ +G     L L+    D       +TL       + Y A    +      + PN N
Sbjct: 89  GEIDTRGGTLAKLTLKK-QGDGKQPDLYITLFD-HTAGHTYLARTGLLGG----DFPNHN 142

Query: 140 TVWNLI---SGKILTPTTPIKLVFKN--ANNILFERTISLDEHYLFKIVDTVTNNSIDQI 194
            V+  +   S  +      +KL F++     +   +T +         VDT  +N +   
Sbjct: 143 DVYTQLNPGSTSLTGDQNTLKLSFESPVKGGVKVVKTYTFTRGSYVIGVDTKIDN-VGTA 201

Query: 195 RFSPRGRIMRHKPQTATNTFGVQEGFI--AVLGD-KSLVEQKYSDIEKSSISNFHES--N 249
             +P   +   +  TA  T      F+  AV  D K   +  +SD++K+  +NF +S  N
Sbjct: 202 PVTPTVYMELVRDNTAVETPMFSHTFLGPAVYTDAKHFQKIDFSDLDKNK-ANFEKSADN 260

Query: 250 SWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLF 309
            W+ +   Y+AS +IP +        + +    A Y+         I PG+S      LF
Sbjct: 261 GWVAMVQHYFASAWIPQQGAKRDIYAEKIDP--ALYRVGVKQPVAAIAPGQSADVQARLF 318

Query: 310 AGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTV 369
           AG +E   +         P  E++ D+GW   IAKP+F L+   +  VGN+G AI+L TV
Sbjct: 319 AGPEEERMLEGIA-----PGLELVKDYGWVTIIAKPLFWLLEKIHGYVGNWGWAIVLLTV 373

Query: 370 FVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAG 429
            +K +FFPL+   Y S A MK I P++  LRE+FK S PQ +  A+++LYKT  +NP  G
Sbjct: 374 LIKAVFFPLSAASYKSMARMKEITPRMQALRERFK-SDPQKMNAALMELYKTEKVNPFGG 432

Query: 430 CWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMH 489
           C P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  D           PF+      
Sbjct: 433 CLPVVIQIPVFISLYWVLLASVEMRGAPWILWIHDLSQRD-----------PFF------ 475

Query: 490 VGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVIS 549
             I P++M++SMF+Q  ++P P D  QA ++ +MP+ F      FPAGL++Y+  +NV+S
Sbjct: 476 --ILPVLMAVSMFVQTSLNPTPPDPVQAKMMKFMPIAFSVMFFFFPAGLVLYYVVNNVLS 533

Query: 550 IVQQAVIMKMHGA 562
           I QQ  I +  G 
Sbjct: 534 IAQQYYITRKLGG 546


>gi|170734513|ref|YP_001766460.1| putative inner membrane protein translocase component YidC
           [Burkholderia cenocepacia MC0-3]
 gi|254772758|sp|B1K0Y4|OXAA_BURCC RecName: Full=Inner membrane protein oxaA
 gi|169817755|gb|ACA92338.1| 60 kDa inner membrane insertion protein [Burkholderia cenocepacia
           MC0-3]
          Length = 553

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 155/493 (31%), Positives = 241/493 (48%), Gaps = 45/493 (9%)

Query: 80  GSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSN 139
           G I+ +G     L L+    D       +TL       + Y A    +      + PN N
Sbjct: 90  GEIDTRGGTLAKLTLKK-QGDGKQPDLYITLFD-HTAGHTYLARTGLLGG----DFPNHN 143

Query: 140 TVWNLI---SGKILTPTTPIKLVFKN--ANNILFERTISLDEHYLFKIVDTVTNNSIDQI 194
            V+  +   S  +      +KL F++     +   +T +         VDT  +N +   
Sbjct: 144 DVYTQLNPGSTSLTGDQNTLKLSFESPVKGGVKVVKTYTFTRGSYVIGVDTKIDN-VGTA 202

Query: 195 RFSPRGRIMRHKPQTATNTFGVQEGFI--AVLGD-KSLVEQKYSDIEKSSISNFHES--N 249
             +P   +   +  TA  T      F+  AV  D K   +  +SD++K+  +NF +S  N
Sbjct: 203 PVTPTVYMELVRDNTAVETPMFSHTFLGPAVYTDAKHFQKIDFSDLDKNK-ANFEKSADN 261

Query: 250 SWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLF 309
            W+ +   Y+AS +IP +        + +    A Y+         I PG+S      LF
Sbjct: 262 GWVAMVQHYFASAWIPQQGAKRDIYAEKIDP--ALYRVGVKQPVAAIAPGQSADVQARLF 319

Query: 310 AGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTV 369
           AG +E   +         P  E++ D+GW   IAKP+F L+   +  VGN+G AI+L TV
Sbjct: 320 AGPEEERMLEGIA-----PGLELVKDYGWVTIIAKPLFWLLEKIHGYVGNWGWAIVLLTV 374

Query: 370 FVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAG 429
            +K +FFPL+   Y S A MK I P++  LRE+FK S PQ +  A+++LYKT  +NP  G
Sbjct: 375 LIKAVFFPLSAASYKSMARMKEITPRMQALRERFK-SDPQKMNAALMELYKTEKVNPFGG 433

Query: 430 CWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMH 489
           C P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  D           PF+      
Sbjct: 434 CLPVVIQIPVFISLYWVLLASVEMRGAPWILWIHDLSQRD-----------PFF------ 476

Query: 490 VGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVIS 549
             I P++M++SMF+Q  ++P P D  QA ++ +MP+ F      FPAGL++Y+  +NV+S
Sbjct: 477 --ILPVLMAVSMFVQTSLNPTPPDPVQAKMMKFMPIAFSVMFFFFPAGLVLYYVVNNVLS 534

Query: 550 IVQQAVIMKMHGA 562
           I QQ  I +  G 
Sbjct: 535 IAQQYYITRKLGG 547


>gi|254363130|ref|ZP_04979180.1| Oxa1 family cytochrome oxidase biogenesis protein [Mannheimia
           haemolytica PHL213]
 gi|261491963|ref|ZP_05988540.1| Oxa1 family cytochrome oxidase biogenesis protein [Mannheimia
           haemolytica serotype A2 str. BOVINE]
 gi|261496234|ref|ZP_05992639.1| Oxa1 family cytochrome oxidase biogenesis protein [Mannheimia
           haemolytica serotype A2 str. OVINE]
 gi|153095021|gb|EDN75576.1| Oxa1 family cytochrome oxidase biogenesis protein [Mannheimia
           haemolytica PHL213]
 gi|261308065|gb|EEY09363.1| Oxa1 family cytochrome oxidase biogenesis protein [Mannheimia
           haemolytica serotype A2 str. OVINE]
 gi|261312430|gb|EEY13556.1| Oxa1 family cytochrome oxidase biogenesis protein [Mannheimia
           haemolytica serotype A2 str. BOVINE]
          Length = 541

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 126/406 (31%), Positives = 219/406 (53%), Gaps = 33/406 (8%)

Query: 156 IKLVFKNANNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-T 213
           + L F+    +++ +T +L    Y   +   + NN+   I   P G++     +++ N T
Sbjct: 154 VPLTFEK-EGVVYTKTFTLKRGSYDVGVNFNIKNNTAQAIEVQPYGQLKHSIVESSGNLT 212

Query: 214 FGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHS 273
                G      + +  +  + D+EK+++S       W+ +   Y+ S ++P+++   +S
Sbjct: 213 MPTYTGGAYSSSETNYKKYSFQDMEKANLS-VDTKAGWIAVLQHYFVSAWVPNQDAD-NS 270

Query: 274 QFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEML 333
            +   ++G A     +     TI P       + L+ G+K+       E   +    ++ 
Sbjct: 271 LYSRTNNGVATI--GYRGPLTTIAPNSEANLNSKLWTGSKD-----QKEMGESANHLDLT 323

Query: 334 IDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQ 393
           +D+GW +FIAKP+F L++    +V N+G+AI+  T+ VK + +PL K QY S A M+ +Q
Sbjct: 324 VDYGWAWFIAKPLFWLLTAIQKIVSNWGLAIIGVTIVVKTILYPLTKAQYTSMAKMRMLQ 383

Query: 394 PKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEM 453
           P+I E+RE+F     Q + + M++LY+   +NP+ GC PIL+Q+P+F A+Y     ++E+
Sbjct: 384 PRITEMRERFGDD-RQRMSQEMMKLYREEKVNPMGGCLPILIQMPIFIALYWTFMEAVEL 442

Query: 454 RHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-A 512
           RHAPF+GWI+DL+A D           P+Y        I P++M  SMF+  KMSP P A
Sbjct: 443 RHAPFFGWIQDLSAQD-----------PYY--------ILPLLMGGSMFLLQKMSPTPVA 483

Query: 513 DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           D  Q  ++ +MPV+F      FP+GL++YW  SN+I+I QQ +I +
Sbjct: 484 DPVQQKVMTFMPVIFTVFFLWFPSGLVLYWLTSNLITIAQQWLIYR 529


>gi|302035743|ref|YP_003796065.1| inner-membrane protein insertion factor OxaA [Candidatus Nitrospira
           defluvii]
 gi|300603807|emb|CBK40139.1| Inner-membrane protein insertion factor OxaA [Candidatus Nitrospira
           defluvii]
          Length = 580

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 125/366 (34%), Positives = 191/366 (52%), Gaps = 44/366 (12%)

Query: 209 TATNTFGV---QEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIP 265
           T    FG+    EGFI ++G  SLV+ K         +       W  I DKY+ SV +P
Sbjct: 217 TLGTNFGIVEWGEGFIGLMGSASLVDDKVLKETPDGEAERKGDVKWSAIQDKYFLSVLMP 276

Query: 266 SKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDL 325
            K ++  +  K   D       +F+       P    T    L+AG KE+ T+      L
Sbjct: 277 QKASAALA--KKEGDKLVSAGVRFAT------PVNGATMAMQLYAGPKEYDTLKRLNVGL 328

Query: 326 AIPRFEMLIDWGWFYF--------IAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFP 377
                E  ID+GWF F        +AKP+F ++ + Y    N+G+ I+L T+ +KL+F P
Sbjct: 329 -----EDTIDFGWFVFGSWGLVKAVAKPIFYVLRFLYEFTHNYGVTIILLTMLIKLMFVP 383

Query: 378 LAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQI 437
           L  K Y S   M+ IQPK+  L+ KFK    + L K +I+LYK H +NP+ GC P++LQ+
Sbjct: 384 LQYKSYKSMKQMQVIQPKVLALQTKFKDDRER-LNKELIKLYKDHRVNPVGGCLPMVLQM 442

Query: 438 PVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIM 497
           PVF A++ ++ +++++R APF  WIKDL+  D           P+Y        + PI+M
Sbjct: 443 PVFVALFNILYMTIDLRQAPFMLWIKDLSVQD-----------PYY--------VLPIVM 483

Query: 498 SLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIM 557
             +M IQ K++P   D  QA I+ ++PV   F   +FPAGL++YW  +N ++I QQ V  
Sbjct: 484 GATMVIQQKITPTTMDPTQAKIMLFLPVFMTFLFVNFPAGLVLYWLTNNTLTITQQVVTE 543

Query: 558 KMHGAE 563
           ++ G +
Sbjct: 544 RLFGKK 549


>gi|172062138|ref|YP_001809790.1| putative inner membrane protein translocase component YidC
           [Burkholderia ambifaria MC40-6]
 gi|254772757|sp|B1YQJ7|OXAA_BURA4 RecName: Full=Inner membrane protein oxaA
 gi|171994655|gb|ACB65574.1| 60 kDa inner membrane insertion protein [Burkholderia ambifaria
           MC40-6]
          Length = 554

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 154/493 (31%), Positives = 242/493 (49%), Gaps = 45/493 (9%)

Query: 80  GSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSN 139
           G I+ +G     L L+    D       +TL       + Y A    +      + PN N
Sbjct: 91  GEIDTRGGTLAKLTLKK-QGDGKQPDLYITLFD-HTAGHTYLARTGLLGG----DFPNHN 144

Query: 140 TVWNLISGKILTPT---TPIKLVFKN--ANNILFERTISLDEHYLFKIVDTVTNNSIDQI 194
            V+  ++    + T     +KL F++     +   +T +         VDT  +N +   
Sbjct: 145 DVYTQVNAGPTSLTGDQNALKLSFESPVKGGVKVVKTYTFTRGSYVIGVDTKIDN-VGTA 203

Query: 195 RFSPRGRIMRHKPQTATNTFGVQEGFI--AVLGD-KSLVEQKYSDIEKSSISNFHES--N 249
             +P   +   +  TA  T      F+  AV  D K   +  +SD++K+  +NF ++  N
Sbjct: 204 PVTPTVYMELVRDNTAVETPMFSHTFLGPAVYTDAKHFQKIDFSDLDKNK-ANFEKAADN 262

Query: 250 SWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLF 309
            W+ +   Y+AS +IP +        + +    A Y+         I PG+S      LF
Sbjct: 263 GWVAMVQHYFASAWIPQQGAKRDIYAEKIDP--ALYRVGVKQPVAAIAPGQSADVQARLF 320

Query: 310 AGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTV 369
           AG +E   +         P  E++ D+GW   IAKP+F L+   +  VGN+G AI+L TV
Sbjct: 321 AGPEEERMLEGIA-----PGLELVKDYGWVTIIAKPLFWLLEKIHGFVGNWGWAIVLLTV 375

Query: 370 FVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAG 429
            +K +FFPL+   Y S A MK I P++  LRE+FK S PQ +  A+++LYKT  +NP  G
Sbjct: 376 LIKAVFFPLSAASYKSMARMKEITPRMQALRERFK-SDPQKMNAALMELYKTEKVNPFGG 434

Query: 430 CWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMH 489
           C P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  D           PF+      
Sbjct: 435 CLPVVIQIPVFISLYWVLLASVEMRGAPWILWIHDLSQRD-----------PFF------ 477

Query: 490 VGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVIS 549
             I P++M++SMF+Q  ++P P D  QA ++ +MP+ F      FPAGL++Y+  +NV+S
Sbjct: 478 --ILPVLMAVSMFVQTSLNPTPPDPVQAKMMKFMPIAFSVMFFFFPAGLVLYYVVNNVLS 535

Query: 550 IVQQAVIMKMHGA 562
           I QQ  I +  G 
Sbjct: 536 IAQQYYITRKLGG 548


>gi|303256374|ref|ZP_07342388.1| inner membrane protein OxaA [Burkholderiales bacterium 1_1_47]
 gi|331001500|ref|ZP_08325118.1| membrane protein insertase, YidC/Oxa1 family domain protein
           [Parasutterella excrementihominis YIT 11859]
 gi|302859865|gb|EFL82942.1| inner membrane protein OxaA [Burkholderiales bacterium 1_1_47]
 gi|329568229|gb|EGG50046.1| membrane protein insertase, YidC/Oxa1 family domain protein
           [Parasutterella excrementihominis YIT 11859]
          Length = 565

 Score =  214 bits (546), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 157/535 (29%), Positives = 251/535 (46%), Gaps = 47/535 (8%)

Query: 41  QTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQ---FDDLNLRGY 97
           QT   P +   +  A  I      L +S   + +   +IGS   K  Q   + D  L G 
Sbjct: 59  QTASLPAEAKTAVKAEPIQVETDLLKLS--FDPEGAVIIGSELRKEKQTIPWTDTGLVGM 116

Query: 98  HLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIK 157
            L   + +P   +L        Y A+   +        P   T + L+ G +        
Sbjct: 117 ILGNKAETPADVVLFTEQKGRTYLAQTGLIGGP----YPTHKTQFKLVPGPLKMADGQDN 172

Query: 158 LVFK---NANNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFSPRGRIMR--HKPQTAT 211
           L  K    +  +   ++ + +  HY  K+   V NN+  +I+ S   ++ R   KP+  +
Sbjct: 173 LTVKFEGESGGVKVIKSFTFERGHYGIKVSHEVVNNTASEIKPSVYYQLTRDGEKPEGES 232

Query: 212 NTFGVQEGFIAVLGDKSLVEQ-KYSDIEKSSISNFHE--SNSWLGISDKYWASVFIPSKE 268
                  G  AV  DK   ++  +SDI      +F     N W+ +   Y+ S ++P++ 
Sbjct: 233 TMVNAYTG-AAVYTDKDKFQKVSFSDIADGD-KDFQAKADNGWIAMIQHYFVSAWVPTQG 290

Query: 269 TSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIP 328
               +    +  G   Y         TI P  S T    L++G ++         D   P
Sbjct: 291 VERENYTNTV--GEKLYAVGSIQQMDTIAPNSSKTIEATLYSGPQD-----QTRLDAIAP 343

Query: 329 RFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTAN 388
              +++D+GW  F+AKP++ L+S+ Y +VGN+G AI+L T  VK + +PL+   Y S A 
Sbjct: 344 GLSLVVDYGWLTFLAKPIYWLLSFLYGIVGNWGWAIVLLTCIVKAILYPLSLAGYRSMAK 403

Query: 389 MKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVIS 448
           MK++ P++  L+EK+     Q L  AM+++YKT  INP+ GC PI LQ+PVF A+Y V+ 
Sbjct: 404 MKDLGPRMKALKEKYGDD-KQRLNMAMMEMYKTEKINPVGGCLPIALQLPVFLALYWVLL 462

Query: 449 ISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMS 508
            S+E+R AP+  W+ DLAA DP  I                    PI+M ++M IQ K++
Sbjct: 463 ASVELRDAPWIFWVTDLAAPDPWFIL-------------------PILMIITMVIQFKLN 503

Query: 509 PPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           P P D  QA ++  MP VF      F +GL++YW  +N++SI+QQ V+ K   A+
Sbjct: 504 PTPPDPVQAKMMAIMPFVFGIMFIFFASGLVLYWLVNNILSIIQQYVVNKQIEAD 558


>gi|327398260|ref|YP_004339129.1| Membrane protein oxaA [Hippea maritima DSM 10411]
 gi|327180889|gb|AEA33070.1| Membrane protein oxaA [Hippea maritima DSM 10411]
          Length = 522

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 108/307 (35%), Positives = 177/307 (57%), Gaps = 37/307 (12%)

Query: 247 ESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTN 306
           E   W+ +  KY+   F+P    S  + +  L+DG+  Y    S  ++TI          
Sbjct: 234 EDIHWIALESKYFCFAFLPQNSNSLLAGYTKLNDGNYVYVNLESPAKLTI---------- 283

Query: 307 FLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIML 366
             +AG K   TI   +  L     + +I +G F FI KP+  ++++ Y++ GN+G+AI++
Sbjct: 284 --YAGPKSKETIAAVDHKL-----DKIIRFGMFGFIGKPLLYVLNWLYSIFGNYGVAIIV 336

Query: 367 TTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINP 426
            T  ++L+F+PL+ K + S   M  +QPK+ EL+ K+K  P Q L KA ++LYK H +NP
Sbjct: 337 LTFLIRLIFYPLSFKSFKSMKEMAKLQPKLKELQAKYKGKPDQ-LNKATMELYKKHKVNP 395

Query: 427 LAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPG 486
             GC P+++QIPVFFA+Y V+  ++E+R APF  WI DL++ D           P+Y   
Sbjct: 396 FGGCLPVVIQIPVFFALYNVLLNAIELRGAPFMLWITDLSSKD-----------PYY--- 441

Query: 487 FMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSN 546
                + PI+M L+M++Q K++P   D  Q  I+ +MP++F F    FP+GL++YW+ +N
Sbjct: 442 -----VLPILMGLTMYVQQKLTPATGDPTQQKIMMFMPLIFTFMFMGFPSGLVLYWATNN 496

Query: 547 VISIVQQ 553
           +++I QQ
Sbjct: 497 LLTIAQQ 503


>gi|146328851|ref|YP_001209838.1| preprotein translocase subunit YidC [Dichelobacter nodosus
           VCS1703A]
 gi|146232321|gb|ABQ13299.1| preprotein translocase subunit YidC [Dichelobacter nodosus
           VCS1703A]
          Length = 544

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 161/549 (29%), Positives = 263/549 (47%), Gaps = 76/549 (13%)

Query: 41  QTVKQPNQVDNSYAAVLIDDRAQALSMSP-RVELKNPSLIGSINLKGAQFDDLNLRGYHL 99
           QTVK+   +D           A   S +P RV +K   L  + + +GA   +  L  Y  
Sbjct: 42  QTVKKTETLDQQPPI-----SASETSEAPDRVRVKTDVLDIAFSTQGASIVEAKLLNYAF 96

Query: 100 DVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTP---- 155
            + + SP+ TLL   N     F +   VS +     PN  + W     + + P       
Sbjct: 97  TIDNKSPL-TLLHAENPSRMVF-QSGLVSQSGTTA-PNHFSQWKSAQKEYVLPDDAEHIS 153

Query: 156 IKLVFKNANNILFERTISLDEH-YLFKIVDTVTNNS--------IDQIRFSPRGRIMRHK 206
           +   +++ + + F +T +     Y F+I +TV N S          QI F    + M   
Sbjct: 154 VPFTWEDEHGVRFTKTFTFHRGTYRFEIEETVENQSERPWQGFAYRQIAFGEAAK-MGGL 212

Query: 207 PQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHES-------NSWLGISDKYW 259
            Q AT T  V           S  E +Y+ IE   I++  ++         W+ +   Y+
Sbjct: 213 GQVATFTGAV----------TSSEENRYNKIELKDIASAKKAKLNEVTQTGWVAMMQHYF 262

Query: 260 ASVFIPSK--ETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPT 317
            +  +P    E   ++Q+      +  +       E+TI P  +    +  + G K    
Sbjct: 263 LAAVVPQSGVENRLYTQYD-----NGDHIVGTHDKEVTIAPRDTHHFKSTGYIGPK---- 313

Query: 318 IHHYEKDLAI--PRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLF 375
                K+L+   P  +  ID+G+ + I++ MF +M++ Y ++GN+G AI++ T+ +K LF
Sbjct: 314 ---ISKNLSAIAPYLDKTIDYGYLFMISQLMFHVMTFIYTVIGNWGGAIIVMTLLIKCLF 370

Query: 376 FPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILL 435
           F  +   Y S A M+ +QP+I+ L+ ++ +   Q   +AM+QLY+   +NP +GC P+LL
Sbjct: 371 FVPSAWAYKSMAKMRALQPEINRLKAQYGEDK-QAFSQAMMQLYRDRKVNPASGCLPMLL 429

Query: 436 QIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPI 495
           QIP F A Y V++ S+E+RHAP+ GWI+DL++ DP  I                    PI
Sbjct: 430 QIPFFIAFYWVLAESVELRHAPWIGWIQDLSSMDPLYIL-------------------PI 470

Query: 496 IMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAV 555
           I +  MF+Q K++PPP D  QA ++  MP+VF F    FP+GL++YW+ SN  SIVQQ V
Sbjct: 471 INAALMFLQQKLNPPPPDPTQAKVMMMMPLVFGFMFMWFPSGLVLYWTMSNAFSIVQQYV 530

Query: 556 IMKMHGAEI 564
           + K +G  +
Sbjct: 531 MNKRYGQRV 539


>gi|134096616|ref|YP_001101691.1| preprotein translocase membrane subunit [Herminiimonas
           arsenicoxydans]
 gi|166975870|sp|A4GAN3|OXAA_HERAR RecName: Full=Inner membrane protein oxaA
 gi|133740519|emb|CAL63570.1| Inner membrane protein OxaA [Herminiimonas arsenicoxydans]
          Length = 569

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 147/481 (30%), Positives = 242/481 (50%), Gaps = 30/481 (6%)

Query: 81  SINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNT 140
            I+  G +   L L  +H     +  +V  L   N ++ Y  +   +  A     PN  +
Sbjct: 97  GIDTAGGEVRHLELLKHHESGDESKNVV--LFDENGQHTYLGQTGLIGGA----YPNHKS 150

Query: 141 VWNLISG-KILTPTTPIKLVFKNAN-NILFERTISLDE-HYLFKIVDTVTNNSIDQIRFS 197
           ++  + G + L     ++LV ++    +   +T +     Y   I   V NN+   I  S
Sbjct: 151 MFAAVPGPRTLDSANQVQLVLQSEQQGVKLIKTFTFKRGEYKVDIKHDVVNNTSTAITPS 210

Query: 198 PRGRIMRHKPQTATNTFGVQEGF----IAVLGDKSLVEQKYSDIEKSSISNFHESNS-WL 252
              +++         +  +   F    I    DK   +  +  IEK    +  +  S W+
Sbjct: 211 LYLQLVHDGSALGGGSMFMASAFTGPAIYTEADK-FQKVTFESIEKGKAEHAMKGESGWI 269

Query: 253 GISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGA 312
            +   Y+ S F+P   T      K L+     Y         T+ PG + +    +++G 
Sbjct: 270 ALVQHYFVSAFVPPANTPREYFTKKLATN--LYAVGTILPMGTVAPGATASMDTTMYSGP 327

Query: 313 KEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVK 372
           +E   +     +   P FE++ D+GW   IAKP+F LM   + ++GN+G  I++ T+ +K
Sbjct: 328 QESKRL-----EAVAPGFELVKDYGWLTIIAKPIFWLMMQIHQILGNWGWTIIVLTIVIK 382

Query: 373 LLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWP 432
           L FFPL+   Y S A MK + PK+ ++R ++K   PQ +  AM++LYK   INP+ GC+P
Sbjct: 383 LAFFPLSAAGYRSMAKMKLVTPKMTDIRTRYK-GEPQKMNAAMMELYKKEKINPIGGCFP 441

Query: 433 ILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGI 492
           +L+QIPVF ++Y V+  S+E+R+A  W WI DLAA  P  +F  + I  F+L     +GI
Sbjct: 442 MLVQIPVFISLYWVLLASVEIRNAS-WLWIHDLAA--PDILFGSYHIGTFHLT----IGI 494

Query: 493 WPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQ 552
            PI+M++SMFIQ K++P P D  QA ++ +MP+ F      FPAGL++YW  +N++SI Q
Sbjct: 495 LPILMAISMFIQTKLNPTPPDPIQAKVMMFMPIAFSVMFFFFPAGLVLYWVVNNILSIAQ 554

Query: 553 Q 553
           Q
Sbjct: 555 Q 555


>gi|307825357|ref|ZP_07655576.1| membrane protein insertase, YidC/Oxa1 family domain containing
           [Methylobacter tundripaludum SV96]
 gi|307733532|gb|EFO04390.1| membrane protein insertase, YidC/Oxa1 family domain containing
           [Methylobacter tundripaludum SV96]
          Length = 585

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 153/515 (29%), Positives = 247/515 (47%), Gaps = 56/515 (10%)

Query: 71  VELKNPSLIGSINLKGAQFDDLNLRGYHLDVSS-----------------NSPIVTLLSP 113
           + +K   L   I+LKG    +L+L  Y ++ S+                 N+  V L + 
Sbjct: 94  ITVKTDVLALQIDLKGGTIQNLDLLTYPIEKSNTVVDKLRAMIGLSVAEKNTAPVRLFNS 153

Query: 114 SNTKNAYFAELDYVSTANNIELPNSNTVW-NLISGKILTP---TTPIKLVFKNANNILFE 169
           S  K  + A+   ++ +     P+ +TV+ N  +   L P   +  + L + + N +   
Sbjct: 154 SQEK-LFVAQSGLIADSGFATAPSHHTVFKNEQTNYDLQPGQDSLTVPLTWTDNNGLTIT 212

Query: 170 RTISLDE-HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKS 228
           +  +     Y   +   V N+S          ++++  P T +    +  G  A  G   
Sbjct: 213 KLFTFKRGSYDITLEQKVKNDSAKPWSGRQYSQLLK-APDTTSKGGMLTGGMRAYDGGVI 271

Query: 229 LVE-QKYSDIEKSSISN----FHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
             E +KY  I    +S+          W  +   Y+AS +IP  +   H   K L+DGH 
Sbjct: 272 YTEKEKYQKISFDDMSDENLDVATKGGWTALIQHYFASAWIPPADQENHFYTKVLNDGH- 330

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
            Y     +  +T+           LFAG K  P +         P  E+ +D+ +  FI 
Sbjct: 331 -YVIGTYSAPVTVNANSDAQFVAQLFAGPKIQPMMEKIA-----PGLELTVDYSFLTFIG 384

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           KP++ L++  ++  GN+G+AI+  T+ +KLLFFPL++  Y S A M+ IQP++ EL+E+F
Sbjct: 385 KPIYWLLNQIHDAAGNWGVAIIGVTLCIKLLFFPLSQSSYKSMAKMRKIQPRLKELQERF 444

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
               P+     M+ LYK   +NPL GC PIL+QIPVF  +Y V+S ++E RHAPF  WI+
Sbjct: 445 ADDRPR-FNTEMMALYKKEKVNPLGGCLPILVQIPVFMCLYWVLSETVEFRHAPFILWIQ 503

Query: 464 DLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWM 523
           DL++ D           PFY        + P+IM ++M IQ  ++P P D  QA ++   
Sbjct: 504 DLSSQD-----------PFY--------VLPVIMGITMKIQQSLNPAPIDPIQAKVMKMF 544

Query: 524 PVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           P+VF      FPAGL++YW  +N +SI+QQ+ I K
Sbjct: 545 PIVFTIFFLFFPAGLVLYWVVNNTLSIIQQSYITK 579


>gi|90413740|ref|ZP_01221728.1| putative inner membrane protein translocase component YidC
           [Photobacterium profundum 3TCK]
 gi|90325209|gb|EAS41706.1| putative inner membrane protein translocase component YidC
           [Photobacterium profundum 3TCK]
          Length = 538

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 147/493 (29%), Positives = 239/493 (48%), Gaps = 56/493 (11%)

Query: 81  SINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNT 140
           S++  G    +  L  Y  ++ S  P + L   +   ++Y A+   +  AN I+  N   
Sbjct: 77  SVDTLGGDVTEAKLLAYDNELDSADPFILLKDEAG--HSYIAQSGLIG-ANGIDSANGRA 133

Query: 141 V-------WNLISGK--ILTPTTPIKLVFKNANNILFERTISLDEH-YLFKIVDTVTNNS 190
                   + L  G+  +  P T +K      + I + +T  L  + Y   +  T+ N S
Sbjct: 134 QLAVTAKDFTLADGQDELRVPMTYVK------DGITYTKTFVLKRNSYAVDVEYTIDNQS 187

Query: 191 ID----QIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFH 246
                 Q+    R  +M         T+    G        +  +  + D++  S+ N  
Sbjct: 188 ASAASVQMYAQLRQNLMDDGSSLTMPTY---RGGAYSTDTTNYKKYSFDDMQDKSL-NMT 243

Query: 247 ESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTN 306
            +N W  +   Y+ S +IP  E +  + F   S+G      +      TI  G   T T+
Sbjct: 244 TTNGWAAMLQHYFVSAWIPRSEEA-SNLFTRASNGQGYIGVRLPTT--TIAAGTEQTITS 300

Query: 307 FLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIML 366
            L+ G K        E +       + +D+GW +FIA P+  L+S+  ++VGN+GIAIM+
Sbjct: 301 TLWVGPK-----LQKEMEATAANLNLTVDYGWLWFIASPLHKLLSFIQSIVGNWGIAIMM 355

Query: 367 TTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINP 426
            T  V+   +PL K QY S A M+ +QPK+  +RE+      Q + + M++LYK   +NP
Sbjct: 356 LTFIVRGAMYPLTKAQYTSMAKMRMLQPKLTAMRERLGDD-RQRMSQEMMELYKKEKVNP 414

Query: 427 LAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPG 486
           L GC PI+LQ+P+F A+Y  +  S+E+RH+PF+GWI DL+A D           P+Y   
Sbjct: 415 LGGCLPIVLQMPIFIALYWSLMESVELRHSPFFGWIHDLSAQD-----------PYY--- 460

Query: 487 FMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWS 545
                I P++M +SMF+  KMSP    D  Q  I+ +MPV+F F    FP+GL++YW  S
Sbjct: 461 -----ILPLLMGVSMFMIQKMSPTTVTDPMQQKIMTFMPVMFTFFFLWFPSGLVLYWLVS 515

Query: 546 NVISIVQQAVIMK 558
           NV++++QQ +I +
Sbjct: 516 NVVTLIQQTLIYR 528


>gi|170724369|ref|YP_001752057.1| putative inner membrane protein translocase component YidC
           [Pseudomonas putida W619]
 gi|254773014|sp|B1JFV4|OXAA_PSEPW RecName: Full=Inner membrane protein oxaA
 gi|169762372|gb|ACA75688.1| 60 kDa inner membrane insertion protein [Pseudomonas putida W619]
          Length = 560

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 131/379 (34%), Positives = 206/379 (54%), Gaps = 31/379 (8%)

Query: 182 IVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS--DIEK 239
           ++D  +  +     F+   R     P ++T T G      A L       +K S  DI+K
Sbjct: 200 LIDNQSGQAWSGNMFAQLKRDASGDPSSSTAT-GTATYLGAALWTAGEPYKKVSMKDIDK 258

Query: 240 SSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPG 299
            S+   + S  W+     Y+ + +IP+K  +   Q +   D    Y   ++   I++  G
Sbjct: 259 GSLKE-NVSGGWVAWLQHYFVTAWIPAKSDNNVVQTR--KDSQGNYIIGYTGPAISVPAG 315

Query: 300 KSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGN 359
               T+  L+AG    P I    K+L+ P  E+ +D+G+ +FIA+P+F L+ + ++L+GN
Sbjct: 316 GKAETSAMLYAG----PKIQSKLKELS-PGLELTVDYGFLWFIAQPIFWLLQHIHSLLGN 370

Query: 360 FGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLY 419
           +G +I++ T+ +K LFFPL+   Y S A M+ + PK+  L+E+F     Q + +AM++LY
Sbjct: 371 WGWSIIVLTMLIKGLFFPLSAASYRSMARMRAVAPKLAALKERFGDD-RQKMSQAMMELY 429

Query: 420 KTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGI 479
           K   INPL GC PIL+Q+PVF A+Y V+  S+EMR AP+  WI DL+  D          
Sbjct: 430 KKEKINPLGGCLPILVQMPVFLALYWVLLESVEMRQAPWMLWITDLSIKD---------- 479

Query: 480 LPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLI 539
            PF+        I PIIM  +MFIQ +++P P D  QA ++  MP++F F    FPAGL+
Sbjct: 480 -PFF--------ILPIIMGATMFIQQRLNPTPPDPMQAKVMKMMPIIFTFFFLWFPAGLV 530

Query: 540 IYWSWSNVISIVQQAVIMK 558
           +YW  +N +SI QQ  I +
Sbjct: 531 LYWVVNNCLSISQQWYITR 549


>gi|145638178|ref|ZP_01793788.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae PittII]
 gi|145272507|gb|EDK12414.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae PittII]
 gi|309751334|gb|ADO81318.1| Inner membrane translocation protein YidC [Haemophilus influenzae
           R2866]
          Length = 541

 Score =  214 bits (544), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 115/327 (35%), Positives = 194/327 (59%), Gaps = 30/327 (9%)

Query: 234 YSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA-KFSAN 292
           ++D++ +++S       W+ +   Y+ S +IP+++   ++Q   ++D      +  +   
Sbjct: 231 FADMQDNNLS-IDTKAGWVAVLQHYFVSAWIPNQDV--NNQLYTITDSKNNVASIGYRGP 287

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
            ++I  G   T T+ L+ G    P + +    +A    ++ +D+GW +FIAKP+F L+++
Sbjct: 288 VVSIPAGSQETITSSLWTG----PKLQNQMATVA-NNLDLTVDYGWAWFIAKPLFWLLTF 342

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
              +V N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + 
Sbjct: 343 IQGIVSNWGLAIICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGDD-RQRMS 401

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           + M++LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A D   
Sbjct: 402 QEMMKLYKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQD--- 458

Query: 473 IFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFAL 531
                   P+Y        I PI+M +SMF+  KMSP P  D  Q  ++N+MP++F+   
Sbjct: 459 --------PYY--------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLIFMVFF 502

Query: 532 SSFPAGLIIYWSWSNVISIVQQAVIMK 558
             FP+GL++YW  SN+I+I QQ +I +
Sbjct: 503 LWFPSGLVLYWLVSNLITIAQQQLIYR 529


>gi|307133251|ref|YP_003885267.1| cytoplasmic insertase into membrane protein, Sec system [Dickeya
           dadantii 3937]
 gi|306530780|gb|ADN00711.1| cytoplasmic insertase into membrane protein, Sec system [Dickeya
           dadantii 3937]
          Length = 543

 Score =  213 bits (543), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 151/569 (26%), Positives = 259/569 (45%), Gaps = 71/569 (12%)

Query: 15  VIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELK 74
           ++I   +  F ++ + E   N     QT +Q N      A    +    A      + +K
Sbjct: 8   LLIALLFVTFMIWQQWETDKNPPAATQTTQQANGAVGDAA----NQGVPASGQGKLITVK 63

Query: 75  NPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLS-----------------PSNTK 117
              L  +IN +G   ++ +L  Y  ++ S+ P   L +                 P N  
Sbjct: 64  TDVLSLNINTRGGDIEEADLLAYPAELGSSQPFKLLETTPAFTYQAQSGLTGKNGPDNPA 123

Query: 118 NAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE- 176
           N   +   Y + A+  EL                    I L + +AN + F +T  L   
Sbjct: 124 NG--SRPLYTAPADRFELAAGQNELR------------IPLTYTDANGVSFTKTFVLKRG 169

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMR------HKPQTATNTFGVQEGFIAVLGDKSLV 230
            Y   +   V N S   +  +  G++ +      H+  T +N F +     A        
Sbjct: 170 EYALNVEYGVNNASAQPLELTLFGQLKQSIDLPSHR-DTGSNNFALHTYRGAAFSSSDDK 228

Query: 231 EQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFS 290
            +KYS  +     N      W+ +  +Y+A+ ++P+   + ++ F   + G+      F 
Sbjct: 229 YRKYSFSDMKENLNITTQGGWVAMLQQYFATAWVPA--AAGNNTFYSANLGNGLAAIGFK 286

Query: 291 ANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLM 350
           A  + + PG        L+ G    P I      +A P  ++ +D+GW +FI++P+F L+
Sbjct: 287 APPVIVQPGSQQNLNATLWVG----PEIQDKMATVA-PHLDLTVDYGWLWFISQPLFKLL 341

Query: 351 SYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQV 410
            + +  +GN+G +I+  T  V+ + +PL K QY S A M+ +QPK+  +RE+      Q 
Sbjct: 342 KFLHGFIGNWGFSIIAITFIVRGIMYPLTKAQYTSMAKMRMLQPKLQAMRERIGDD-KQR 400

Query: 411 LQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADP 470
           + + M+ LYK   +NPL GC+P+L+Q+P+F A+Y ++  S+E+RHAPF  WI DL+A D 
Sbjct: 401 MSQEMMALYKAEKVNPLGGCFPLLIQMPIFLALYYMLMGSVELRHAPFALWIHDLSAQD- 459

Query: 471 TNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVF 529
                     P+Y        + PI+M L+MF   KMSP    D  Q  I+ +MPV+F  
Sbjct: 460 ----------PYY--------VLPILMGLTMFFIQKMSPTTVTDPMQQKIMTYMPVIFTV 501

Query: 530 ALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
               FP+GL++Y+  SN+++I QQ +I +
Sbjct: 502 FFLWFPSGLVLYYIVSNLVTIAQQQLIYR 530


>gi|119503568|ref|ZP_01625651.1| putative inner membrane protein translocase component YidC [marine
           gamma proteobacterium HTCC2080]
 gi|119460630|gb|EAW41722.1| putative inner membrane protein translocase component YidC [marine
           gamma proteobacterium HTCC2080]
          Length = 571

 Score =  213 bits (542), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 126/388 (32%), Positives = 204/388 (52%), Gaps = 37/388 (9%)

Query: 178 YLFKIVDTVTNNSID---QIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKY 234
           Y  ++   + NN  +    I F+   R     P   T+ FG+Q    A     +  E +Y
Sbjct: 207 YTIEVSYHIVNNGTEIWQSIPFAQLKRDSSPAPSADTSGFGMQPFLGAA---TTTPENRY 263

Query: 235 SDIEKSSISN----FHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFS 290
                + I++      ++  W+ +   Y+ +  +P  E +     +   DG     A F+
Sbjct: 264 EKFTFADIADDPWKTQQTGGWIAMLQHYFTAALVPDAEATHTYSTRRTRDGFNI--AGFT 321

Query: 291 ANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLM 350
           +  + I PG++ +     +AG K+  T+     +LA P  E+++D+GW ++I KP+F L+
Sbjct: 322 SEPLRIAPGQTGSWNTQFYAGPKDQYTL----AELA-PHLELVVDYGWLWWIGKPLFWLL 376

Query: 351 SYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQV 410
           +   ++V N+G+AI+L T+ +K  FF L+   Y S A M+  QPK+  ++E+      Q 
Sbjct: 377 TQIQSVVINWGVAIILLTLLIKTAFFKLSAASYRSMAKMRKAQPKMVAIKEQHANDK-QK 435

Query: 411 LQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADP 470
             +AM++LYK   INP+ GC PIL+Q+PVF A+Y V+  S+E+R APF  WIKDLA  DP
Sbjct: 436 QSQAMMELYKKEKINPMGGCLPILVQMPVFIALYWVLMESVELRQAPFALWIKDLAVMDP 495

Query: 471 TNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFA 530
             +                    P++M  SMF   K++PPP D  QA ++ W+PVVF F 
Sbjct: 496 YFVL-------------------PLMMGASMFFMQKLNPPPPDPMQAKLMQWLPVVFTFF 536

Query: 531 LSSFPAGLIIYWSWSNVISIVQQAVIMK 558
              FPAGL++YW  +N++S+ QQ  I +
Sbjct: 537 FLWFPAGLVLYWVVNNLLSMAQQYYITR 564


>gi|152998480|ref|YP_001343315.1| 60 kDa inner membrane insertion protein [Marinomonas sp. MWYL1]
 gi|189036353|sp|A6W3V1|OXAA_MARMS RecName: Full=Inner membrane protein oxaA
 gi|150839404|gb|ABR73380.1| 60 kDa inner membrane insertion protein [Marinomonas sp. MWYL1]
          Length = 551

 Score =  213 bits (542), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 149/501 (29%), Positives = 242/501 (48%), Gaps = 48/501 (9%)

Query: 71  VELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTA 130
           +E+   +L  +IN  G    +  L  Y  ++    P V L     ++  Y  +   V   
Sbjct: 80  IEVTTDTLRVAINPVGGDLVEAALLQYKKELGQPDPFVIL--EDGSERTYVTQSGLVGQD 137

Query: 131 NNIELP-------NSNTVWNLISGKILTPTTPIKLVFKNANNILFERTIS-LDEHYLFKI 182
                P       +  T + L  G+    +  + L + +A  + + +T   +   Y  + 
Sbjct: 138 GPDASPEGRPVYQSEKTAYTLADGE---NSLDVNLYYTDAKGVKYTKTFRFMKGKYRIRQ 194

Query: 183 VDTVTNNSIDQIRFSPRGRIMRH---KPQTATNTFGVQEGFIAVLGDKSLVEQK--YSDI 237
           + TV N S +  R +   +I R     P  AT + G+Q      + D+     K  +SD+
Sbjct: 195 LITVDNTSSNTWRGNLFAQIKRDNTPDPSKAT-SMGLQPYLGGAISDEQTKYTKVSFSDM 253

Query: 238 EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITIL 297
           ++  I     +  W+ +   Y+ S +IP +      Q +   D +      F+   + I 
Sbjct: 254 KEDPIKT-TTTKGWVAVLQHYFVSAWIPEQGQKVTLQARTNGDFNI---IGFTGTSVEIA 309

Query: 298 PGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLV 357
           PGK  T ++  + G K    +    ++L     ++ +D+GW +++AKP+F L++   + V
Sbjct: 310 PGKQGTLSSTFYVGPKLQDHLESTAENL-----DLTVDYGWLWWLAKPLFWLLTLIQSFV 364

Query: 358 GNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQ 417
            N+GIAI+L  V VK +FF L+   Y S A M+   P+I +L+EK+     Q + + M+ 
Sbjct: 365 INWGIAIILIVVCVKAIFFKLSAASYRSMAKMRKFGPEIAKLKEKYGDDR-QKMSQEMMA 423

Query: 418 LYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLF 477
           LYK   INPL GC PIL+Q+PVF ++Y V+  S+E+RHAPF+ WI DL+  DP  I    
Sbjct: 424 LYKKEKINPLGGCLPILVQMPVFLSLYWVLMESVELRHAPFFLWIHDLSVMDPYFIL--- 480

Query: 478 GILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAG 537
                           PI+M +SMF+Q  ++P P D  QA I+  MPV F      FPAG
Sbjct: 481 ----------------PILMGISMFVQQSLNPTPPDPMQARIMKIMPVAFSIFFLWFPAG 524

Query: 538 LIIYWSWSNVISIVQQAVIMK 558
           L++YW  +N +SI+QQ VI K
Sbjct: 525 LVLYWVTNNTLSILQQYVITK 545


>gi|149925381|ref|ZP_01913645.1| 60 kDa inner membrane insertion protein [Limnobacter sp. MED105]
 gi|149825498|gb|EDM84706.1| 60 kDa inner membrane insertion protein [Limnobacter sp. MED105]
          Length = 558

 Score =  213 bits (542), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 137/435 (31%), Positives = 228/435 (52%), Gaps = 41/435 (9%)

Query: 134 ELPNSNTVWNLISGKILTPTTP----IKLVFKNANNILFERTIS---LDEHYLFKIVDTV 186
           + PN  T++ L+SG   T   P    +KLVFK A +   E T +       Y   +V   
Sbjct: 145 DAPNHRTLFELVSGS--TEFAPGQDQLKLVFK-ATSGGIENTTTYTIFKNRYDIDLVINA 201

Query: 187 TNNSIDQIRFSPRGRIMR--HKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISN 244
            N  ++ +  S   +I R  +  ++ ++ +    G      +K   +  + DI   S   
Sbjct: 202 RNTGVEPVSPSAYVQITRDGNPLESDSSLYATFTGPAVYTPEKKYQKIDFEDIADRSADY 261

Query: 245 FHESNS-WLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSIT 303
              ++S WL +   Y+ S  +   +      +    D +  Y     ++  T+ P ++ T
Sbjct: 262 VKTADSGWLAMIQHYFVSAIV--GQDGPRENYTRQVDSN-LYSIGLVSSLGTLAPEQTAT 318

Query: 304 TTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIA 363
            T  L+ G ++   +         P  ++++D+GW   IA+P++ L+   ++ +GN+G A
Sbjct: 319 YTAKLYTGPQDQSVLEALS-----PGLDLVVDYGWLTVIAQPIYWLLEKIHSYIGNWGWA 373

Query: 364 IMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHN 423
           I++ T+ +KL+FFPL+   Y S A M+ + P++ +L+E++        Q+AM+++YK   
Sbjct: 374 IVVLTILIKLVFFPLSAASYKSMAKMRKVGPRMQKLKEQYGDDK-MGFQRAMMEMYKREK 432

Query: 424 INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY 483
           INPL GC PIL+QIPVF A+Y V+  S+EMR+AP+ GW+ DLAA D           PFY
Sbjct: 433 INPLGGCMPILIQIPVFIALYWVLLASVEMRNAPWLGWVTDLAAPD-----------PFY 481

Query: 484 LPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWS 543
                   I P+IM+++MFIQ +++P P D  QA I+  MP+VF      FPAGL++YW 
Sbjct: 482 --------ILPVIMAVTMFIQTRLNPTPPDPVQAKIMMIMPLVFSVMFIFFPAGLVLYWV 533

Query: 544 WSNVISIVQQAVIMK 558
            +N++SI QQ VI +
Sbjct: 534 VNNILSIAQQWVITR 548


>gi|167560996|ref|ZP_02353912.1| putative inner membrane protein translocase component YidC
           [Burkholderia oklahomensis EO147]
          Length = 483

 Score =  213 bits (542), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 148/495 (29%), Positives = 234/495 (47%), Gaps = 50/495 (10%)

Query: 80  GSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSN 139
           G I+ +G     L L+    D       VTL   +   + Y A    +      + PN N
Sbjct: 19  GEIDTRGGTLAKLTLKK-EGDGKQPDLFVTLFDHAEN-HTYLARTGLLGG----DFPNHN 72

Query: 140 TVWNLISGKI----------LTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNN 189
            V+  ++G            L+  +P+K   K      F R       Y+  +   + N 
Sbjct: 73  DVYAQVAGPTSLSGDQNTLKLSFESPVKGGVKVVKTYTFTRG-----SYVIGVDTKIDNV 127

Query: 190 SIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ-KYSDIEKSSISNFHES 248
               +  +    ++R      T  F       AV  D+   ++  +SD++K+       +
Sbjct: 128 GTAPVTPTVYMELVRDNTPVETPLFSHTFLGPAVYTDQKHFQKINFSDVDKNKADYVASA 187

Query: 249 -NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNF 307
            N W+ +   Y+AS +IP +        + +      Y+         I PG+S   +  
Sbjct: 188 DNGWIAMVQHYFASAWIPQQGAKRDIYVEKIDP--TLYRVGVKQPVAAIAPGQSADVSAR 245

Query: 308 LFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLT 367
           LFAG +E   +         P  E++ D+GW   IAKP+F L+   +  VGN+G AI+L 
Sbjct: 246 LFAGPEEERMLEGIA-----PGLELVKDYGWVTIIAKPLFWLLEKIHGFVGNWGWAIVLL 300

Query: 368 TVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPL 427
           T+ +K +FFPL+   Y S A MK I P++  LRE+FK S PQ +  A+++LYKT  +NP 
Sbjct: 301 TLLIKAVFFPLSAASYKSMARMKEITPRMQALRERFK-SDPQKMNAALMELYKTEKVNPF 359

Query: 428 AGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGF 487
            GC P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  DP  I              
Sbjct: 360 GGCLPVVIQIPVFISLYWVLLASVEMRGAPWVLWIHDLSQRDPYFIL------------- 406

Query: 488 MHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNV 547
                 P++M++SMF+Q K++P P D  QA ++ +MP+ F      FPAGL++Y+  +NV
Sbjct: 407 ------PVLMAVSMFVQTKLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVLYYVVNNV 460

Query: 548 ISIVQQAVIMKMHGA 562
           +SI QQ  I +  G 
Sbjct: 461 LSIAQQYYITRTLGG 475


>gi|254000529|ref|YP_003052592.1| 60 kDa inner membrane insertion protein [Methylovorus sp. SIP3-4]
 gi|253987208|gb|ACT52065.1| 60 kDa inner membrane insertion protein [Methylovorus sp. SIP3-4]
          Length = 549

 Score =  213 bits (542), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 164/560 (29%), Positives = 269/560 (48%), Gaps = 54/560 (9%)

Query: 8   FVAIALSVIIVY-AWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAV-LIDDRAQAL 65
           FV  + S+++++ AWQ  +  P  E +  E     +V    ++  + AA  +  +    L
Sbjct: 9   FVIFSFSILMLWDAWQREHT-PPPETVTAEAATDNSVPHAEKLPGAKAAADMPKESGFRL 67

Query: 66  SMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELD 125
             + R++++       I+  G     L L  +  D S+    V LL        Y A+  
Sbjct: 68  QTADRIQVETDVYKAVIDTTGGDLRRLELLKHRADNSTTENFV-LLDDRAAPMVYVAQSG 126

Query: 126 YVSTANNIELPNSNTV-------WNLISGKILTPTTPIKLVFKNANNILFERTISLD-EH 177
            +       LPN  TV       + L +G   + T  ++L   +A+ +  ++  +   + 
Sbjct: 127 LIGQG----LPNHKTVFTAEASNYQLAAG---SDTLEVRLTAASADGVKVDKIYTFHRDS 179

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN----TFGVQEGFIAVLGDKSLVEQK 233
           Y+  +   + N S   I  +   +++        +    TF     F      K L    
Sbjct: 180 YVINLRYEIHNESASPIDPTVYYQVVHDTESNQGSHMMPTFTGGAYFTQADKFKKL---S 236

Query: 234 YSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANE 293
           + D+ K+ +S    S+ W+G+   Y+ S +IP +  +     K L+D    Y     ++ 
Sbjct: 237 FKDMGKNDLSKT-TSDGWVGLLQHYFVSAWIPKEGVTRQFYSKKLADN--IYSIGTKSDI 293

Query: 294 ITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYF 353
             I PG S       +AG    P      K +A P  E  +D+GW   IA P+F ++S  
Sbjct: 294 GVIAPGASAEVDARYYAG----PQNQEVMKQVA-PGLEYTVDYGWLTIIASPLFWILSKI 348

Query: 354 YNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQK 413
            ++V N+G+AI+L TV +KL F+PL+   Y S A+M+ + P++  L+E++     Q +Q 
Sbjct: 349 ESVVHNWGVAIILLTVMIKLAFYPLSAASYRSMAHMRELAPRLQRLKEQYGDDR-QKMQV 407

Query: 414 AMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNI 473
           AM++LYKT  INP+ GC PIL+QIPVF ++Y V+  S+EMRHAPF  WI DL+A D    
Sbjct: 408 AMMELYKTEKINPMGGCLPILVQIPVFISLYWVLLGSVEMRHAPFMLWIHDLSAID---- 463

Query: 474 FTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSS 533
                  P+Y        + PI+M  +M IQ +++P P D  QA ++  MP+VF      
Sbjct: 464 -------PYY--------VLPILMGATMIIQTRLNPTPTDPVQAKVMMIMPIVFSVFFFF 508

Query: 534 FPAGLIIYWSWSNVISIVQQ 553
           FPAGL++YW  +NV+SI QQ
Sbjct: 509 FPAGLVLYWLVNNVLSIAQQ 528


>gi|167568260|ref|ZP_02361134.1| putative inner membrane protein translocase component YidC
           [Burkholderia oklahomensis C6786]
          Length = 497

 Score =  213 bits (542), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 148/495 (29%), Positives = 234/495 (47%), Gaps = 50/495 (10%)

Query: 80  GSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSN 139
           G I+ +G     L L+    D       VTL   +   + Y A    +      + PN N
Sbjct: 33  GEIDTRGGTLAKLTLKK-EGDGKQPDLFVTLFDHA-ANHTYLARTGLLGG----DFPNHN 86

Query: 140 TVWNLISGKI----------LTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNN 189
            V+  ++G            L+  +P+K   K      F R       Y+  +   + N 
Sbjct: 87  DVYAQVAGPTSLSGDQNTLKLSFESPVKGGVKVVKTYTFTRG-----SYVIGVDTKIDNV 141

Query: 190 SIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ-KYSDIEKSSISNFHES 248
               +  +    ++R      T  F       AV  D+   ++  +SD++K+       +
Sbjct: 142 GTAPVTPTVYMELVRDNTPVETPLFSHTFLGPAVYTDQKHFQKINFSDVDKNKADYVTSA 201

Query: 249 -NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNF 307
            N W+ +   Y+AS +IP +        + +      Y+         I PG+S   +  
Sbjct: 202 DNGWIAMVQHYFASAWIPQQGAKRDIYVEKIDP--TLYRVGVKQPVAAIAPGQSADVSAR 259

Query: 308 LFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLT 367
           LFAG +E   +         P  E++ D+GW   IAKP+F L+   +  VGN+G AI+L 
Sbjct: 260 LFAGPEEERMLEGIA-----PGLELVKDYGWVTIIAKPLFWLLEKIHGFVGNWGWAIVLL 314

Query: 368 TVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPL 427
           T+ +K +FFPL+   Y S A MK I P++  LRE+FK S PQ +  A+++LYKT  +NP 
Sbjct: 315 TLLIKAVFFPLSAASYKSMARMKEITPRMQALRERFK-SDPQKMNAALMELYKTEKVNPF 373

Query: 428 AGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGF 487
            GC P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  DP  I              
Sbjct: 374 GGCLPVVIQIPVFISLYWVLLASVEMRGAPWVLWIHDLSQRDPYFIL------------- 420

Query: 488 MHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNV 547
                 P++M++SMF+Q K++P P D  QA ++ +MP+ F      FPAGL++Y+  +NV
Sbjct: 421 ------PVLMAVSMFVQTKLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVLYYVVNNV 474

Query: 548 ISIVQQAVIMKMHGA 562
           +SI QQ  I +  G 
Sbjct: 475 LSIAQQYYITRTLGG 489


>gi|313202488|ref|YP_004041146.1| 60 kda inner membrane insertion protein [Methylovorus sp. MP688]
 gi|312441804|gb|ADQ85910.1| 60 kDa inner membrane insertion protein [Methylovorus sp. MP688]
          Length = 549

 Score =  213 bits (542), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 164/560 (29%), Positives = 269/560 (48%), Gaps = 54/560 (9%)

Query: 8   FVAIALSVIIVY-AWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAV-LIDDRAQAL 65
           FV  + S+++++ AWQ  +  P  E +  E     +V    ++  + AA  +  +    L
Sbjct: 9   FVIFSFSILMLWDAWQREHT-PPPETVTAEAATDNSVPHAEKLPGAKAAADMPKESGFRL 67

Query: 66  SMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELD 125
             + R++++       I+  G     L L  +  D S+    V LL        Y A+  
Sbjct: 68  QTADRIQVETDVYKAVIDTTGGDLRRLELLKHRADNSTTENFV-LLDDRAAPMVYVAQSG 126

Query: 126 YVSTANNIELPNSNTV-------WNLISGKILTPTTPIKLVFKNANNILFERTISLD-EH 177
            +       LPN  TV       + L +G   + T  ++L   +A+ +  ++  +   + 
Sbjct: 127 LIGQG----LPNHKTVFTAEASNYQLAAG---SDTLEVRLTAASADGVKVDKIYTFHRDS 179

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN----TFGVQEGFIAVLGDKSLVEQK 233
           Y+  +   + N S   I  +   +++        +    TF     F      K L    
Sbjct: 180 YVINLRYEIHNESASPIDPTVYYQVVHDTESNQGSHMMPTFTGGAYFTQADKFKKL---S 236

Query: 234 YSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANE 293
           + D+ K+ +S    S+ W+G+   Y+ S +IP +  +     K L+D    Y     ++ 
Sbjct: 237 FKDMGKNDLSKT-TSDGWVGLLQHYFVSAWIPKEGVTRQFYSKKLADN--IYSIGTKSDI 293

Query: 294 ITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYF 353
             I PG S       +AG    P      K +A P  E  +D+GW   IA P+F ++S  
Sbjct: 294 GVIAPGASAEVEARYYAG----PQNQEVMKQVA-PGLEYTVDYGWLTIIASPLFWILSKI 348

Query: 354 YNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQK 413
            ++V N+G+AI+L TV +KL F+PL+   Y S A+M+ + P++  L+E++     Q +Q 
Sbjct: 349 ESVVHNWGVAIILLTVMIKLAFYPLSAASYRSMAHMRELAPRLQRLKEQYGDDR-QKMQV 407

Query: 414 AMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNI 473
           AM++LYKT  INP+ GC PIL+QIPVF ++Y V+  S+EMRHAPF  WI DL+A D    
Sbjct: 408 AMMELYKTEKINPMGGCLPILVQIPVFISLYWVLLGSVEMRHAPFMLWIHDLSAID---- 463

Query: 474 FTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSS 533
                  P+Y        + PI+M  +M IQ +++P P D  QA ++  MP+VF      
Sbjct: 464 -------PYY--------VLPILMGATMIIQTRLNPTPTDPVQAKVMMIMPIVFSVFFFF 508

Query: 534 FPAGLIIYWSWSNVISIVQQ 553
           FPAGL++YW  +NV+SI QQ
Sbjct: 509 FPAGLVLYWLVNNVLSIAQQ 528


>gi|313672991|ref|YP_004051102.1| membrane protein insertase, yidc/oxa1 family [Calditerrivibrio
           nitroreducens DSM 19672]
 gi|312939747|gb|ADR18939.1| membrane protein insertase, YidC/Oxa1 family [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 504

 Score =  213 bits (542), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 137/405 (33%), Positives = 208/405 (51%), Gaps = 54/405 (13%)

Query: 164 NNILFERTISL-DEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIA 222
           NNI   +T ++  E YL  +   V+NNS   ++      I     +    +  + EG + 
Sbjct: 141 NNIGITKTYTIGKEGYLIDLNLKVSNNSDQTVKLEGNIDIGPGFGEGFEKSSYIFEGPMI 200

Query: 223 VLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGH 282
             G+K   E+   +  K +I    ++  W+G + KY+    I               DG+
Sbjct: 201 YNGEKK--EEVAPEKIKDTIK--LDAPKWIGYTTKYYLIAAI---------------DGN 241

Query: 283 ARYQAKFSANEITILPG--------KSITTTNF-LFAGAKEFPTIHHYEKDLAIPRFEML 333
                     E  I+ G        KS +   F ++ G KE+  +  +   L     E  
Sbjct: 242 LELGKIEKVGESAIVKGVKQIILNPKSTSNIKFNIYVGPKEYDLLKSFNLGL-----EHS 296

Query: 334 IDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQ 393
           ID+GWF F+A PM   M + Y+   N+G+AI++ T+ VKLL +PL  K   S   M+ IQ
Sbjct: 297 IDFGWFKFLAVPMLKFMIFIYSFTKNYGVAIIILTIIVKLLTYPLTIKSMTSMKKMQQIQ 356

Query: 394 PKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEM 453
           PK+ E++EKFK   PQ +  AM++LY+ H +NP+ GC P+++QIP+FFA+YK + +S+E+
Sbjct: 357 PKLMEIKEKFKND-PQKMNTAMMELYRKHGVNPMGGCLPMIIQIPIFFALYKALLVSVEL 415

Query: 454 RHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPAD 513
           + +PF  WI DL+  D           P+Y        I PIIM ++MFIQ KM+P   D
Sbjct: 416 KGSPFILWITDLSEKD-----------PYY--------ITPIIMGITMFIQQKMTPSTMD 456

Query: 514 KGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
             Q  I   MPV+F F   SFP+GL+IYW  +N++SI+QQ  I K
Sbjct: 457 PMQQKIFLMMPVIFTFLFLSFPSGLVIYWLTNNILSIIQQYYINK 501


>gi|83719666|ref|YP_443729.1| inner membrane protein translocase component YidC [Burkholderia
           thailandensis E264]
 gi|167620894|ref|ZP_02389525.1| putative inner membrane protein translocase component YidC
           [Burkholderia thailandensis Bt4]
 gi|123536100|sp|Q2STM0|OXAA_BURTA RecName: Full=Inner membrane protein oxaA
 gi|83653491|gb|ABC37554.1| inner membrane protein, 60 kDa [Burkholderia thailandensis E264]
          Length = 557

 Score =  213 bits (542), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 153/494 (30%), Positives = 241/494 (48%), Gaps = 50/494 (10%)

Query: 80  GSINLKGAQFDDLNLR----GYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIEL 135
           G I+ +G     L L     G   D+S     VTL   +   + Y A    +      + 
Sbjct: 93  GEIDTRGGTLAKLTLTKAGDGKQPDLS-----VTLFD-NAANHTYLARTGLLGG----DF 142

Query: 136 PNSNTVWNLISG--KILTPTTPIKLVFKN--ANNILFERTISLDEHYLFKIVDTVTNNSI 191
           PN N V+   +G   +      +KL F++     +   +T +         VDT   N +
Sbjct: 143 PNHNDVYTQAAGPTSLAAGQNTLKLAFESPVKGGVKVVKTYTFTRGSYVIGVDTKIEN-V 201

Query: 192 DQIRFSPRGRIMRHKPQTATNTFGVQEGFI--AVLGDKSLVEQ-KYSDIEKSSISNFHES 248
                +P   +   +  T+  T      F+  AV  D+   ++  +SDI+K+       +
Sbjct: 202 GTAPVTPSVYMELVRDNTSVETPMFSHTFLGPAVYTDQKHFQKITFSDIDKNKADYVTSA 261

Query: 249 -NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNF 307
            N W+ +   Y+AS +IP +        + +      Y+         I PG+S   +  
Sbjct: 262 DNGWIAMVQHYFASAWIPQQGAKRDIYVEKIDP--TLYRVGVKQPVAAIAPGQSADVSAR 319

Query: 308 LFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLT 367
           LFAG +E        + +A P  E++ D+GW   IAKP+F L+   +  VGN+G AI+L 
Sbjct: 320 LFAGPEE----ERMLEGIA-PGLELVKDYGWVTIIAKPLFWLLEKIHGFVGNWGWAIVLL 374

Query: 368 TVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPL 427
           T+ +K +FFPL+   Y S A MK I P++  LRE+FK S PQ +  A+++LYKT  +NP 
Sbjct: 375 TLLIKAVFFPLSAASYKSMARMKEITPRMQALRERFK-SDPQKMNAALMELYKTEKVNPF 433

Query: 428 AGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGF 487
            GC P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  DP  I              
Sbjct: 434 GGCLPVVIQIPVFISLYWVLLASVEMRGAPWILWIHDLSQRDPYFIL------------- 480

Query: 488 MHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNV 547
                 P++M++SMF+Q K++P P D  QA ++ +MP+ F      FPAGL++Y+  +NV
Sbjct: 481 ------PVLMAVSMFVQTKLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVLYYVVNNV 534

Query: 548 ISIVQQAVIMKMHG 561
           +SI QQ  I +  G
Sbjct: 535 LSIAQQYYITRTLG 548


>gi|186477842|ref|YP_001859312.1| putative inner membrane protein translocase component YidC
           [Burkholderia phymatum STM815]
 gi|254772761|sp|B2JJR8|OXAA_BURP8 RecName: Full=Inner membrane protein oxaA
 gi|184194301|gb|ACC72266.1| 60 kDa inner membrane insertion protein [Burkholderia phymatum
           STM815]
          Length = 550

 Score =  213 bits (542), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 124/334 (37%), Positives = 188/334 (56%), Gaps = 34/334 (10%)

Query: 234 YSDIEKSSISNFHES--NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSA 291
           + DI+K+   ++  S  N W+ +   Y+AS +IP +        + +     R   K   
Sbjct: 243 FGDIDKNK-QDYATSADNGWVAMVQHYFASAWIPQQGAKRDIYVEKIDPSLYRVGVKQPL 301

Query: 292 NEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLA--IPRFEMLIDWGWFYFIAKPMFML 349
              TI PG++I  +  LFAG +E       E+ L    P  E++ D+GW   IAKP+F L
Sbjct: 302 Q--TIAPGQTIDVSARLFAGPEE-------ERMLEGIAPGLELVKDYGWVTIIAKPLFWL 352

Query: 350 MSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQ 409
           +   +  VGN+G AI+L T+ +K +FFPL+   Y S A MK I P++  LRE+FK S PQ
Sbjct: 353 LEKIHGYVGNWGWAIVLLTLLIKAVFFPLSAASYKSMARMKEITPRMQALRERFK-SDPQ 411

Query: 410 VLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAAD 469
            +  A+++LYKT  +NP  GC P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  D
Sbjct: 412 KMNAALMELYKTEKVNPFGGCLPVVIQIPVFISLYWVLLSSVEMRGAPWILWIHDLSQQD 471

Query: 470 PTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVF 529
           P  I                    P++M++SMF+Q K++P P D  QA ++ +MP+ F  
Sbjct: 472 PYFIL-------------------PVLMAVSMFVQTKLNPTPPDPVQAKMMMFMPIAFSV 512

Query: 530 ALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
               FPAGL++Y+  +NV+SI QQ  I +M G +
Sbjct: 513 MFFFFPAGLVLYYVVNNVLSIAQQYYITRMMGQK 546


>gi|295678214|ref|YP_003606738.1| membrane protein insertase, YidC/Oxa1 family domain containing
           protein [Burkholderia sp. CCGE1002]
 gi|295438057|gb|ADG17227.1| membrane protein insertase, YidC/Oxa1 family domain containing
           protein [Burkholderia sp. CCGE1002]
          Length = 552

 Score =  213 bits (542), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 122/333 (36%), Positives = 192/333 (57%), Gaps = 34/333 (10%)

Query: 234 YSDIEKSSISNFHES--NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSA 291
           + D++K+   +F  S  + W+ +   Y+AS +IP  +      F       + Y+     
Sbjct: 244 FGDLDKNK-QDFATSANDGWVAMVQHYFASAWIP--QEGVKRDFYAEKIDPSLYRVGMKQ 300

Query: 292 NEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLA--IPRFEMLIDWGWFYFIAKPMFML 349
              TI PG++++ +  LFAG +E       E+ LA   P  +++ D+GW   IAKP+F L
Sbjct: 301 AMPTIQPGQTVSVSARLFAGPEE-------EQMLAGIAPGLDLVKDYGWVTIIAKPLFWL 353

Query: 350 MSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQ 409
           +S  ++ VGN+G +I+L T+ +K +FFPL+   Y S A MK I P++  LRE+FK   PQ
Sbjct: 354 LSKIHSYVGNWGWSIVLLTLLIKAVFFPLSAASYKSMARMKAITPRMQALRERFKGD-PQ 412

Query: 410 VLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAAD 469
            +  A+++LYKT  +NP  GC P+++QIPVF ++Y V+  S+EMR AP+  WI+DL+  D
Sbjct: 413 KMNAALMELYKTEKVNPFGGCLPVVIQIPVFISLYWVLLSSVEMRGAPWIWWIQDLSQQD 472

Query: 470 PTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVF 529
           P  I                    P++M++SMF+Q K++P P D  QA ++ +MP+ F  
Sbjct: 473 PYFIL-------------------PVLMAVSMFLQTKLNPTPPDPVQAKMMMFMPIAFSV 513

Query: 530 ALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
               FPAGL++Y+  +NV+SI QQ  I +M GA
Sbjct: 514 MFFFFPAGLVLYYVVNNVLSIAQQYYITRMMGA 546


>gi|107024094|ref|YP_622421.1| inner membrane protein translocase component YidC [Burkholderia
           cenocepacia AU 1054]
 gi|116691180|ref|YP_836803.1| putative inner membrane protein translocase component YidC
           [Burkholderia cenocepacia HI2424]
 gi|123071851|sp|Q1BSF7|OXAA_BURCA RecName: Full=Inner membrane protein oxaA
 gi|166975851|sp|A0KBN3|OXAA_BURCH RecName: Full=Inner membrane protein oxaA
 gi|105894283|gb|ABF77448.1| protein translocase subunit yidC [Burkholderia cenocepacia AU 1054]
 gi|116649269|gb|ABK09910.1| protein translocase subunit yidC [Burkholderia cenocepacia HI2424]
          Length = 552

 Score =  213 bits (542), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 154/493 (31%), Positives = 240/493 (48%), Gaps = 45/493 (9%)

Query: 80  GSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSN 139
           G I+ +G     L L+    D       +TL       + Y A    +      + PN N
Sbjct: 89  GEIDTRGGTLAKLTLKK-QGDGKQPDLYITLFD-HTAGHTYLARTGLLGG----DFPNHN 142

Query: 140 TVWNLI---SGKILTPTTPIKLVFKN--ANNILFERTISLDEHYLFKIVDTVTNNSIDQI 194
            V+  +   S  +      +KL F++     +   +T +         VDT  +N +   
Sbjct: 143 DVYTQLNPGSTSLTGDENTLKLSFESPVKGGVKVVKTYTFTRGSYVIGVDTKIDN-VGTA 201

Query: 195 RFSPRGRIMRHKPQTATNTFGVQEGFI--AVLGD-KSLVEQKYSDIEKSSISNFHES--N 249
             +P   +   +  TA  T      F+  AV  D K   +  +SD++K+  +NF +S  N
Sbjct: 202 PVTPTVYMELVRDNTAVETPMFSHTFLGPAVYTDAKHFQKIDFSDLDKNK-ANFEKSSDN 260

Query: 250 SWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLF 309
            W+ +   Y+AS +IP +        + +      Y+         I PG+S      LF
Sbjct: 261 GWVAMVQHYFASAWIPQQGAKRDIYAEKIDP--TLYRVGVKQPVAAIAPGQSADVQARLF 318

Query: 310 AGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTV 369
           AG +E   +         P  E++ D+GW   IAKP+F L+   +  VGN+G AI+L TV
Sbjct: 319 AGPEEERMLEGIA-----PGLELVKDYGWVTIIAKPLFWLLEKIHGYVGNWGWAIVLLTV 373

Query: 370 FVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAG 429
            +K +FFPL+   Y S A MK I P++  LRE+FK S PQ +  A+++LYKT  +NP  G
Sbjct: 374 LIKAVFFPLSAASYKSMARMKEITPRMQALRERFK-SDPQKMNAALMELYKTEKVNPFGG 432

Query: 430 CWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMH 489
           C P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  D           PF+      
Sbjct: 433 CLPVVIQIPVFISLYWVLLASVEMRGAPWILWIHDLSQRD-----------PFF------ 475

Query: 490 VGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVIS 549
             I P++M++SMF+Q  ++P P D  QA ++ +MP+ F      FPAGL++Y+  +NV+S
Sbjct: 476 --ILPVLMAVSMFVQTSLNPTPPDPVQAKMMKFMPIAFSVMFFFFPAGLVLYYVVNNVLS 533

Query: 550 IVQQAVIMKMHGA 562
           I QQ  I +  G 
Sbjct: 534 IAQQYYITRKLGG 546


>gi|167582766|ref|ZP_02375640.1| putative inner membrane protein translocase component YidC
           [Burkholderia thailandensis TXDOH]
          Length = 557

 Score =  213 bits (542), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 153/494 (30%), Positives = 241/494 (48%), Gaps = 50/494 (10%)

Query: 80  GSINLKGAQFDDLNLR----GYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIEL 135
           G I+ +G     L L     G   D+S     VTL   +   + Y A    +      + 
Sbjct: 93  GEIDTRGGTLAKLTLTKAGDGKQPDLS-----VTLFD-NAANHTYLARTGLLGG----DF 142

Query: 136 PNSNTVWNLISG--KILTPTTPIKLVFKN--ANNILFERTISLDEHYLFKIVDTVTNNSI 191
           PN N V+   +G   +      +KL F++     +   +T +         VDT   N +
Sbjct: 143 PNHNDVYTQAAGPTSLAADQNTLKLAFESPVKGGVKVVKTYTFTRGSYVIGVDTKIEN-V 201

Query: 192 DQIRFSPRGRIMRHKPQTATNTFGVQEGFI--AVLGDKSLVEQ-KYSDIEKSSISNFHES 248
                +P   +   +  T+  T      F+  AV  D+   ++  +SDI+K+       +
Sbjct: 202 GTAPVTPSVYMELVRDNTSVETPMFSHTFLGPAVYTDQKHFQKITFSDIDKNKADYVTSA 261

Query: 249 -NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNF 307
            N W+ +   Y+AS +IP +        + +      Y+         I PG+S   +  
Sbjct: 262 DNGWIAMVQHYFASAWIPQQGAKRDIYVEKIDP--TLYRVGVKQPVAAIAPGQSADVSAR 319

Query: 308 LFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLT 367
           LFAG +E        + +A P  E++ D+GW   IAKP+F L+   +  VGN+G AI+L 
Sbjct: 320 LFAGPEE----ERMLEGIA-PGLELVKDYGWVTIIAKPLFWLLEKIHGFVGNWGWAIVLL 374

Query: 368 TVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPL 427
           T+ +K +FFPL+   Y S A MK I P++  LRE+FK S PQ +  A+++LYKT  +NP 
Sbjct: 375 TLLIKAVFFPLSAASYKSMARMKEITPRMQALRERFK-SDPQKMNAALMELYKTEKVNPF 433

Query: 428 AGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGF 487
            GC P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  DP  I              
Sbjct: 434 GGCLPVVIQIPVFISLYWVLLASVEMRGAPWILWIHDLSQRDPYFIL------------- 480

Query: 488 MHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNV 547
                 P++M++SMF+Q K++P P D  QA ++ +MP+ F      FPAGL++Y+  +NV
Sbjct: 481 ------PVLMAVSMFVQTKLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVLYYVVNNV 534

Query: 548 ISIVQQAVIMKMHG 561
           +SI QQ  I +  G
Sbjct: 535 LSIAQQYYITRTLG 548


>gi|167834935|ref|ZP_02461818.1| putative inner membrane protein translocase component YidC
           [Burkholderia thailandensis MSMB43]
          Length = 489

 Score =  213 bits (542), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 151/499 (30%), Positives = 235/499 (47%), Gaps = 58/499 (11%)

Query: 80  GSINLKGAQFDDLNLR----GYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIEL 135
           G I+ +G     L L     G   D+S     VTL   +   + Y A    +      + 
Sbjct: 25  GEIDTRGGTLAKLTLTKAGDGKQPDLS-----VTLFD-NAANHTYLARTGLLGG----DF 74

Query: 136 PNSNTVWNLISGKI----------LTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDT 185
           PN N ++  ++G            L+  +P+K   K      F R       Y+  +   
Sbjct: 75  PNHNDIYAQVAGPTSLSAGQNALKLSFESPVKGGVKVVKTYTFTRG-----SYVIGVDTK 129

Query: 186 VTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ-KYSDIEKSSISN 244
           + N     +  S    ++R      T  F       AV  D+   ++  +SDI+K+    
Sbjct: 130 IENVGTTPVTPSVYMELVRDNTSVETPMFSHTFLGPAVYTDQKHFQKITFSDIDKNKADY 189

Query: 245 FHES-NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSIT 303
              + N W+ +   Y+AS +IP          + +      Y+         I PG+S  
Sbjct: 190 VPSADNGWIAMVQHYFASAWIPQAGAKRDIYVEKIDP--TLYRVGVKQPVAAIAPGQSAD 247

Query: 304 TTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIA 363
            +  LFAG +E   +         P  E++ D+GW   IAKP+F L+   +  VGN+G A
Sbjct: 248 VSARLFAGPEEERMLEGIA-----PGLELVKDYGWVTIIAKPLFWLLEKIHGFVGNWGWA 302

Query: 364 IMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHN 423
           I+L T+ +K +FFPL+   Y S A MK I P++  LRE+FK S PQ +  A+++LYKT  
Sbjct: 303 IVLLTLLIKAVFFPLSAASYKSMARMKEITPRMQALRERFK-SDPQKMNAALMELYKTEK 361

Query: 424 INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY 483
           +NP  GC P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  DP  I          
Sbjct: 362 VNPFGGCLPVVIQIPVFISLYWVLLASVEMRGAPWILWIHDLSQRDPYFIL--------- 412

Query: 484 LPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWS 543
                     P++M++SMF+Q K++P P D  QA ++ +MP+ F      FPAGL++Y+ 
Sbjct: 413 ----------PVLMAVSMFVQTKLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVLYYV 462

Query: 544 WSNVISIVQQAVIMKMHGA 562
            +NV+SI QQ  I +  G 
Sbjct: 463 VNNVLSIAQQYYITRTLGG 481


>gi|304414291|ref|ZP_07395659.1| Preprotein translocase subunit YidC [Candidatus Regiella
           insecticola LSR1]
 gi|304283505|gb|EFL91901.1| Preprotein translocase subunit YidC [Candidatus Regiella
           insecticola LSR1]
          Length = 542

 Score =  213 bits (541), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 167/578 (28%), Positives = 279/578 (48%), Gaps = 65/578 (11%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
           +RN    + IAL  +    WQ + V       NN   + QT +Q      S   V + ++
Sbjct: 4   QRN---LLLIALLFVSFMIWQTWQVD------NNPPSSSQTAQQ------STDTVSMANQ 48

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
             A +    ++++   L  +IN +G   +  NL  Y   + S+ P   L     T  A+ 
Sbjct: 49  TAADTQKQLIKVQTDVLSLTINTRGGDIEQANLLAYPNVLGSDKPFELL----ETTPAFI 104

Query: 122 AELDYVSTANNIELPNSNTVWNLISGK----ILTPTTP---IKLVFKNANNILFERTISL 174
            +     T  N     +N    L +      +L        I L F +   ++F +T  L
Sbjct: 105 YQAQSGLTGKNGPDNPANGARPLFTATQDHFVLAENQDELRIPLTFTSQEGVIFTKTFVL 164

Query: 175 DEH-YLFKIVDTVTNNSIDQIRFSPRGRIMR--HKPQ---TATNTFGVQEGFIAVLGDKS 228
             + Y   +   V N     + FS  G++ +  + PQ   T ++ F +Q    A      
Sbjct: 165 KRNDYAIGVHYQVKNTFATPLEFSLFGQLKQSINLPQYRDTGSSNFALQTYRGAAYSSDE 224

Query: 229 LVEQKYS--DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQ 286
              +KYS  DIE+++++   +   W+ +  +Y+A+ +IP+ + +       LS+G A   
Sbjct: 225 TKYKKYSFSDIEETNLNTVTQGG-WVAMLQQYFATAWIPAAQETHTFYSNKLSNGLAA-- 281

Query: 287 AKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPM 346
             F +  + I PG+       L+ G    P I      +A    ++ +D+GW +FI++P+
Sbjct: 282 IGFKSMPVVIPPGEQKDLAATLWIG----PEIQDKMAAIAT-HLDLTVDYGWLWFISQPL 336

Query: 347 FMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQS 406
           F L+ +    +GN+G +I++ T  V+ + +PL K QY S A M+ IQPK+ E+RE+    
Sbjct: 337 FKLLHFIQGFIGNWGFSIIVITFIVRGIMYPLTKAQYTSMAKMRMIQPKLTEMRERIGDD 396

Query: 407 PPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLA 466
             Q + + M+ LYKT  +NPL GC P+L+Q+P+F A+Y ++  S+E+RHA F  WI DL+
Sbjct: 397 -KQRMSQEMMALYKTEQVNPLGGCLPLLIQMPIFLALYYMLMSSVELRHASFILWIHDLS 455

Query: 467 AADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPV 525
           A D           P+Y        I PI+M ++M+   KMSP    D  Q  I+ +MPV
Sbjct: 456 AQD-----------PYY--------ILPILMGITMYFIQKMSPTTITDPMQQKIMTFMPV 496

Query: 526 VFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           +F      FPAGL++Y+  SN+++I+QQ +I   HG E
Sbjct: 497 IFTVFFLWFPAGLVLYYIVSNLVTILQQYLI--YHGLE 532


>gi|260595827|ref|YP_003208398.1| membrane protein insertase [Cronobacter turicensis z3032]
 gi|260215004|emb|CBA26663.1| Inner membrane protein oxaA [Cronobacter turicensis z3032]
          Length = 549

 Score =  213 bits (541), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 144/510 (28%), Positives = 247/510 (48%), Gaps = 58/510 (11%)

Query: 71  VELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTA 130
           + +K   L  +IN +G   +   L  Y  ++ S+ P   L     T N  +     ++  
Sbjct: 61  ITVKTDVLSLTINTRGGDIEQALLLAYPKELGSSEPFQLL---ETTPNFIYQAQSGLTGR 117

Query: 131 NNIELPNSNT----------VWNLISGK--ILTPTTPIKLVFKNANNILFERTISLDE-H 177
           N  + PN+N            + L  G+  +L P T     F +A    F +T +L    
Sbjct: 118 NGPDNPNNNQGRPLYNVERDTYVLADGQDELLIPMT-----FTDAAGNAFTKTFALKRGQ 172

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMR------HKPQTATNTFGVQ--EGFIAVLGDKSL 229
           Y   +   V N     +  S  G++ +      H+  T +N F +    G      D+  
Sbjct: 173 YAVYVGYDVKNAGTQPLEVSSFGQLKQTIDLPSHR-DTGSNNFALHTFRGAAYSTPDEKY 231

Query: 230 VEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKF 289
            + K+  I      N +    W+ +  +Y+A+ ++P+   +  S F     GH      +
Sbjct: 232 EKYKFDTIADDENLNVNAKGGWVAMLQQYFATAWVPASNVT--SNFYTADLGHGVAAIGY 289

Query: 290 SANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFML 349
            +  + + PG++    + L+ G    P I      +A P  ++ +D+GW +FI++P+F L
Sbjct: 290 KSEPVQVQPGQTAKLASTLWVG----PEIQDKMAAVA-PHLDLTVDYGWLWFISQPLFKL 344

Query: 350 MSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQ 409
           + + ++ +GN+G +I+  T  V+ + +PL K QY S A M+ +QPKI  +RE+      Q
Sbjct: 345 LKWIHSFLGNWGFSIIAITFIVRGVMYPLTKAQYTSMAKMRLLQPKIQAMRERLGDD-KQ 403

Query: 410 VLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAAD 469
            + + M+ LYK   +NPL GC+P+L+Q+P+F A+Y ++  S+E+RHAPF  WI DL+A D
Sbjct: 404 RMSQEMMALYKAEKVNPLGGCFPLLIQMPIFLALYYMLMGSVELRHAPFALWIHDLSAQD 463

Query: 470 PTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFV 528
                      P+Y        I PI+M  +MF   KMSP    D  Q  I+ +MPV+F 
Sbjct: 464 -----------PYY--------ILPILMGATMFFIQKMSPTTVTDPMQQKIMTFMPVIFT 504

Query: 529 FALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
                FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 505 VFFLWFPSGLVLYYIVSNLVTILQQQLIYR 534


>gi|53724898|ref|YP_104854.1| inner membrane protein translocase component YidC [Burkholderia
           mallei ATCC 23344]
 gi|67639597|ref|ZP_00438442.1| inner membrane protein, 60 kDa [Burkholderia mallei GB8 horse 4]
 gi|121600195|ref|YP_994138.1| putative inner membrane protein translocase component YidC
           [Burkholderia mallei SAVP1]
 gi|124386283|ref|YP_001028205.1| putative inner membrane protein translocase component YidC
           [Burkholderia mallei NCTC 10229]
 gi|126451415|ref|YP_001083056.1| putative inner membrane protein translocase component YidC
           [Burkholderia mallei NCTC 10247]
 gi|167001176|ref|ZP_02266975.1| membrane protein OxaA [Burkholderia mallei PRL-20]
 gi|254174811|ref|ZP_04881472.1| inner membrane protein, 60 kDa [Burkholderia mallei ATCC 10399]
 gi|254201964|ref|ZP_04908328.1| membrane protein OxaA [Burkholderia mallei FMH]
 gi|254207296|ref|ZP_04913647.1| membrane protein OxaA [Burkholderia mallei JHU]
 gi|254359605|ref|ZP_04975876.1| membrane protein OxaA [Burkholderia mallei 2002721280]
 gi|81684886|sp|Q62EM4|OXAA_BURMA RecName: Full=Inner membrane protein oxaA
 gi|166975852|sp|A3MS20|OXAA_BURM7 RecName: Full=Inner membrane protein oxaA
 gi|166975853|sp|A2S8D6|OXAA_BURM9 RecName: Full=Inner membrane protein oxaA
 gi|166975854|sp|A1V7D5|OXAA_BURMS RecName: Full=Inner membrane protein oxaA
 gi|52428321|gb|AAU48914.1| inner membrane protein, 60 kDa [Burkholderia mallei ATCC 23344]
 gi|121229005|gb|ABM51523.1| inner membrane protein, 60 kDa [Burkholderia mallei SAVP1]
 gi|124294303|gb|ABN03572.1| inner membrane protein, 60 kDa [Burkholderia mallei NCTC 10229]
 gi|126244285|gb|ABO07378.1| inner membrane protein, 60 kDa [Burkholderia mallei NCTC 10247]
 gi|147747858|gb|EDK54934.1| membrane protein OxaA [Burkholderia mallei FMH]
 gi|147752838|gb|EDK59904.1| membrane protein OxaA [Burkholderia mallei JHU]
 gi|148028819|gb|EDK86751.1| membrane protein OxaA [Burkholderia mallei 2002721280]
 gi|160695856|gb|EDP85826.1| inner membrane protein, 60 kDa [Burkholderia mallei ATCC 10399]
 gi|238520165|gb|EEP83627.1| inner membrane protein, 60 kDa [Burkholderia mallei GB8 horse 4]
 gi|243063003|gb|EES45189.1| membrane protein OxaA [Burkholderia mallei PRL-20]
          Length = 558

 Score =  213 bits (541), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 152/499 (30%), Positives = 233/499 (46%), Gaps = 58/499 (11%)

Query: 80  GSINLKGAQFDDLNLR----GYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIEL 135
           G I+ +G     L L     G   D+S     VTL       + Y A    +      + 
Sbjct: 94  GEIDTRGGTLAKLTLTKAGDGKQPDLS-----VTLFD-HTANHTYLARTGLLGG----DF 143

Query: 136 PNSNTVWNLISGKI----------LTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDT 185
           PN N V+  ++G            L+  +P+K   K      F R       Y+  +   
Sbjct: 144 PNHNDVYAQVAGPTSLAADQNTLKLSFESPVKGGVKVVKTYTFTRG-----SYVIGVDTK 198

Query: 186 VTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ-KYSDIEKSSISN 244
           + N     +  S    ++R      T  F       AV  D+   ++  + DI+K+    
Sbjct: 199 IENVGAAPVTPSVYMELVRDNSSVETPMFSHTFLGPAVYTDQKHFQKITFGDIDKNKADY 258

Query: 245 FHES-NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSIT 303
              + N W+ +   Y+AS +IP          + +     R   K     I   PG+S  
Sbjct: 259 VTSADNGWIAMVQHYFASAWIPQSGAKRDIYVEKIDPTLYRVGVKQPVEAIA--PGQSAD 316

Query: 304 TTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIA 363
            +  LFAG +E   +         P  E++ D+GW   IAKP+F L+   +  VGN+G A
Sbjct: 317 VSARLFAGPEEERMLEGIA-----PGLELVKDYGWVTIIAKPLFWLLEKIHGFVGNWGWA 371

Query: 364 IMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHN 423
           I+L T+ +K +FFPL+   Y S A MK I P++  LRE+FK S PQ +  A+++LYKT  
Sbjct: 372 IVLLTLLIKAVFFPLSAASYKSMARMKEITPRMQALRERFK-SDPQKMNAALMELYKTEK 430

Query: 424 INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY 483
           +NP  GC P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  DP  I          
Sbjct: 431 VNPFGGCLPVVIQIPVFISLYWVLLASVEMRGAPWVLWIHDLSQRDPYFIL--------- 481

Query: 484 LPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWS 543
                     P++M++SMF+Q K++P P D  QA ++ +MP+ F      FPAGL++Y+ 
Sbjct: 482 ----------PVLMAVSMFVQTKLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVLYYV 531

Query: 544 WSNVISIVQQAVIMKMHGA 562
            +NV+SI QQ  I +  G 
Sbjct: 532 VNNVLSIAQQYYITRTLGG 550


>gi|171316349|ref|ZP_02905569.1| 60 kDa inner membrane insertion protein [Burkholderia ambifaria
           MEX-5]
 gi|171098478|gb|EDT43280.1| 60 kDa inner membrane insertion protein [Burkholderia ambifaria
           MEX-5]
          Length = 554

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 153/493 (31%), Positives = 242/493 (49%), Gaps = 45/493 (9%)

Query: 80  GSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSN 139
           G I+ +G     L L+    D       +TL       + Y A    +      + PN N
Sbjct: 91  GEIDTRGGTLAKLTLKK-QGDGKQPDLYITLFD-HTAGHTYLARTGLLGG----DFPNHN 144

Query: 140 TVWNLISGKILTPT---TPIKLVFKN--ANNILFERTISLDEHYLFKIVDTVTNNSIDQI 194
            V+  ++    + T     +KL F++     +   +T +         VDT  +N +   
Sbjct: 145 DVYTQVNAGPTSLTGDQNALKLSFESPVKGGVKVVKTYTFTRGSYVIGVDTKIDN-VGTA 203

Query: 195 RFSPRGRIMRHKPQTATNTFGVQEGFI--AVLGD-KSLVEQKYSDIEKSSISNFHES--N 249
             +P   +   +  TA  T      F+  AV  D K   +  +SD++K+  +NF ++  N
Sbjct: 204 PVTPTVYMELVRDNTAVETPMFSHTFLGPAVYTDAKHFQKIDFSDLDKNK-ANFEKAADN 262

Query: 250 SWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLF 309
            W+ +   Y+AS +IP +        + +      Y+         I PG+S      LF
Sbjct: 263 GWVAMVQHYFASAWIPQQGAKRDIYAEKIDP--TLYRVGVKQPVAAIAPGQSADVQARLF 320

Query: 310 AGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTV 369
           AG +E   +         P  E++ D+GW   IAKP+F L+   ++ VGN+G AI+L TV
Sbjct: 321 AGPEEERMLEGIA-----PGLELVKDYGWVTIIAKPLFWLLEKIHSYVGNWGWAIVLLTV 375

Query: 370 FVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAG 429
            +K +FFPL+   Y S A MK I P++  LRE+FK S PQ +  A+++LYKT  +NP  G
Sbjct: 376 LIKAVFFPLSAASYKSMARMKEITPRMQALRERFK-SDPQKMNAALMELYKTEKVNPFGG 434

Query: 430 CWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMH 489
           C P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  D           PF+      
Sbjct: 435 CLPVVIQIPVFISLYWVLLASVEMRGAPWILWIHDLSQRD-----------PFF------ 477

Query: 490 VGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVIS 549
             I P++M++SMF+Q  ++P P D  QA ++ +MP+ F      FPAGL++Y+  +NV+S
Sbjct: 478 --ILPVLMAVSMFVQTSLNPTPPDPVQAKMMKFMPIAFSVMFFFFPAGLVLYYVVNNVLS 535

Query: 550 IVQQAVIMKMHGA 562
           I QQ  I +  G 
Sbjct: 536 IAQQYYITRKLGG 548


>gi|167843727|ref|ZP_02469235.1| putative inner membrane protein translocase component YidC
           [Burkholderia pseudomallei B7210]
          Length = 499

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 151/499 (30%), Positives = 233/499 (46%), Gaps = 58/499 (11%)

Query: 80  GSINLKGAQFDDLNLR----GYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIEL 135
           G I+ +G     L L     G   D+S     VTL       + Y A    +      + 
Sbjct: 35  GEIDTRGGTLAKLTLTKAGDGKQPDLS-----VTLFD-HTANHTYLARTGLLGG----DF 84

Query: 136 PNSNTVWNLISGKI----------LTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDT 185
           PN N V+  ++G            L+  +P+K   K      F R       Y+  +   
Sbjct: 85  PNHNDVYAQVAGPTSLAADQNTLKLSFESPVKGGVKVVKTYTFTRG-----SYVIGVDTK 139

Query: 186 VTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ-KYSDIEKSSISN 244
           + N     +  S    ++R      T  F       AV  D+   ++  + DI+K+    
Sbjct: 140 IENVGAAPVTPSVYMELVRDNSSVETPMFSHTFLGPAVYTDQKHFQKITFGDIDKNKADY 199

Query: 245 FHES-NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSIT 303
              + N W+ +   Y+AS +IP          + +      Y+         I PG+S  
Sbjct: 200 VTSADNGWIAMVQHYFASAWIPQSGAKRDIYVEKIDP--TLYRVGVKQPVAAIAPGQSAD 257

Query: 304 TTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIA 363
            +  LFAG +E   +         P  E++ D+GW   IAKP+F L+   +  VGN+G A
Sbjct: 258 VSARLFAGPEEERMLEGIA-----PGLELVKDYGWVTIIAKPLFWLLEKIHGFVGNWGWA 312

Query: 364 IMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHN 423
           I+L T+ +K +FFPL+   Y S A MK I P++  LRE+FK S PQ +  A+++LYKT  
Sbjct: 313 IVLLTLLIKAVFFPLSAASYKSMARMKEITPRMQALRERFK-SDPQKMNAALMELYKTEK 371

Query: 424 INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY 483
           +NP  GC P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  DP  I          
Sbjct: 372 VNPFGGCLPVVIQIPVFISLYWVLLASVEMRGAPWVLWIHDLSQRDPYFIL--------- 422

Query: 484 LPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWS 543
                     P++M++SMF+Q K++P P D  QA ++ +MP+ F      FPAGL++Y+ 
Sbjct: 423 ----------PVLMAVSMFVQTKLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVLYYV 472

Query: 544 WSNVISIVQQAVIMKMHGA 562
            +NV+SI QQ  I +  G 
Sbjct: 473 VNNVLSIAQQYYITRTLGG 491


>gi|307731536|ref|YP_003908760.1| membrane protein insertase, YidC/Oxa1 family domain containing
           protein [Burkholderia sp. CCGE1003]
 gi|307586071|gb|ADN59469.1| membrane protein insertase, YidC/Oxa1 family domain containing
           protein [Burkholderia sp. CCGE1003]
          Length = 552

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 151/497 (30%), Positives = 242/497 (48%), Gaps = 55/497 (11%)

Query: 80  GSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSN 139
           G I+ +G     L+L     D      ++TL   +   + Y A    +      + PN N
Sbjct: 89  GEIDTRGGTLSKLSLVK-EGDGKQPDLVITLFDRTGN-HTYLARTGLLGG----DFPNHN 142

Query: 140 TVWNLISGK-----------ILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTN 188
            V+ L+  +            L+  +P+K   K      F R       Y+  +   + N
Sbjct: 143 DVYTLMPNQQTDLKGDQKSFSLSFESPVKGGLKVIKTYTFTRG-----SYVIGVDTKIQN 197

Query: 189 NSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFI--AVLGDKSLVEQ-KYSDIEKSSISNF 245
                +  S    ++R      T  F     FI  AV  D+   ++  + DI+K+     
Sbjct: 198 VGTTPVSPSVYMELVRDDQPVETPRF--SHTFIGPAVYTDQHHFQKMTFGDIDKNKEDYA 255

Query: 246 HES-NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITT 304
            ++ N W+ +   Y+AS +IP +        + +    A Y+         I PG+++  
Sbjct: 256 KQADNGWIAMVQHYFASAWIPQQGVKRDIYVEKIDP--ALYRVGVKQPVAAIAPGQTVDV 313

Query: 305 TNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAI 364
           +  LFAG +E        + +A P  E++ D+GW   IAKP+F L+   ++ VGN+G AI
Sbjct: 314 SARLFAGPEE----ERMLEGIA-PGLELVKDYGWVTIIAKPLFWLLEKIHSYVGNWGWAI 368

Query: 365 MLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNI 424
           +L T+ +K +FFPL+   Y S A MK I P++  LRE+FK   PQ +  A+++LYKT  +
Sbjct: 369 VLLTLLIKAVFFPLSAASYKSMARMKAITPRMQALRERFKGD-PQKMNAALMELYKTEKV 427

Query: 425 NPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYL 484
           NP  GC P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  DP  I           
Sbjct: 428 NPFGGCLPVVVQIPVFISLYWVLLSSVEMRGAPWILWIHDLSQQDPYFIL---------- 477

Query: 485 PGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSW 544
                    P++M++SMF+Q K++P P D  QA ++ +MP+ F      FPAGL++Y+  
Sbjct: 478 ---------PVLMAVSMFLQTKLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVLYYVV 528

Query: 545 SNVISIVQQAVIMKMHG 561
           +NV+SI QQ  I +M G
Sbjct: 529 NNVLSIAQQYYITRMMG 545


>gi|167908935|ref|ZP_02496026.1| putative inner membrane protein translocase component YidC
           [Burkholderia pseudomallei 112]
          Length = 486

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 151/499 (30%), Positives = 233/499 (46%), Gaps = 58/499 (11%)

Query: 80  GSINLKGAQFDDLNLR----GYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIEL 135
           G I+ +G     L L     G   D+S     VTL       + Y A    +      + 
Sbjct: 22  GEIDTRGGTLAKLTLTKAGDGKQPDLS-----VTLFD-HTANHTYLARTGLLGG----DF 71

Query: 136 PNSNTVWNLISGKI----------LTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDT 185
           PN N V+  ++G            L+  +P+K   K      F R       Y+  +   
Sbjct: 72  PNHNDVYAQVAGPTSLAADQNTLKLSFESPVKGGVKVVKTYTFTRG-----SYVIGVDTK 126

Query: 186 VTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ-KYSDIEKSSISN 244
           + N     +  S    ++R      T  F       AV  D+   ++  + DI+K+    
Sbjct: 127 IENVGAAPVTPSVYMELVRDNSSVETPMFSHTFLGPAVYTDQKHFQKITFGDIDKNKADY 186

Query: 245 FHES-NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSIT 303
              + N W+ +   Y+AS +IP          + +      Y+         I PG+S  
Sbjct: 187 VTSADNGWIAMVQHYFASAWIPQSGAKRDIYVEKIDP--TLYRVGVKQPVAAIAPGQSAD 244

Query: 304 TTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIA 363
            +  LFAG +E   +         P  E++ D+GW   IAKP+F L+   +  VGN+G A
Sbjct: 245 VSARLFAGPEEERMLEGIA-----PGLELVKDYGWVTIIAKPLFWLLEKIHGFVGNWGWA 299

Query: 364 IMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHN 423
           I+L T+ +K +FFPL+   Y S A MK I P++  LRE+FK S PQ +  A+++LYKT  
Sbjct: 300 IVLLTLLIKAVFFPLSAASYKSMARMKEITPRMQALRERFK-SDPQKMNAALMELYKTEK 358

Query: 424 INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY 483
           +NP  GC P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  DP  I          
Sbjct: 359 VNPFGGCLPVVIQIPVFISLYWVLLASVEMRGAPWVLWIHDLSQRDPYFIL--------- 409

Query: 484 LPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWS 543
                     P++M++SMF+Q K++P P D  QA ++ +MP+ F      FPAGL++Y+ 
Sbjct: 410 ----------PVLMAVSMFVQTKLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVLYYV 459

Query: 544 WSNVISIVQQAVIMKMHGA 562
            +NV+SI QQ  I +  G 
Sbjct: 460 VNNVLSIAQQYYITRTLGG 478


>gi|167822122|ref|ZP_02453593.1| putative inner membrane protein translocase component YidC
           [Burkholderia pseudomallei 9]
          Length = 492

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 151/499 (30%), Positives = 233/499 (46%), Gaps = 58/499 (11%)

Query: 80  GSINLKGAQFDDLNLR----GYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIEL 135
           G I+ +G     L L     G   D+S     VTL       + Y A    +      + 
Sbjct: 28  GEIDTRGGTLAKLTLTKAGDGKQPDLS-----VTLFD-HTANHTYLARTGLLGG----DF 77

Query: 136 PNSNTVWNLISGKI----------LTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDT 185
           PN N V+  ++G            L+  +P+K   K      F R       Y+  +   
Sbjct: 78  PNHNDVYAQVAGPTSLAADQNTLKLSFESPVKGGVKVVKTYTFTRG-----SYVIGVDTK 132

Query: 186 VTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ-KYSDIEKSSISN 244
           + N     +  S    ++R      T  F       AV  D+   ++  + DI+K+    
Sbjct: 133 IENVGAAPVTPSVYMELVRDNSSVETPMFSHTFLGPAVYTDQKHFQKITFGDIDKNKADY 192

Query: 245 FHES-NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSIT 303
              + N W+ +   Y+AS +IP          + +      Y+         I PG+S  
Sbjct: 193 VTSADNGWIAMVQHYFASAWIPQSGAKRDIYVEKIDP--TLYRVGVKQPVAAIAPGQSAD 250

Query: 304 TTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIA 363
            +  LFAG +E   +         P  E++ D+GW   IAKP+F L+   +  VGN+G A
Sbjct: 251 VSARLFAGPEEERMLEGIA-----PGLELVKDYGWVTIIAKPLFWLLEKIHGFVGNWGWA 305

Query: 364 IMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHN 423
           I+L T+ +K +FFPL+   Y S A MK I P++  LRE+FK S PQ +  A+++LYKT  
Sbjct: 306 IVLLTLLIKAVFFPLSAASYKSMARMKEITPRMQALRERFK-SDPQKMNAALMELYKTEK 364

Query: 424 INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY 483
           +NP  GC P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  DP  I          
Sbjct: 365 VNPFGGCLPVVIQIPVFISLYWVLLASVEMRGAPWVLWIHDLSQRDPYFIL--------- 415

Query: 484 LPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWS 543
                     P++M++SMF+Q K++P P D  QA ++ +MP+ F      FPAGL++Y+ 
Sbjct: 416 ----------PVLMAVSMFVQTKLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVLYYV 465

Query: 544 WSNVISIVQQAVIMKMHGA 562
            +NV+SI QQ  I +  G 
Sbjct: 466 VNNVLSIAQQYYITRTLGG 484


>gi|167736503|ref|ZP_02409277.1| putative inner membrane protein translocase component YidC
           [Burkholderia pseudomallei 14]
          Length = 496

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 151/499 (30%), Positives = 233/499 (46%), Gaps = 58/499 (11%)

Query: 80  GSINLKGAQFDDLNLR----GYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIEL 135
           G I+ +G     L L     G   D+S     VTL       + Y A    +      + 
Sbjct: 32  GEIDTRGGTLAKLTLTKAGDGKQPDLS-----VTLFD-HTANHTYLARTGLLGG----DF 81

Query: 136 PNSNTVWNLISGKI----------LTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDT 185
           PN N V+  ++G            L+  +P+K   K      F R       Y+  +   
Sbjct: 82  PNHNDVYAQVAGPTSLAADQNTLKLSFESPVKGGVKVVKTYTFTRG-----SYVIGVDTK 136

Query: 186 VTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ-KYSDIEKSSISN 244
           + N     +  S    ++R      T  F       AV  D+   ++  + DI+K+    
Sbjct: 137 IENVGAAPVTPSVYMELVRDNSSVETPMFSHTFLGPAVYTDQKHFQKITFGDIDKNKADY 196

Query: 245 FHES-NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSIT 303
              + N W+ +   Y+AS +IP          + +      Y+         I PG+S  
Sbjct: 197 VTSADNGWIAMVQHYFASAWIPQSGAKRDIYVEKIDP--TLYRVGVKQPVAAIAPGQSAD 254

Query: 304 TTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIA 363
            +  LFAG +E   +         P  E++ D+GW   IAKP+F L+   +  VGN+G A
Sbjct: 255 VSARLFAGPEEERMLEGIA-----PGLELVKDYGWVTIIAKPLFWLLEKIHGFVGNWGWA 309

Query: 364 IMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHN 423
           I+L T+ +K +FFPL+   Y S A MK I P++  LRE+FK S PQ +  A+++LYKT  
Sbjct: 310 IVLLTLLIKAVFFPLSAASYKSMARMKEITPRMQALRERFK-SDPQKMNAALMELYKTEK 368

Query: 424 INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY 483
           +NP  GC P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  DP  I          
Sbjct: 369 VNPFGGCLPVVIQIPVFISLYWVLLASVEMRGAPWVLWIHDLSQRDPYFIL--------- 419

Query: 484 LPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWS 543
                     P++M++SMF+Q K++P P D  QA ++ +MP+ F      FPAGL++Y+ 
Sbjct: 420 ----------PVLMAVSMFVQTKLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVLYYV 469

Query: 544 WSNVISIVQQAVIMKMHGA 562
            +NV+SI QQ  I +  G 
Sbjct: 470 VNNVLSIAQQYYITRTLGG 488


>gi|325275325|ref|ZP_08141278.1| membrane protein insertase [Pseudomonas sp. TJI-51]
 gi|324099573|gb|EGB97466.1| membrane protein insertase [Pseudomonas sp. TJI-51]
          Length = 560

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 128/365 (35%), Positives = 202/365 (55%), Gaps = 31/365 (8%)

Query: 196 FSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS--DIEKSSISNFHESNSWLG 253
           F+   R     P ++T T G      A L   S   +K S  D++K ++   + S  W+ 
Sbjct: 214 FAQLKRDASGDPSSSTAT-GTATYLGAALWTASEPYKKVSMKDMDKGNLKE-NVSGGWVA 271

Query: 254 ISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAK 313
               Y+ + +IP+K  +   Q +   D    Y   ++   + +  G  + T+  L+AG  
Sbjct: 272 WLQHYFVTAWIPAKSDNNVVQTR--KDSQGNYIIGYTGPALNVPAGGKVETSAMLYAG-- 327

Query: 314 EFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKL 373
             P I    K+L+ P  E+ +D+G+ +FIA+P+F L+ + ++L+GN+G +I++ T+ +K 
Sbjct: 328 --PKIQSKLKELS-PGLELTVDYGFLWFIAQPIFWLLQHIHSLLGNWGWSIIVLTMLIKG 384

Query: 374 LFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPI 433
           LFFPL+   Y S A M+ + PK+  L+E+F     Q + +AM++LYK   INPL GC PI
Sbjct: 385 LFFPLSAASYRSMARMRAVAPKLAALKERFGDD-RQKMSQAMMELYKKEKINPLGGCLPI 443

Query: 434 LLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIW 493
           L+Q+PVF A+Y V+  S+EMR AP+  WI DL+  D           PF+        I 
Sbjct: 444 LVQMPVFLALYWVLLESVEMRQAPWMLWITDLSIKD-----------PFF--------IL 484

Query: 494 PIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQ 553
           PIIM  +MFIQ +++P P D  QA ++  MP++F F    FPAGL++YW  +N +SI QQ
Sbjct: 485 PIIMGATMFIQQRLNPTPPDPMQAKVMKMMPIIFTFFFLWFPAGLVLYWVVNNCLSISQQ 544

Query: 554 AVIMK 558
             I +
Sbjct: 545 WYITR 549


>gi|229593497|ref|YP_002875616.1| putative inner membrane protein translocase component YidC
           [Pseudomonas fluorescens SBW25]
 gi|259515713|sp|C3K1G2|OXAA_PSEFS RecName: Full=Inner membrane protein oxaA
 gi|229365363|emb|CAY53750.1| putative inner membrane protein [Pseudomonas fluorescens SBW25]
          Length = 560

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 119/323 (36%), Positives = 186/323 (57%), Gaps = 28/323 (8%)

Query: 236 DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
           DI+K S+    +   W+     Y+ + +IP+K  +   Q +   D    Y   F+   +T
Sbjct: 255 DIDKGSLKETVQGG-WVAWLQHYFVTAWIPNKGDANLVQTR--KDSQGNYIIGFTGPALT 311

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           + PG    T+  L+AG K    +    K+L+ P  E+ +D+G+ +FIA+P+F L+ + ++
Sbjct: 312 VAPGAKAETSATLYAGPKSQAVL----KELS-PGLELTVDYGFLWFIAQPIFWLLQHIHS 366

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
           +VGN+G +I+  T+ +K +FFPL+   Y S A M+ + PK+  L+E+      Q + +AM
Sbjct: 367 IVGNWGWSIIFLTMLIKGIFFPLSAASYKSMARMRAVAPKLAALKEQHGDDR-QKMSQAM 425

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           ++LYK   INPL GC PIL+Q+PVF ++Y V+  S+EMR APF  WI DL+  D      
Sbjct: 426 MELYKKEKINPLGGCLPILVQMPVFLSLYWVLLESVEMRQAPFMLWITDLSIKD------ 479

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFP 535
                PF+        I PIIM  +MFIQ +++P P D  QA ++  MP++F F    FP
Sbjct: 480 -----PFF--------ILPIIMGATMFIQQRLNPTPPDPMQAKVMKMMPIIFTFFFLWFP 526

Query: 536 AGLIIYWSWSNVISIVQQAVIMK 558
           AGL++YW  +NV+SI QQ  I +
Sbjct: 527 AGLVLYWVVNNVLSISQQWYITR 549


>gi|126439633|ref|YP_001057148.1| putative inner membrane protein translocase component YidC
           [Burkholderia pseudomallei 668]
 gi|166975856|sp|A3N477|OXAA_BURP6 RecName: Full=Inner membrane protein oxaA
 gi|126219126|gb|ABN82632.1| membrane protein insertase, YidC/Oxa1 family [Burkholderia
           pseudomallei 668]
          Length = 558

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 151/499 (30%), Positives = 233/499 (46%), Gaps = 58/499 (11%)

Query: 80  GSINLKGAQFDDLNLR----GYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIEL 135
           G I+ +G     L L     G   D+S     VTL       + Y A    +      + 
Sbjct: 94  GEIDTRGGTLAKLTLTKAGDGKQPDLS-----VTLFD-HTANHTYLARTGLLGG----DF 143

Query: 136 PNSNTVWNLISGKI----------LTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDT 185
           PN N V+  ++G            L+  +P+K   K      F R       Y+  +   
Sbjct: 144 PNHNDVYAQVAGPTSLAADQNTLKLSFESPVKGGVKVVKTYTFTRG-----SYVIGVDTK 198

Query: 186 VTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ-KYSDIEKSSISN 244
           + N     +  S    ++R      T  F       AV  D+   ++  + DI+K+    
Sbjct: 199 IENVGAAPVTPSVYMELVRDNSSVETPMFSHTFLGPAVYTDQKHFQKITFGDIDKNKADY 258

Query: 245 FHES-NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSIT 303
              + N W+ +   Y+AS +IP          + +      Y+         I PG+S  
Sbjct: 259 VTSADNGWIAMVQHYFASAWIPQSGAKRDIYVEKIDP--TLYRVGVKQPVAAIAPGQSAD 316

Query: 304 TTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIA 363
            +  LFAG +E   +         P  E++ D+GW   IAKP+F L+   +  VGN+G A
Sbjct: 317 VSARLFAGPEEERMLEGIA-----PGLELVKDYGWVTIIAKPLFWLLEKIHGFVGNWGWA 371

Query: 364 IMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHN 423
           I+L T+ +K +FFPL+   Y S A MK I P++  LRE+FK S PQ +  A+++LYKT  
Sbjct: 372 IVLLTLLIKAVFFPLSAASYKSMARMKEITPRMQALRERFK-SDPQKMNAALMELYKTEK 430

Query: 424 INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY 483
           +NP  GC P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  DP  I          
Sbjct: 431 VNPFGGCLPVVIQIPVFISLYWVLLASVEMRGAPWVLWIHDLSQRDPYFIL--------- 481

Query: 484 LPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWS 543
                     P++M++SMF+Q K++P P D  QA ++ +MP+ F      FPAGL++Y+ 
Sbjct: 482 ----------PVLMAVSMFVQTKLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVLYYV 531

Query: 544 WSNVISIVQQAVIMKMHGA 562
            +NV+SI QQ  I +  G 
Sbjct: 532 VNNVLSIAQQYYITRTLGG 550


>gi|53717718|ref|YP_106704.1| putative inner membrane protein translocase component YidC
           [Burkholderia pseudomallei K96243]
 gi|76811170|ref|YP_331720.1| putative inner membrane protein translocase component YidC
           [Burkholderia pseudomallei 1710b]
 gi|126453447|ref|YP_001064392.1| putative inner membrane protein translocase component YidC
           [Burkholderia pseudomallei 1106a]
 gi|167813580|ref|ZP_02445260.1| putative inner membrane protein translocase component YidC
           [Burkholderia pseudomallei 91]
 gi|167892205|ref|ZP_02479607.1| putative inner membrane protein translocase component YidC
           [Burkholderia pseudomallei 7894]
 gi|167900716|ref|ZP_02487921.1| putative inner membrane protein translocase component YidC
           [Burkholderia pseudomallei NCTC 13177]
 gi|167916975|ref|ZP_02504066.1| putative inner membrane protein translocase component YidC
           [Burkholderia pseudomallei BCC215]
 gi|217423939|ref|ZP_03455439.1| membrane protein insertase, YidC/Oxa1 family [Burkholderia
           pseudomallei 576]
 gi|226193291|ref|ZP_03788901.1| membrane protein insertase, YidC/Oxa1 family [Burkholderia
           pseudomallei Pakistan 9]
 gi|237810283|ref|YP_002894734.1| inner membrane protein OxaA [Burkholderia pseudomallei MSHR346]
 gi|242316035|ref|ZP_04815051.1| membrane protein insertase, YidC/Oxa1 family [Burkholderia
           pseudomallei 1106b]
 gi|254184152|ref|ZP_04890743.1| membrane protein OxaA [Burkholderia pseudomallei 1655]
 gi|254186623|ref|ZP_04893140.1| membrane protein OxaA [Burkholderia pseudomallei Pasteur 52237]
 gi|254194722|ref|ZP_04901153.1| membrane protein OxaA [Burkholderia pseudomallei S13]
 gi|254262072|ref|ZP_04953126.1| membrane protein insertase, YidC/Oxa1 family [Burkholderia
           pseudomallei 1710a]
 gi|254298582|ref|ZP_04966033.1| membrane protein OxaA [Burkholderia pseudomallei 406e]
 gi|81690513|sp|Q63YW1|OXAA_BURPS RecName: Full=Inner membrane protein oxaA
 gi|123600731|sp|Q3JXI3|OXAA_BURP1 RecName: Full=Inner membrane protein oxaA
 gi|166975855|sp|A3NPX1|OXAA_BURP0 RecName: Full=Inner membrane protein oxaA
 gi|52208132|emb|CAH34062.1| putative membrane protein [Burkholderia pseudomallei K96243]
 gi|76580623|gb|ABA50098.1| inner membrane protein, 60 kDa [Burkholderia pseudomallei 1710b]
 gi|126227089|gb|ABN90629.1| membrane protein insertase, YidC/Oxa1 family [Burkholderia
           pseudomallei 1106a]
 gi|157808712|gb|EDO85882.1| membrane protein OxaA [Burkholderia pseudomallei 406e]
 gi|157934308|gb|EDO89978.1| membrane protein OxaA [Burkholderia pseudomallei Pasteur 52237]
 gi|169651472|gb|EDS84165.1| membrane protein OxaA [Burkholderia pseudomallei S13]
 gi|184214684|gb|EDU11727.1| membrane protein OxaA [Burkholderia pseudomallei 1655]
 gi|217393002|gb|EEC33024.1| membrane protein insertase, YidC/Oxa1 family [Burkholderia
           pseudomallei 576]
 gi|225934891|gb|EEH30868.1| membrane protein insertase, YidC/Oxa1 family [Burkholderia
           pseudomallei Pakistan 9]
 gi|237503961|gb|ACQ96279.1| inner membrane protein OxaA [Burkholderia pseudomallei MSHR346]
 gi|242139274|gb|EES25676.1| membrane protein insertase, YidC/Oxa1 family [Burkholderia
           pseudomallei 1106b]
 gi|254220761|gb|EET10145.1| membrane protein insertase, YidC/Oxa1 family [Burkholderia
           pseudomallei 1710a]
          Length = 558

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 151/499 (30%), Positives = 233/499 (46%), Gaps = 58/499 (11%)

Query: 80  GSINLKGAQFDDLNLR----GYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIEL 135
           G I+ +G     L L     G   D+S     VTL       + Y A    +      + 
Sbjct: 94  GEIDTRGGTLAKLTLTKAGDGKQPDLS-----VTLFD-HTANHTYLARTGLLGG----DF 143

Query: 136 PNSNTVWNLISGKI----------LTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDT 185
           PN N V+  ++G            L+  +P+K   K      F R       Y+  +   
Sbjct: 144 PNHNDVYAQVAGPTSLAADQNTLKLSFESPVKGGVKVVKTYTFTRG-----SYVIGVDTK 198

Query: 186 VTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ-KYSDIEKSSISN 244
           + N     +  S    ++R      T  F       AV  D+   ++  + DI+K+    
Sbjct: 199 IENVGAAPVTPSVYMELVRDNSSVETPMFSHTFLGPAVYTDQKHFQKITFGDIDKNKADY 258

Query: 245 FHES-NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSIT 303
              + N W+ +   Y+AS +IP          + +      Y+         I PG+S  
Sbjct: 259 VTSADNGWIAMVQHYFASAWIPQSGAKRDIYVEKIDP--TLYRVGVKQPVAAIAPGQSAD 316

Query: 304 TTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIA 363
            +  LFAG +E   +         P  E++ D+GW   IAKP+F L+   +  VGN+G A
Sbjct: 317 VSARLFAGPEEERMLEGIA-----PGLELVKDYGWVTIIAKPLFWLLEKIHGFVGNWGWA 371

Query: 364 IMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHN 423
           I+L T+ +K +FFPL+   Y S A MK I P++  LRE+FK S PQ +  A+++LYKT  
Sbjct: 372 IVLLTLLIKAVFFPLSAASYKSMARMKEITPRMQALRERFK-SDPQKMNAALMELYKTEK 430

Query: 424 INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFY 483
           +NP  GC P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  DP  I          
Sbjct: 431 VNPFGGCLPVVIQIPVFISLYWVLLASVEMRGAPWVLWIHDLSQRDPYFIL--------- 481

Query: 484 LPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWS 543
                     P++M++SMF+Q K++P P D  QA ++ +MP+ F      FPAGL++Y+ 
Sbjct: 482 ----------PVLMAVSMFVQTKLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVLYYV 531

Query: 544 WSNVISIVQQAVIMKMHGA 562
            +NV+SI QQ  I +  G 
Sbjct: 532 VNNVLSIAQQYYITRTLGG 550


>gi|325519717|gb|EGC99037.1| membrane protein insertase [Burkholderia sp. TJI49]
          Length = 553

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 154/492 (31%), Positives = 239/492 (48%), Gaps = 43/492 (8%)

Query: 80  GSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSN 139
           G I+ +G     L L+    D       +TL       + Y A     S     + PN N
Sbjct: 90  GEIDTRGGTLAKLTLKK-QGDGKQPDLYITLFD-HTAGHTYLAR----SGLLGGDFPNHN 143

Query: 140 TVWNLISGKILTPT---TPIKLVFKN--ANNILFERTISLDEHYLFKIVDTVTNNSIDQI 194
            V+  +S    + T     +KL F++     +   +T +         VDT  +N +   
Sbjct: 144 DVYTQVSTGPTSLTGDQNTLKLSFESPVKGGVKVVKTYTFTRGSYVIGVDTKIDN-VGTA 202

Query: 195 RFSPRGRIMRHKPQTATNTFGVQEGFI--AVLGD-KSLVEQKYSDIEKSSISNFHES-NS 250
             +P   +   +  TA  T      F+  AV  D K   +  +SD++K+       + N 
Sbjct: 203 PVTPTVYMELVRDNTAVETPMFSHTFLGPAVYTDAKHFQKINFSDLDKNKADYVTSADNG 262

Query: 251 WLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFA 310
           W+ +   Y+AS +IP +        + +    + Y+         I PG+S      LFA
Sbjct: 263 WVAMVQHYFASAWIPQQGVKRDIYAEKIDP--SLYRVGVKQPVAAIAPGQSADVQARLFA 320

Query: 311 GAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVF 370
           G +E   +         P  E++ D+GW   IAKP+F L+   + LVGN+G AI+L TV 
Sbjct: 321 GPEEERMLEGIA-----PGLELVKDYGWVTIIAKPLFWLLEKIHGLVGNWGWAIVLLTVL 375

Query: 371 VKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGC 430
           +K +FFPL+   Y S A MK I P++  LRE+FK S PQ +  A+++LYKT  +NP  GC
Sbjct: 376 IKAVFFPLSAASYKSMARMKEITPRMQALRERFK-SDPQKMNAALMELYKTEKVNPFGGC 434

Query: 431 WPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHV 490
            P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  D           PF+       
Sbjct: 435 LPVVIQIPVFISLYWVLLASVEMRGAPWILWIHDLSQRD-----------PFF------- 476

Query: 491 GIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISI 550
            I P++M++SMF+Q  ++P P D  QA ++ +MP+ F      FPAGL++Y+  +NV+SI
Sbjct: 477 -ILPVLMAVSMFVQTSLNPTPPDPVQAKMMKFMPIAFSVMFFFFPAGLVLYYVVNNVLSI 535

Query: 551 VQQAVIMKMHGA 562
            QQ  I +  G 
Sbjct: 536 AQQYYITRKLGG 547


>gi|323527919|ref|YP_004230072.1| membrane protein insertase, YidC/Oxa1 family domain containing
           [Burkholderia sp. CCGE1001]
 gi|323384921|gb|ADX57012.1| membrane protein insertase, YidC/Oxa1 family domain containing
           [Burkholderia sp. CCGE1001]
          Length = 552

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 151/497 (30%), Positives = 242/497 (48%), Gaps = 55/497 (11%)

Query: 80  GSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSN 139
           G I+ +G     L+L     D      ++TL   +   + Y A    +      + PN N
Sbjct: 89  GEIDTRGGTLSKLSLVK-QGDGKQPDLVITLFDRTGN-HTYLARTGLLGG----DFPNHN 142

Query: 140 TVWNLISGK-----------ILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTN 188
            V+ L+  +            L+  +P+K   K      F R       Y+  +   + N
Sbjct: 143 DVYTLMPNQQTELKGDQKSFSLSFESPVKGGVKVIKTYTFTRG-----SYVIGVDTKIQN 197

Query: 189 NSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFI--AVLGDKSLVEQ-KYSDIEKSSISNF 245
                +  S    ++R      T  F     FI  AV  D+   ++  + DI+K+     
Sbjct: 198 VGTAPVSPSVYMELVRDDQPVETPRF--SHTFIGPAVYTDQHHFQKMTFGDIDKNKEDYA 255

Query: 246 HES-NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITT 304
            ++ N W+ +   Y+AS +IP +        + +    A Y+         I PG+++  
Sbjct: 256 KQADNGWIAMVQHYFASAWIPQQGVKRDIYVEKIDP--ALYRVGVKEPVAAIAPGQTVDV 313

Query: 305 TNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAI 364
           +  LFAG +E        + +A P  E++ D+GW   IAKP+F L+   ++ VGN+G AI
Sbjct: 314 SARLFAGPEE----ERMLEGIA-PGLELVKDYGWVTIIAKPLFWLLEKIHSYVGNWGWAI 368

Query: 365 MLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNI 424
           +L T+ +K +FFPL+   Y S A MK I P++  LRE+FK   PQ +  A+++LYKT  +
Sbjct: 369 VLLTLLIKAVFFPLSAASYKSMARMKAITPRMQALRERFKGD-PQKMNAALMELYKTEKV 427

Query: 425 NPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYL 484
           NP  GC P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  DP  I           
Sbjct: 428 NPFGGCLPVVVQIPVFISLYWVLLSSVEMRGAPWILWIHDLSQQDPYFIL---------- 477

Query: 485 PGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSW 544
                    P++M++SMF+Q K++P P D  QA ++ +MP+ F      FPAGL++Y+  
Sbjct: 478 ---------PVLMAVSMFLQTKLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVLYYVV 528

Query: 545 SNVISIVQQAVIMKMHG 561
           +NV+SI QQ  I +M G
Sbjct: 529 NNVLSIAQQYYITRMMG 545


>gi|152983547|ref|YP_001351680.1| putative inner membrane protein translocase component YidC
           [Pseudomonas aeruginosa PA7]
 gi|166975880|sp|A6VF45|OXAA_PSEA7 RecName: Full=Inner membrane protein oxaA
 gi|150958705|gb|ABR80730.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 578

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 117/325 (36%), Positives = 184/325 (56%), Gaps = 32/325 (9%)

Query: 236 DIEKSSISNFHES--NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANE 293
           D++K     F ES    W+     Y+ + ++P+K      Q     DG   Y   F+   
Sbjct: 275 DMDKE---QFKESVQGGWVAWLQHYFVTAWVPTKGE--QHQVMTRKDGQGNYIVGFTGPT 329

Query: 294 ITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYF 353
           +++  G  + T   L+AG    P +  + K+L+ P  E+ +D+G+ +FIA+P+F L+ + 
Sbjct: 330 LSVPAGGKVETDLTLYAG----PKLQKHLKELS-PGLELTVDYGFLWFIAQPIFWLLQHI 384

Query: 354 YNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQK 413
           ++L+GN+G +I+  TV +KL FFPL+   Y S A M+ + PK+  ++E+      Q + +
Sbjct: 385 HSLIGNWGWSIIALTVLIKLAFFPLSAASYRSMARMRAVSPKMQAIKEQHGDDR-QKMSQ 443

Query: 414 AMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNI 473
           AM++LYK   INPL GC PIL+Q+PVF ++Y V+  S+EMR AP+ GWI DL+  D    
Sbjct: 444 AMMELYKKEKINPLGGCLPILVQMPVFLSLYWVLLESVEMRQAPWLGWITDLSVKD---- 499

Query: 474 FTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSS 533
                  PF+        I PI+M  +M IQ  ++P P D  QA ++  MP++F F    
Sbjct: 500 -------PFF--------ILPIVMGGTMLIQQMLNPTPPDPMQAKVMKLMPIIFTFFFLW 544

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMK 558
           FPAGL++YW  +NV+SI QQ  I +
Sbjct: 545 FPAGLVLYWVVNNVLSIAQQWYITR 569


>gi|153873748|ref|ZP_02002226.1| 60Kd inner membrane protein [Beggiatoa sp. PS]
 gi|152069784|gb|EDN67772.1| 60Kd inner membrane protein [Beggiatoa sp. PS]
          Length = 495

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 135/408 (33%), Positives = 214/408 (52%), Gaps = 31/408 (7%)

Query: 156 IKLVFKNANNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTF 214
           IKL ++N   I   +  +     Y+  +   V N S++       G+  R +     + F
Sbjct: 103 IKLHWQNDKGIKVTKIYTFHRGSYVIDVKYLVDNQSVEPWAGQLYGQFQRTQADLGGSRF 162

Query: 215 GVQEGFIAVLGDKSLVEQ-KYSDIEKSSISNFHE---SNSWLGISDKYWASVFIPSKETS 270
                  A+   ++L E+  + DIE SS +  +    +  W+ +   Y+ S ++P  E  
Sbjct: 163 IYTYMGGAISSPETLYEKIPFDDIEDSSFNQENRPAWAEGWIAMLQHYFVSAWVPKPEQI 222

Query: 271 FHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRF 330
                K L DG+ RY   F   +  + PG        LF G    P + +   +LA P  
Sbjct: 223 HKYYTKMLKDGN-RYVLGFYGPKQVVAPGTQEIFNIALFVG----PKLQNKLLELA-PGL 276

Query: 331 EMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMK 390
           ++ +D+GW +FIA+P+F ++ + ++  GN+G +I+L T+ +KL FF L+   Y S ANM+
Sbjct: 277 DLTVDYGWLWFIAQPLFWVLDWLHDWTGNWGWSIILLTIMIKLAFFHLSATSYKSMANMR 336

Query: 391 NIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISIS 450
            +QP++  L+E+F     + L +AM++LYK   INPL GC PIL+QIPVF A+Y V+  S
Sbjct: 337 RLQPRMITLKERFGDDKTK-LNQAMMELYKKEKINPLGGCLPILVQIPVFIALYWVLLES 395

Query: 451 LEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPP 510
           +E+R A F  WIKDL++ DP   F L                 P+IM  +M +Q  ++P 
Sbjct: 396 VELRQADFMWWIKDLSSPDP--FFVL-----------------PLIMGATMLVQHFLNPA 436

Query: 511 PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           P D  Q  ++  +P+VF    + FPAGL++YW  +NV+SI QQ VI K
Sbjct: 437 PIDPIQQKMMMMLPIVFTVFFAFFPAGLVLYWVANNVLSITQQWVITK 484


>gi|319940691|ref|ZP_08015033.1| inner membrane protein oxaA [Sutterella wadsworthensis 3_1_45B]
 gi|319805842|gb|EFW02609.1| inner membrane protein oxaA [Sutterella wadsworthensis 3_1_45B]
          Length = 565

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 134/443 (30%), Positives = 226/443 (51%), Gaps = 39/443 (8%)

Query: 118 NAYFAELDYVSTANNIELPNSNTVWNLISGKI-LTPTTPIKLVFK-NANNILFERTISLD 175
           +AY A+   V      + P  N  + L+S  + L     +K+VF+ +   +   +T +  
Sbjct: 137 HAYLAQTGLVGG----DYPTHNDEFKLVSQDLALGDKESMKVVFEADKGGLKVTKTFTFK 192

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPR--GRIMRH--KPQTATNTFGVQEGFIAVLGDKSLVE 231
             Y    VDT   N+ D+   +P+   ++ R   KP   ++ +    G      +++  +
Sbjct: 193 RGYYGIDVDTAVTNTTDKA-VTPQIYYQLTRDSSKPAGESSMYSTFTGPAFYTDEENFQK 251

Query: 232 QKYSDIEKSSISNFHESN-SWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFS 290
             +S+I         ++N  WL +   ++ S ++P +    H+  + L  GH  +     
Sbjct: 252 LSFSEIRDKDAKYVEDTNNGWLAMVQHHFVSAWVPPQGEVRHNYTRAL--GHDLFAVGTL 309

Query: 291 ANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLM 350
            +   I PG + T    L++G +E   +         P  E+++D+GW  F+AKP++ L+
Sbjct: 310 ISLKEIAPGATQTNHAVLYSGPQEQARLEQLA-----PGLELVVDYGWLTFLAKPIYWLL 364

Query: 351 SYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQV 410
            + Y +VGN+G AI+L T  VK + +P++   Y S A MK + P++  L+EK+K    Q 
Sbjct: 365 DFLYGIVGNWGWAIVLLTCIVKAVLYPISAAGYRSMARMKEVTPRLKALQEKYKDD-KQR 423

Query: 411 LQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADP 470
           L +AM++LYKT  INP+ GC PI+LQIPVF A+Y V+  S+E+R A +  W+ DLA  DP
Sbjct: 424 LNQAMMELYKTEKINPVGGCLPIMLQIPVFLALYWVLQGSVELRGAEWILWVHDLAMPDP 483

Query: 471 TNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFA 530
             +                    P +M+ +MF+Q+ ++P P D  QA ++  MPVVF   
Sbjct: 484 WFVL-------------------PALMAATMFLQILLNPKPTDPMQAKVMYIMPVVFSVM 524

Query: 531 LSSFPAGLIIYWSWSNVISIVQQ 553
              F AGL++YW  +N++SI QQ
Sbjct: 525 FFIFAAGLVLYWLTNNILSIAQQ 547


>gi|238028969|ref|YP_002913200.1| putative inner membrane protein translocase component YidC
           [Burkholderia glumae BGR1]
 gi|237878163|gb|ACR30496.1| Putative inner membrane protein translocase component YidC
           [Burkholderia glumae BGR1]
          Length = 553

 Score =  211 bits (537), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 152/489 (31%), Positives = 238/489 (48%), Gaps = 40/489 (8%)

Query: 80  GSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSN 139
           G I+ +G     L L+    D       VTL    +TK+  +     V+  N    PN N
Sbjct: 92  GEIDTRGGTLTKLTLKK-EGDGKQPDLFVTLFD--HTKDHTYLARTGVTGGN---FPNHN 145

Query: 140 TVWNLISG--KILTPTTPIKLVFKN--ANNILFERTISLDEHYLFKIVDT-VTNNSIDQI 194
            ++  +SG   +      +KL F++     +   +T +         VDT + N     +
Sbjct: 146 DLFTPLSGPRSLAAGQDTLKLSFESQEKGGVKVVKTYTFTRGSYVIGVDTKIENVGTAPV 205

Query: 195 RFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ-KYSDIEKSSISNFHES-NSWL 252
             +    I+R      T  F       AV  D+   ++  +SDI+K+       + N W+
Sbjct: 206 TPTVYMEIVRDSTPVETPLFSHTFLGPAVYTDQKHFQKITFSDIDKNKAEYVTSADNGWV 265

Query: 253 GISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGA 312
            +   Y+AS +IP          + +     R   K      TI PG+S   +  LFAG 
Sbjct: 266 AMVQHYFASAWIPQAGVKRDIYVEKIDPSLYRIGVKEPVK--TIEPGQSADVSARLFAGP 323

Query: 313 KEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVK 372
           +E   +         P  +++ D+GW   IAKP+F L+   +  VGN+G +I+L TV +K
Sbjct: 324 EEERVLEGIA-----PGLDLVKDYGWVTIIAKPLFWLLQKIHGYVGNWGWSIVLLTVLIK 378

Query: 373 LLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWP 432
            +FFPL+   Y S A MK I P++ +LRE+FK S PQ +  A+++LYKT  +NP  GC P
Sbjct: 379 AVFFPLSAASYKSMARMKEITPRMQQLRERFK-SDPQKMNAALMELYKTEKVNPFGGCLP 437

Query: 433 ILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGI 492
           +++QIPVF ++Y V+  S+EMR AP+  WI DL+  DP  I                   
Sbjct: 438 VVIQIPVFISLYWVLLASVEMRGAPWILWIHDLSQRDPYFIL------------------ 479

Query: 493 WPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQ 552
            P++M+ SMF+Q +++P P D  QA ++ +MP+ F      FPAGL++Y+  +NV+SI Q
Sbjct: 480 -PVLMAGSMFLQTRLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVLYYVVNNVLSIAQ 538

Query: 553 QAVIMKMHG 561
           Q  I +  G
Sbjct: 539 QYYITRAIG 547


>gi|187479885|ref|YP_787910.1| putative inner membrane protein translocase component YidC
           [Bordetella avium 197N]
 gi|123513533|sp|Q2KTI5|OXAA_BORA1 RecName: Full=Inner membrane protein oxaA
 gi|115424472|emb|CAJ51026.1| inner-membrane protein insertion factor [Bordetella avium 197N]
          Length = 559

 Score =  211 bits (537), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 115/326 (35%), Positives = 185/326 (56%), Gaps = 28/326 (8%)

Query: 234 YSDIEKSSISNFHES-NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSAN 292
           +SDI K+  S   ++ N W+GI   Y+A+ ++P + T   +    L       +A  +  
Sbjct: 251 FSDIAKNKASYIKQADNGWIGIVQHYFATAWVPKEGTPRTNDLLQLQPNLFAARAIEALG 310

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
           E+   PG ++++   L+ G ++             P  E+++D+GW   IAKP+F LM++
Sbjct: 311 EVA--PGATVSSDAQLWVGPQD-----QQAMAAVAPGLELVVDYGWLTIIAKPLFTLMTW 363

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
            ++L+GN+G  I+  TV +K +F+PLA   Y S A MK + P++  L+EK+     Q L 
Sbjct: 364 LHSLLGNWGWTIVALTVIIKAVFYPLASASYRSMARMKQVAPRLQALKEKYGDD-RQKLN 422

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           +AM+++Y+T  INPL GC P+++QIPVF A+Y V+  S+EMR AP+  WI DL+  DP  
Sbjct: 423 QAMMEMYRTEKINPLGGCLPMVVQIPVFIALYWVLLASVEMRGAPWILWIHDLSVRDPYF 482

Query: 473 IFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALS 532
           I                    P +M  +MF+Q+K++P P D  QA ++  MP+VF   + 
Sbjct: 483 IL-------------------PAVMMATMFLQIKLNPTPPDPVQAKVMMVMPLVFGGMMF 523

Query: 533 SFPAGLIIYWSWSNVISIVQQAVIMK 558
            FPAGL++YW  +N +SI+QQ  I +
Sbjct: 524 FFPAGLVLYWCVNNTLSILQQWSITR 549


>gi|94501616|ref|ZP_01308133.1| putative inner membrane protein translocase component YidC
           [Oceanobacter sp. RED65]
 gi|94426299|gb|EAT11290.1| putative inner membrane protein translocase component YidC
           [Oceanobacter sp. RED65]
          Length = 538

 Score =  211 bits (537), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 149/482 (30%), Positives = 238/482 (49%), Gaps = 48/482 (9%)

Query: 94  LRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPN------SNTVWNLISG 147
           L+ Y L V        LL  SN +  Y A+   V   N I+           T +NL  G
Sbjct: 88  LKQYPLSVDQQDVPFVLLEQSNIRT-YIAQSGLVGK-NGIDKKGRAQYSVEKTEYNLADG 145

Query: 148 KILTPTTPIKLVFKNA-NNILFERTISLDE-HYLFKIVDTVTNNSID--QIRFSPRGRIM 203
           +       I++V     NN+  E+  +++   YL  +   + N S +  Q  F  + +  
Sbjct: 146 Q-----DQIQVVLATTQNNVKIEKVFTINRGEYLIDVGFRIDNQSQEPWQANFYAQFKRD 200

Query: 204 RHKPQTATNTFGVQE--GFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWAS 261
           R    ++  + G+    G       +   +  + DIE+       E   W+     Y+  
Sbjct: 201 RSVDPSSMESMGMASFLGAAVTRPSERYFKMDFDDIEEDPFKEKIEG-GWIAFLQHYFLG 259

Query: 262 VFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHY 321
            ++PSK+ + H      + GH  Y   +  + + + PG    T+  L+ G K+   +   
Sbjct: 260 AWVPSKDEA-HVYNTRKASGH--YLVGYYDSALQVEPGTQGGTSTQLYLGPKDQDRLAEI 316

Query: 322 EKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKK 381
            + L     ++ ID+GW +++A+P+F L+   +++ GN+G AI++ T+ VKL FFPL+  
Sbjct: 317 AEHL-----DLTIDYGWLWWVAQPLFWLLQLMHDIAGNWGWAIIMLTILVKLAFFPLSAA 371

Query: 382 QYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFF 441
            Y S ANM+ + PK+  ++E++  +  Q L K M+ LYK   INPL GC PIL+Q+PVF 
Sbjct: 372 SYRSMANMRRVAPKLTAIKEQYADNREQ-LSKEMMNLYKKEKINPLGGCLPILVQMPVFI 430

Query: 442 AIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSM 501
           A+Y V+  S+E+R APF  WI+DL+  DP  I                    P+IM  SM
Sbjct: 431 ALYWVLMESVELRQAPFMLWIEDLSLKDPYFIL-------------------PLIMGASM 471

Query: 502 FIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHG 561
           F+QM+++P P D  QA ++  MPVVF      FPAGL++YW  +N++SI QQ  I +   
Sbjct: 472 FVQMQLNPTPPDPMQAKVMKLMPVVFTVFFLFFPAGLVLYWVVNNLLSIAQQYYITRKIE 531

Query: 562 AE 563
           AE
Sbjct: 532 AE 533


>gi|94263631|ref|ZP_01287440.1| 60 kDa inner membrane insertion protein [delta proteobacterium
           MLMS-1]
 gi|93455936|gb|EAT06091.1| 60 kDa inner membrane insertion protein [delta proteobacterium
           MLMS-1]
          Length = 559

 Score =  211 bits (536), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 169/575 (29%), Positives = 290/575 (50%), Gaps = 41/575 (7%)

Query: 4   NWNYFVAIALSVIIVYAWQNFYVYPRIEEMN-------NERKNIQTVK----QPNQVDNS 52
           N+   +AI LS+ I+  +Q F++ P  E           ER    T      +P   D +
Sbjct: 3   NYRALLAIVLSMAILLVYQFFFMPPPPESTAPEPEAPVAERATAPTAAPERPRPGTTDPT 62

Query: 53  YAAVLID-DRAQALSMSPRVELKNPSLIGS-INLKGAQFDDLNLRGYHLDVSSNSPIVTL 110
            A   +D     A  +  R  +    L  + I+  G       L+ +   V  +SP   L
Sbjct: 63  GAPAPVDVSSLLAQEVEGREIVVETDLYEAVISEAGGALRSFRLKEFRETVDPDSPAKEL 122

Query: 111 LSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNIL--- 167
           +  ++  N       +    +  +L +  +      G+++ P    + +   A + L   
Sbjct: 123 VR-TDHDNGLPLRFSWGVEPHQADLLHYQSERQ---GRLVVPAGREQTLTLRAQSPLGLE 178

Query: 168 FERTISL-DEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFG--VQEGFIAVL 224
           F RT +  D  +L ++ + V N     ++ +P   +     +   +     + +G +A++
Sbjct: 179 FIRTYTFRDSDHLLELREEVRNTGEVPLQGAPYLALTSRPFEAEDDPLKRFLFDGPVALV 238

Query: 225 GDKSLVEQKYSD-IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
            D  + E +  D +E+ S  +F    SW G  D Y+ +  IP ++    + F    +  A
Sbjct: 239 -DGEVHEVRPRDLVEERSGRSFTGEVSWAGYHDSYFLAAIIPREQGQATAHFSANREETA 297

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
                 SA E+ + PG++ +    ++ G K+   ++    DL        +++GWF F+A
Sbjct: 298 T-TVLASAAEV-LNPGEARSYEYMVYYGPKKLAELNAIGYDLG-----RSVNFGWFDFLA 350

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           +P F ++S+F+ +VGN+G+AI++ T+ +K+LF+PL  K   S   M+ IQP++ +LREKF
Sbjct: 351 RPAFYVLSFFHGMVGNYGLAIIMVTILIKILFWPLTHKGLKSMKVMQKIQPRMAKLREKF 410

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
           K    Q  Q+ M++LY+T+ +NPL GC P+LLQIPVFFA+YKV+  S+E+RHAPF  WI 
Sbjct: 411 KDDK-QRQQQEMLKLYQTYKVNPLGGCLPMLLQIPVFFALYKVLLQSVELRHAPFMLWIN 469

Query: 464 DLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWM 523
           DL+A D   I        F +P    + +  ++M+ SMFIQ KM+ P AD  QA I+ ++
Sbjct: 470 DLSAPDRLYIG-------FDIPWLGGIPVLTLLMAASMFIQQKMT-PIADPMQARIMLFL 521

Query: 524 PVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           P+VF F   +F +GL++YW  +NV++I QQ  I +
Sbjct: 522 PLVFFFLFLNFASGLVLYWFINNVLTIAQQYTIYR 556


>gi|145590263|ref|YP_001156860.1| 60 kDa inner membrane insertion protein [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|189036355|sp|A4T0N2|OXAA_POLSQ RecName: Full=Membrane protein oxaA
 gi|145048669|gb|ABP35296.1| protein translocase subunit yidC [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 557

 Score =  211 bits (536), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 152/506 (30%), Positives = 254/506 (50%), Gaps = 50/506 (9%)

Query: 73  LKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANN 132
           L+N  L   I+  GA   D  L     +++++   V +   + T + Y A    V+  N 
Sbjct: 84  LENELLSVEISAAGANVVDAKLLK---ELTADQKPVEIFQHTPT-HTYVARSGLVAVGNT 139

Query: 133 IELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD----EHYLFKIVDTVTN 188
            +LPN  +++ L          P  ++    N +  E+T  L+    + Y+   V  VT 
Sbjct: 140 -DLPNHTSLFKLDRSGKDGSGRPFLVLSSERNGVKLEKTFLLNPGSYDIYVGHRVTQVTP 198

Query: 189 NSIDQIRFSPRGRIMRH-KPQTATNTFG---VQEGFI--AVLGDKSLVEQ-KYSDIEKSS 241
           N    I ++    I+R    +     FG       F   A+  D    ++  ++DIEK+ 
Sbjct: 199 NGAPLILYT---EIVRDGSEEKKIGPFGGAFSASTFTGPAIYTDGGKYKKVSFADIEKNK 255

Query: 242 ISNFHE----SNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITIL 297
            +   +       W+ +   Y+AS +IP  +         + +    Y+        TI 
Sbjct: 256 FTAPSQIAAGQPGWVAMVQHYFASAWIPDDKLPRDIYSGKIDND--LYRVGMQTQLGTIA 313

Query: 298 PGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLV 357
            G ++     LF G +E   +     +   P  E+L D+G+   +AKP+F L+ + +N+V
Sbjct: 314 TGTTVMANAQLFVGPQEERML-----ETIAPGLELLKDYGYLTILAKPIFWLLEHIHNIV 368

Query: 358 GNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQ 417
           GN+G +I+L TV +KL FFPL+   Y S A MK +QP++  ++E++K   PQ L +AM++
Sbjct: 369 GNWGWSIILLTVLIKLAFFPLSAASYKSMARMKEVQPRLAAMKEQYKGE-PQKLNQAMME 427

Query: 418 LYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLF 477
           +Y+   INPL GC P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  D        
Sbjct: 428 MYRKEKINPLGGCLPVVIQIPVFISLYWVLLSSVEMRGAPWILWIHDLSVPD-------- 479

Query: 478 GILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAG 537
              P+Y        I P++M++SMF+Q K++P P D  QA ++ +MP+VF      FPAG
Sbjct: 480 ---PYY--------ILPVVMAVSMFVQTKLNPTPPDPVQAKVMMYMPIVFSIMFFFFPAG 528

Query: 538 LIIYWSWSNVISIVQQAVIMKMHGAE 563
           L++YW  +N++SI QQ  I ++ G +
Sbjct: 529 LVLYWVTNNLLSIAQQWQINRLFGKK 554


>gi|37528712|ref|NP_932057.1| putative inner membrane protein translocase component YidC
           [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|36788151|emb|CAE17278.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 546

 Score =  211 bits (536), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 156/574 (27%), Positives = 278/574 (48%), Gaps = 64/574 (11%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
           +RN      + +S ++  AW+         + N +   +Q  +Q +   +   AV    +
Sbjct: 4   QRNLLLIALLFVSFLVWQAWE--------ADKNPQPTTVQATQQTDMPSSENQAVPGSGK 55

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTL-LSPSNTKNAY 120
            + ++      +K   L  +IN +G   ++ +L  Y   + SN P   L  +P+ T  A 
Sbjct: 56  GKLIT------VKTDVLSLTINTRGGDIEEADLLAYPDTLGSNQPFKLLETTPAFTYQAQ 109

Query: 121 --FAELDYVSTANNIELP---NSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD 175
                 D      N E P    +   + L  G+       I + F   N I++ +T  L 
Sbjct: 110 SGLTGKDGPDNPMNSERPLYTAAQDSYVLADGQ---DELRIPMNFVTKNGIVYVKTFVLK 166

Query: 176 EHYLFKIVDTVTNNSIDQ-IRFSPRGRIM------RHKPQTATNTFGVQ--EGFIAVLGD 226
                  VD   +N+ ++ ++ +  G++       +H+  T ++ F +    G      D
Sbjct: 167 RGEYAISVDYRIHNTTEKPLQMTFFGQLKQSVELPKHR-DTGSSNFALHTYRGAAYSSDD 225

Query: 227 KSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIP-SKETSFHSQFKYLSDGHARY 285
               +  +SDIE  S+S       W+ +  +Y+A+ ++P + ETS    F  ++ G    
Sbjct: 226 TKYKKYSFSDIEGESLS-VTTKGGWIAMLQQYFATAWVPVANETS---TFYTVALGKEMA 281

Query: 286 QAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKP 345
              + +  I++      T ++ L+ G    P I   E     P  ++ +D+GW +FI++P
Sbjct: 282 AIGYKSAPISVAANSEKTVSSTLWIG----PEIQD-EMAAVAPHLDLSVDYGWLWFISQP 336

Query: 346 MFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQ 405
           +F L+ + +  +GN+G +I++ T  V+ + +PL K QY S A M+ +QPK+  +RE+   
Sbjct: 337 LFKLLKFLHGFIGNWGFSIIVITFIVRGIMYPLTKAQYTSMAKMRLLQPKLAAMRERIGD 396

Query: 406 SPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDL 465
              Q + + M+ LYK   +NPL GC P+L+Q+P+F A+Y ++  S+E+RHAPF GWI DL
Sbjct: 397 DK-QRMSQEMMALYKAEKVNPLGGCLPLLIQMPIFLALYYMLMGSVELRHAPFAGWIHDL 455

Query: 466 AAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMP 524
           +A D           P+Y        I P++M ++MFI  KMSP    D  Q  I+ +MP
Sbjct: 456 SAQD-----------PYY--------ILPLLMGVTMFIIQKMSPTTITDPMQQKIMTYMP 496

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           V+F      FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 497 VIFTIFFLWFPSGLVLYYIVSNLVTIIQQQLIYR 530


>gi|255320707|ref|ZP_05361884.1| inner membrane protein [Acinetobacter radioresistens SK82]
 gi|262380663|ref|ZP_06073816.1| membrane protein insertase, YidC/Oxa1 family protein [Acinetobacter
           radioresistens SH164]
 gi|255302323|gb|EET81563.1| inner membrane protein [Acinetobacter radioresistens SK82]
 gi|262297611|gb|EEY85527.1| membrane protein insertase, YidC/Oxa1 family protein [Acinetobacter
           radioresistens SH164]
          Length = 584

 Score =  211 bits (536), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 166/603 (27%), Positives = 283/603 (46%), Gaps = 90/603 (14%)

Query: 3   RNWNYFVAIALSVIIVY----AWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           + W  F  +    ++ Y    AWQ  Y +    E   +++ + + +    + NS AA   
Sbjct: 2   QQWARFAILGAMFVVAYLLILAWQKDYGH---AETAPQQQAVVSHEVSADLPNSQAASAS 58

Query: 59  DDRAQALSMSPRV----ELKNPSLIGS--------INLKGAQFDDLNLRGYHLDVSSNSP 106
            D  QA   +P+        N  LI          IN KG     + L  +  +  S+ P
Sbjct: 59  SDVPQANIATPQATDVTAPVNQQLISVQTDLYHLLINPKGGDIVRIELLNHDKNKDSDQP 118

Query: 107 IVTLLSPSNTKNAYFAELDYVSTANNIELPNSN-----------TVWNLI---------S 146
            V L   S+ K  Y A+   +     +  P+SN           T ++L+         +
Sbjct: 119 FVML--ESDAKRTYVAQSGLIG----LNGPDSNRSGRPVYEVEKTSYDLLKDAQTVSKDN 172

Query: 147 GKILTPTTPIKLVFKNANNILFERTISLDE-HYLFKIVDTVTNNSIDQIRFSPRGRIMRH 205
           GK +   T I +V+K A+ +   +T +  +  Y   +   V N S    +    G+I R 
Sbjct: 173 GKAVKVLT-IPMVYKTADGVEIIKTFTFKQGEYPIVVNHKVVNRSQQNWQGQMFGQIKRD 231

Query: 206 ------KPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYW 259
                 K      T G   G      ++   + K+ +     + N      W+ +   Y+
Sbjct: 232 NSEDPGKSDQGIFTLGTFLGGAWGTPEEHYNKLKFDNFNDEKL-NVDAKGGWIAVVQHYF 290

Query: 260 ASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITIL---------PGKSITTTNFLFA 310
            S +IP +     +  +  +   A+ +++ SA+++ I+         P  ++   +  F 
Sbjct: 291 VSAWIPGQLKLTQANGQPYA---AKLESRKSADDMNIISFTSPTINVPAGTVAEVDATFY 347

Query: 311 GAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVF 370
                P I    KDLA+      +D+GW + IAK +F+ + +F+N+VGN+G +I+L T+ 
Sbjct: 348 SG---PKIQSELKDLAV-GLNQTVDYGWLWPIAKLLFLGLQFFHNIVGNWGWSIILLTIL 403

Query: 371 VKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGC 430
           VKL+ +PL+ K Y S A M+ I P++  ++E+F +   +  Q+ M+ LYK   +NPL+GC
Sbjct: 404 VKLILWPLSSKSYRSMAKMRVIAPEMQRMKEEFGEDRMRFSQE-MMALYKREQVNPLSGC 462

Query: 431 WPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHV 490
            P+LLQ+P+F A+Y V+  S+E+RHAP++GWI+DL+A DP  I                 
Sbjct: 463 LPLLLQMPIFLALYWVLMESVELRHAPWFGWIQDLSAMDPWFIL---------------- 506

Query: 491 GIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISI 550
              P++M L+MF Q  ++P PAD  QA +   MP++F   +  FPAGL++YW  +N I+I
Sbjct: 507 ---PLVMGLTMFTQQSLNPQPADPMQAKVFKIMPIIFTIFMLFFPAGLVLYWIVNNSITI 563

Query: 551 VQQ 553
           +QQ
Sbjct: 564 LQQ 566


>gi|270264115|ref|ZP_06192382.1| putative inner membrane protein translocase component YidC
           [Serratia odorifera 4Rx13]
 gi|270041764|gb|EFA14861.1| putative inner membrane protein translocase component YidC
           [Serratia odorifera 4Rx13]
          Length = 545

 Score =  211 bits (536), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 155/573 (27%), Positives = 263/573 (45%), Gaps = 62/573 (10%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQ-VDNSYAAVLIDD 60
           +RN      + +S +I  AWQ       + +   +  N  T    +Q V  S    LI  
Sbjct: 4   QRNLFLIALLFVSFMIWQAWQTDNAPQPVAQTTQQTSNTATGDAASQAVPASGQGKLITV 63

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
               LS++             IN +G   +   L  Y   + S++P   L    NT +  
Sbjct: 64  NTDVLSLT-------------INTRGGDIEQAKLLAYPDTLGSSTPFQLL---ENTPSFV 107

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTP-------IKLVFKNANNILFERTIS 173
           +     ++  N  + P +N    L        T P       I L F   +  ++ +T  
Sbjct: 108 YQAQSGLTGRNGPDNP-ANGERPLFQAAQDNYTLPEGQDELRIPLTFTGKDGAVYTKTFV 166

Query: 174 LDE-HYLFKIVDTVTNNSIDQIRFSPRGRIM------RHKPQTATNTFGVQEGFIAVLGD 226
           L   HY   +   V N S   +  +  G++       +H+  T +N F +     A    
Sbjct: 167 LKRNHYAVGVDYNVDNKSTAPLELTLFGQLKQTTELPKHR-DTGSNNFALHTFRGAAYSS 225

Query: 227 KSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQ 286
                QKY+  +K    N      W+ +  +Y+A+ ++P+ + S  + F     G     
Sbjct: 226 SEDKYQKYA-FDKDENLNVTTQGGWVAMLQQYFATAWVPATQGS--NTFYTAKPGDNLST 282

Query: 287 AKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPM 346
             F +  + + PG        L+ G    P +      LA P  ++ +D+GW +FI++P+
Sbjct: 283 IGFKSTPVVVQPGAQQQLNATLWVG----PELQDQMAQLA-PHLDLTVDYGWLWFISQPL 337

Query: 347 FMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQS 406
           F L+ + +  +GN+G +I++ T  V+ + +PL K QY S A M+ +QPK+  +RE+    
Sbjct: 338 FKLLKFIHGFIGNWGFSIIIITFIVRGIMYPLTKAQYTSMAKMRMLQPKLQAMRERIGDD 397

Query: 407 PPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLA 466
             Q + + M+ LYK+  +NPL GC P+++Q+P+F A+Y ++  S+E+RHAPF  WI DL+
Sbjct: 398 -KQRMSQEMMALYKSEKVNPLGGCLPLVIQMPIFLALYYMLMGSVELRHAPFALWIHDLS 456

Query: 467 AADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPV 525
           A D           P+Y        I PI+M ++MF   KMSP    D  Q  I+ +MPV
Sbjct: 457 AQD-----------PYY--------ILPILMGVTMFFIQKMSPTTVTDPMQQKIMTFMPV 497

Query: 526 VFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           +F      FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 498 IFTVFFLWFPSGLVLYYIVSNLVTILQQQLIYR 530


>gi|259910298|ref|YP_002650654.1| putative inner membrane protein translocase component YidC [Erwinia
           pyrifoliae Ep1/96]
 gi|224965920|emb|CAX57453.1| Inner membrane protein OxaA [Erwinia pyrifoliae Ep1/96]
 gi|283480422|emb|CAY76338.1| Inner membrane protein yidC [Erwinia pyrifoliae DSM 12163]
 gi|310765879|gb|ADP10829.1| putative inner membrane protein translocase component YidC [Erwinia
           sp. Ejp617]
          Length = 548

 Score =  211 bits (536), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 165/587 (28%), Positives = 265/587 (45%), Gaps = 87/587 (14%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
           +RN      + +S +I  AWQ           +N  + +QT  Q  Q   S A    +  
Sbjct: 4   QRNLFLIAFLFVSFMIWQAWQT----------DNAPQPLQT--QTTQNTASAAGDAANQG 51

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLS--------- 112
             A      + +K   L  +IN +G   D   L  Y   + S+ P + L S         
Sbjct: 52  VPASGQGKTITVKTDVLSLNINTRGGDIDQAQLLTYPDKLGSDQPFLLLESTPGFLYQAQ 111

Query: 113 --------PSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
                   P N  N   A   Y S+ ++ EL +  +               I L F   N
Sbjct: 112 SGLTGRNGPDNPANG--ARPLYTSSQDHFELADGQSELR------------IPLTFTAEN 157

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQ-IRFSPRGRIM------RHKPQTATNTFGVQ 217
              + +T  L        VD   NN+  Q +  S  G++       +H+  T ++ F + 
Sbjct: 158 GATYTKTFVLKRGEYAIGVDYQINNTTQQPLEVSMFGQLKQTIDLPKHR-DTGSSNFALH 216

Query: 218 EGFIAVLGDKSLVEQKY-----SDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFH 272
               A         +KY     SD E  S +    SN W+ +  +Y+A+ ++P    S  
Sbjct: 217 TFRGAAYSSSETNYEKYKFDTISDNENLSTTT---SNGWVAMLQQYFATAWVPQTAGSNT 273

Query: 273 SQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEM 332
                L +G A     + +  +TI  G        L+ G    P I      +A P  ++
Sbjct: 274 LYTSNLGNGIAAI--GYKSAPVTIAAGSQQQLAATLWVG----PEIQDRMAAVA-PHLDL 326

Query: 333 LIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNI 392
            +D+GW +FI++P+F L+ + +  +GN+G +I++ T  V+ + +PL K QY S A M+ +
Sbjct: 327 TVDYGWLWFISQPLFKLLKFLHGFIGNWGFSIIVITFIVRGIMYPLTKAQYTSMAKMRML 386

Query: 393 QPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLE 452
           QPKI  +RE+      Q + + M+ LYK   +NPL GC P+++Q+P+F A+Y ++  S+E
Sbjct: 387 QPKIQAMRERLGDD-KQRMSQEMMALYKAEKVNPLGGCLPLVIQMPIFLALYYMLMGSVE 445

Query: 453 MRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP- 511
           +RHAPF  WI DLAA D           P+Y        I PI+M ++MF   KMSP   
Sbjct: 446 LRHAPFALWIHDLAAQD-----------PYY--------ILPILMGVTMFFIQKMSPTTV 486

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
            D  Q  I+ +MPV+F      FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 487 TDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTILQQQLIYR 533


>gi|70733513|ref|YP_263288.1| putative inner membrane protein translocase component YidC
           [Pseudomonas fluorescens Pf-5]
 gi|123651831|sp|Q4K395|OXAA_PSEF5 RecName: Full=Inner membrane protein oxaA
 gi|68347812|gb|AAY95418.1| inner membrane protein, 60 kDa [Pseudomonas fluorescens Pf-5]
          Length = 566

 Score =  211 bits (536), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 119/323 (36%), Positives = 184/323 (56%), Gaps = 28/323 (8%)

Query: 236 DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
           D  K+ I+  +    W+     Y+ + +IP K    ++Q     D    Y   ++   +T
Sbjct: 261 DKSKAPITE-NVQGGWVAWLQHYFVTAWIPPKGE--NNQVLARKDSKGNYIIGYTGPSMT 317

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           + PG    T+  L+AG K    +    K+L+ P  E+ +D+G+ +FIA+P+F L+ + ++
Sbjct: 318 VAPGAKAETSAILYAGPKSQAVL----KELS-PGLELTVDYGFLWFIAQPIFWLLQHIHS 372

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
           LVGN+G +I+  T+ +K +FFPL+   Y S A M+ + PK+  L+EKF     Q + +AM
Sbjct: 373 LVGNWGWSIIFLTMLIKGIFFPLSAASYKSMARMRAVAPKLAALKEKFGDD-RQKMSQAM 431

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           ++LYK   INPL GC PIL+Q+PVF ++Y V+  S+EMR APF  WI DL+  D      
Sbjct: 432 MELYKKEKINPLGGCLPILVQMPVFLSLYWVLLESVEMRQAPFMLWITDLSIKD------ 485

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFP 535
                PF+        I PIIM  +MFIQ +++P P D  QA ++  MP++F F    FP
Sbjct: 486 -----PFF--------ILPIIMGATMFIQQQLNPTPPDPMQAKVMKMMPIIFTFFFLWFP 532

Query: 536 AGLIIYWSWSNVISIVQQAVIMK 558
           AGL++YW  +N +SI QQ  I +
Sbjct: 533 AGLVLYWVVNNCLSIAQQWYITR 555


>gi|170694073|ref|ZP_02885229.1| 60 kDa inner membrane insertion protein [Burkholderia graminis
           C4D1M]
 gi|170141145|gb|EDT09317.1| 60 kDa inner membrane insertion protein [Burkholderia graminis
           C4D1M]
          Length = 552

 Score =  211 bits (536), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 118/329 (35%), Positives = 184/329 (55%), Gaps = 28/329 (8%)

Query: 234 YSDIEKSSISNFHES-NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSAN 292
           + DI+K+      ++ N W+ +   Y+AS +IP +        + +    A Y+      
Sbjct: 244 FGDIDKNKEDYAKQADNGWIAMVQHYFASAWIPQQGVKRDIYVEKIDP--ALYRVGVKQP 301

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
              I PG+++  +  LFAG +E   +         P  E++ D+GW   IAKP+F L+  
Sbjct: 302 VAAIAPGQTVDVSARLFAGPEEERMLEGIA-----PGLELVKDYGWVTIIAKPLFWLLEK 356

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
            ++ VGN+G AI+L T+ +K +FFPL+   Y S A MK I P++  LRE+FK   PQ + 
Sbjct: 357 IHSYVGNWGWAIVLLTLLIKAVFFPLSAASYKSMARMKAITPRMQALRERFKGD-PQKMN 415

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
            A+++LYKT  +NP  GC P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  DP  
Sbjct: 416 AALMELYKTEKVNPFGGCLPVVIQIPVFISLYWVLLSSVEMRGAPWVLWIHDLSQQDPYF 475

Query: 473 IFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALS 532
           I                    P++M++SMF+Q K++P P D  QA ++ +MP+ F     
Sbjct: 476 IL-------------------PVLMAVSMFLQTKLNPTPPDPVQAKMMMFMPIAFSVMFF 516

Query: 533 SFPAGLIIYWSWSNVISIVQQAVIMKMHG 561
            FPAGL++Y+  +NV+SI QQ  I +M G
Sbjct: 517 FFPAGLVLYYVVNNVLSIAQQYYITRMMG 545


>gi|52424536|ref|YP_087673.1| putative inner membrane protein translocase component YidC
           [Mannheimia succiniciproducens MBEL55E]
 gi|81691469|sp|Q65VC2|OXAA_MANSM RecName: Full=Inner membrane protein oxaA
 gi|52306588|gb|AAU37088.1| YidC protein [Mannheimia succiniciproducens MBEL55E]
          Length = 540

 Score =  211 bits (536), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 124/375 (33%), Positives = 200/375 (53%), Gaps = 31/375 (8%)

Query: 186 VTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS-DIEKSSISN 244
           + N + + I   P G+ ++H    ++ +  +               +KYS D  K    +
Sbjct: 183 IQNQTNEAIEVQPYGQ-LKHTLVQSSGSMAMPTYTGGAYSSADTNYKKYSFDEMKDKNLS 241

Query: 245 FHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITT 304
                 W+ +   Y+ S +IP+++        Y S  +      +    + +  G S T 
Sbjct: 242 IDTKAGWVAVLQHYFVSAWIPNQDADNQ---LYTSTANGLGFIGYRGPVVNVPAGGSETI 298

Query: 305 TNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAI 364
            + L+ G K        E        ++ +D+GW +FIAKP+F L++   ++V N+G+AI
Sbjct: 299 KSALWTGPK-----LQNEMGAVANHLDLTVDYGWAWFIAKPLFWLLNVIQSIVSNWGLAI 353

Query: 365 MLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNI 424
           +  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++LYK   +
Sbjct: 354 IGVTIVVKGILYPLTKAQYTSMAKMRMLQPKLQEMRERFGDD-RQRMSQEMMKLYKEEKV 412

Query: 425 NPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYL 484
           NPL GC P+L+Q+P+F A+Y     ++E+RHAPF+GWI+DL+A D           P+Y 
Sbjct: 413 NPLGGCLPLLIQMPIFIALYWTFMEAVELRHAPFFGWIQDLSAQD-----------PYY- 460

Query: 485 PGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPAGLIIYWS 543
                  I PI+M  SMF+  KMSP P AD  Q  I+N+MP++F+     FPAGL++YW 
Sbjct: 461 -------ILPILMGASMFLLQKMSPTPVADPMQQKIMNFMPLIFMVFFLWFPAGLVLYWL 513

Query: 544 WSNVISIVQQAVIMK 558
            SN+I+IVQQ +I +
Sbjct: 514 VSNIITIVQQQLIYR 528


>gi|187925954|ref|YP_001897596.1| inner membrane protein translocase component YidC [Burkholderia
           phytofirmans PsJN]
 gi|254772762|sp|B2T7U1|OXAA_BURPP RecName: Full=Inner membrane protein oxaA
 gi|187717148|gb|ACD18372.1| 60 kDa inner membrane insertion protein [Burkholderia phytofirmans
           PsJN]
          Length = 552

 Score =  211 bits (536), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 122/332 (36%), Positives = 190/332 (57%), Gaps = 34/332 (10%)

Query: 234 YSDIEKSSISNFHES--NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSA 291
           + DI+K+   ++  S  N W+ +   Y+AS +IP +        + +    A Y+     
Sbjct: 244 FGDIDKNK-QDYATSADNGWIAMVQHYFASAWIPQQGVKRDIYVEKIDP--ALYRVGVKE 300

Query: 292 NEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLA--IPRFEMLIDWGWFYFIAKPMFML 349
              TI PG+++  +  LFAG +E       E+ L    P  E++ D+GW   IAKP+F L
Sbjct: 301 PVPTIAPGQTVDVSARLFAGPEE-------ERMLEGIAPGLELVKDYGWVTIIAKPLFWL 353

Query: 350 MSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQ 409
           +   ++ VGN+G +I+L T+ +K +FFPL+   Y S A MK I P++  LRE+FK   PQ
Sbjct: 354 LEKIHSYVGNWGWSIVLLTLLIKAVFFPLSAASYKSMARMKAITPRMQALRERFKGD-PQ 412

Query: 410 VLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAAD 469
            +  A+++LYKT  +NP  GC P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  D
Sbjct: 413 KMNSALMELYKTEKVNPFGGCLPVVIQIPVFISLYWVLLSSVEMRGAPWILWIHDLSQQD 472

Query: 470 PTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVF 529
                      PF+        I P++M++SMF+Q K++P P D  QA ++ +MP+ F  
Sbjct: 473 -----------PFF--------ILPVLMAVSMFLQTKLNPTPPDPVQAKMMMFMPIAFSV 513

Query: 530 ALSSFPAGLIIYWSWSNVISIVQQAVIMKMHG 561
               FPAGL++Y+  +NV+SI QQ  I +M G
Sbjct: 514 MFFFFPAGLVLYYVVNNVLSIAQQYYITRMMG 545


>gi|300115605|ref|YP_003762180.1| membrane protein insertase [Nitrosococcus watsonii C-113]
 gi|299541542|gb|ADJ29859.1| membrane protein insertase, YidC/Oxa1 family domain containing
           protein [Nitrosococcus watsonii C-113]
          Length = 545

 Score =  211 bits (536), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 151/531 (28%), Positives = 258/531 (48%), Gaps = 69/531 (12%)

Query: 46  PNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNS 105
           P   D   A +L D +         +E+K   L   I +      ++ L  Y + +   +
Sbjct: 60  PEVADMDTAPILPDQKT--------IEVKTDLLAIKIGMASGDLYEVQLLNYPVSLKEPN 111

Query: 106 PIVTLLSPSN-----TKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVF 160
             VTLL   +     T++   A      T   ++     T + LI  + +     + L +
Sbjct: 112 KPVTLLHKRDPDLFVTQSGLRAASGPSITHEKVQFSAPKTHYELIEDEGILK---VPLTW 168

Query: 161 KNANNILFERTISLDEHYLFKI------VDTVTNNSIDQIRFSPRGRIMRHKPQTATNTF 214
           ++ N I   +T      YLF+       ++    N  DQ      GR      +T   + 
Sbjct: 169 EDENGIKVTKT------YLFRRDSYQIDLNIKIENGTDQAWM---GRAYAQFSRTPPESG 219

Query: 215 GV-QEGFIAVLGDKSLVEQKYSDIEKSSIS----NFHESNSWLGISDKYWASVFIPSKET 269
           G+    ++  +   +  EQ+Y  ++   ++    +      W+ +   Y+ + ++P ++ 
Sbjct: 220 GMFARSYVGAVFSTN--EQEYQKVDFGDLASKSFDRRSPGGWVAMIQHYFVAAWVPREQG 277

Query: 270 SFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAI-- 327
           + +   K++ +  +RY       + TI PG+S      LF G K        +  LA+  
Sbjct: 278 TNYYYGKHVQN--SRYIVGVMPPQQTIAPGESGQFNLALFTGPK-------IQDRLAVVA 328

Query: 328 PRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTA 387
           P+  + +D+G    +A+P+F LMS+F+NLVGN+G AI+L T  VKL+FF L++  Y S A
Sbjct: 329 PKLNLTVDYGKLTILAEPLFWLMSWFHNLVGNWGWAIVLLTFVVKLVFFKLSQTSYRSMA 388

Query: 388 NMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVI 447
            M+ +QP++  L+E++     +V Q AM++LY+   +NP+ GC PI++QIPVF A+Y ++
Sbjct: 389 RMRKLQPRLLALKERYGDDRQKVGQ-AMMELYRKEKVNPMGGCLPIVVQIPVFIALYWML 447

Query: 448 SISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKM 507
             S+E+R APF  WI+DL + DP  I                    P++M +SMF+Q K+
Sbjct: 448 LESVELRQAPFIFWIQDLTSKDPYYIL-------------------PLLMGVSMFVQQKL 488

Query: 508 SPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           SP P D  QA ++  MPV+F      FPAGL++YW  +N++SI QQ  I +
Sbjct: 489 SPAPTDPIQAKVMALMPVMFTVFFVMFPAGLVLYWVVNNILSIAQQWYITR 539


>gi|319796643|ref|YP_004158283.1| membrane protein insertase, yidc/oxa1 family domain containing
           [Variovorax paradoxus EPS]
 gi|315599106|gb|ADU40172.1| membrane protein insertase, YidC/Oxa1 family domain containing
           [Variovorax paradoxus EPS]
          Length = 563

 Score =  211 bits (536), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 155/508 (30%), Positives = 240/508 (47%), Gaps = 67/508 (13%)

Query: 80  GSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIE-LPNS 138
            +I+ +G   + L L+ Y  D +  +  V L    +    Y A+   ++T +  +  PN 
Sbjct: 93  ATIDSEGGTVNHLELQKY--DEADRTKRVVLFENGSPATRYVAQTGLLNTVDTGDRFPNH 150

Query: 139 NTVWNLISGKILTPTTPIK-----LVFKNANNILFERT----ISLDEHYLFKIVDTV--T 187
                      LTP TP          +N   + FE      +   + Y+F   D     
Sbjct: 151 -----------LTPMTPKAGPREMAAGQNTLEVSFESAPVGGLKYTKTYVFHRGDYAIGV 199

Query: 188 NNSIDQIRFSPRG-----RIMRHKPQTATNTFGVQE--GFIAVLGDKSLVEQKYSDIEKS 240
            + +  +   PR      +++RH    A   FG     G  A   +K   +  + DI K 
Sbjct: 200 RHEVANVSDQPRDAQLYMQLLRHGTVAAGTMFGTNTFTGPAAYTNEKKFHKLDFKDIAKG 259

Query: 241 SISNFHESN-SWLGISDKYWASVFI----PSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
            I     +N  W+ +   Y+AS ++    P+ E     +F+    G   +     A    
Sbjct: 260 KIEPPPPANDGWIAMVQHYFASAWLLKGDPASE-QLRREFRVKDLGDNLFTVAMVATLPK 318

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAI--PRFEMLIDWGWFYFIAKPMFMLMSYF 353
           I PG + T ++ LFAG +E       EK L    P  +++ D+G F  I+KP++ L+   
Sbjct: 319 IAPGTTQTVSSVLFAGPQE-------EKKLEALAPGLDLVKDYGIFAIISKPLYWLLIQL 371

Query: 354 YNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQK 413
           +  +GN+G AI+   V +K  F+ L  K Y S A MK I PKI E+RE+ K  P Q +Q+
Sbjct: 372 HGFLGNWGWAIVALVVLLKAAFYWLNAKAYASMAKMKAINPKIMEMRERLKDKP-QEMQQ 430

Query: 414 AMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNI 473
            M+++YKT  +NP+ GC+PI++QIPVF A+Y V+  S+EMRHAP+ GWI DL+A DP  I
Sbjct: 431 EMMRIYKTEKVNPMGGCFPIVIQIPVFIALYWVLLSSVEMRHAPWIGWITDLSAPDPWYI 490

Query: 474 FTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSS 533
                               P++M+ +   Q  ++P P D  QA ++  MP+ F      
Sbjct: 491 L-------------------PVVMTATSLFQTWLNPTPPDPMQAKLMWIMPLAFSVMFIF 531

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMKMHG 561
           FPAGL++YW  +NV+SI QQ  I K  G
Sbjct: 532 FPAGLVLYWITNNVLSIAQQWFINKRLG 559


>gi|167717468|ref|ZP_02400704.1| putative inner membrane protein translocase component YidC
           [Burkholderia pseudomallei DM98]
          Length = 454

 Score =  211 bits (536), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 138/441 (31%), Positives = 215/441 (48%), Gaps = 44/441 (9%)

Query: 134 ELPNSNTVWNLISGKI----------LTPTTPIKLVFKNANNILFERTISLDEHYLFKIV 183
           + PN N V+  ++G            L+  +P+K   K      F R       Y+  + 
Sbjct: 38  DFPNHNDVYAQVAGPTSLAADQNTLKLSFESPVKGGVKVVKTYTFTRG-----SYVIGVD 92

Query: 184 DTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ-KYSDIEKSSI 242
             + N     +  S    ++R      T  F       AV  D+   ++  + DI+K+  
Sbjct: 93  TKIENVGAAPVTPSVYMELVRDNSSVETPMFSHTFLGPAVYTDQKHFQKITFGDIDKNKA 152

Query: 243 SNFHES-NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKS 301
                + N W+ +   Y+AS +IP          + +      Y+         I PG+S
Sbjct: 153 DYVTSADNGWIAMVQHYFASAWIPQSGAKRDIYVEKIDP--TLYRVGVKQPVAAIAPGQS 210

Query: 302 ITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFG 361
              +  LFAG +E   +         P  E++ D+GW   IAKP+F L+   +  VGN+G
Sbjct: 211 ADVSARLFAGPEEERMLEGIA-----PGLELVKDYGWVTIIAKPLFWLLEKIHGFVGNWG 265

Query: 362 IAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKT 421
            AI+L T+ +K +FFPL+   Y S A MK I P++  LRE+FK S PQ +  A+++LYKT
Sbjct: 266 WAIVLLTLLIKAVFFPLSAASYKSMARMKEITPRMQALRERFK-SDPQKMNAALMELYKT 324

Query: 422 HNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILP 481
             +NP  GC P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  DP  I        
Sbjct: 325 EKVNPFGGCLPVVIQIPVFISLYWVLLASVEMRGAPWVLWIHDLSQRDPYFIL------- 377

Query: 482 FYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIY 541
                       P++M++SMF+Q K++P P D  QA ++ +MP+ F      FPAGL++Y
Sbjct: 378 ------------PVLMAVSMFVQTKLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVLY 425

Query: 542 WSWSNVISIVQQAVIMKMHGA 562
           +  +NV+SI QQ  I +  G 
Sbjct: 426 YVVNNVLSIAQQYYITRTLGG 446


>gi|91785811|ref|YP_561017.1| putative inner membrane protein translocase component YidC
           [Burkholderia xenovorans LB400]
 gi|123167872|sp|Q13SH4|OXAA_BURXL RecName: Full=Inner membrane protein oxaA
 gi|91689765|gb|ABE32965.1| protein translocase subunit yidC [Burkholderia xenovorans LB400]
          Length = 552

 Score =  211 bits (536), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 122/332 (36%), Positives = 190/332 (57%), Gaps = 34/332 (10%)

Query: 234 YSDIEKSSISNFHES--NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSA 291
           + DI+K+   ++  S  N W+ +   Y+AS +IP +        + +    A Y+     
Sbjct: 244 FGDIDKNK-QDYATSADNGWIAMVQHYFASAWIPQQGAKRDIYVEKIDP--ALYRVGVKE 300

Query: 292 NEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLA--IPRFEMLIDWGWFYFIAKPMFML 349
              TI PG+++  +  LFAG +E       E+ L    P  E++ D+GW   IAKP+F L
Sbjct: 301 PVPTIAPGQTVDVSARLFAGPEE-------ERMLEGIAPGLELVKDYGWVTIIAKPLFWL 353

Query: 350 MSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQ 409
           +   ++ VGN+G +I+L T+ +K +FFPL+   Y S A MK I P++  LRE+FK   PQ
Sbjct: 354 LEKIHSYVGNWGWSIVLLTLLIKAVFFPLSAASYKSMARMKAITPRMQALRERFKGD-PQ 412

Query: 410 VLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAAD 469
            +  A+++LYKT  +NP  GC P+++QIPVF ++Y V+  S+EMR AP+  WI DL+  D
Sbjct: 413 KMNSALMELYKTEKVNPFGGCLPVVIQIPVFISLYWVLLSSVEMRGAPWILWIHDLSQQD 472

Query: 470 PTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVF 529
                      PF+        I P++M++SMF+Q K++P P D  QA ++ +MP+ F  
Sbjct: 473 -----------PFF--------ILPVLMAVSMFLQTKLNPTPPDPVQAKMMMFMPIAFSV 513

Query: 530 ALSSFPAGLIIYWSWSNVISIVQQAVIMKMHG 561
               FPAGL++Y+  +NV+SI QQ  I +M G
Sbjct: 514 MFFFFPAGLVLYYVVNNVLSIAQQYYITRMMG 545


>gi|120556799|ref|YP_961150.1| putative inner membrane protein translocase component YidC
           [Marinobacter aquaeolei VT8]
 gi|166975875|sp|A1U7J4|OXAA_MARAV RecName: Full=Inner membrane protein oxaA
 gi|120326648|gb|ABM20963.1| protein translocase subunit yidC [Marinobacter aquaeolei VT8]
          Length = 567

 Score =  210 bits (535), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 128/368 (34%), Positives = 194/368 (52%), Gaps = 33/368 (8%)

Query: 200 GRIMRHKPQ--TATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHES--NSWLGIS 255
           G+I+R +    T+  + G++     V+       +KY D E  S    ++S  N WL   
Sbjct: 223 GKIVRDQAPDPTSQASMGIRAYLGMVISTPEDPYEKY-DFEDLSEKRVNQSVTNGWLAFL 281

Query: 256 DKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEF 315
             Y+ + +IP ++     Q     D H      F     T+ PG++       + G    
Sbjct: 282 QHYFLTAWIPERDQKAQFQTTRRGDLHV---MGFVYPATTVAPGETAEVGATAYVG---- 334

Query: 316 PTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLF 375
           P I    + LA P  +  +D+GW +FI+ P+F ++ +FY LVGN+G+AI+L TV VK +F
Sbjct: 335 PKIIDRLEALA-PNLDRTVDFGWLFFISLPLFYILEWFYGLVGNWGVAIILLTVLVKAVF 393

Query: 376 FPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILL 435
           F L+   Y S A M+ + P++  L+E +     Q + + M+ LYK   INPL GC PIL+
Sbjct: 394 FHLSATSYRSMAKMRAVAPQLTRLKELYGDD-RQRMSQEMMALYKREKINPLGGCLPILV 452

Query: 436 QIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPI 495
           Q+PVF ++Y V+  S+++RHAPF  WI+DL+  DP  I                    PI
Sbjct: 453 QMPVFISLYWVLFESVQLRHAPFMLWIQDLSQMDPYFIL-------------------PI 493

Query: 496 IMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAV 555
           +M  SMFIQM ++P P D  QA I+  MP++F      FPAGL++YW  +N++SI QQ  
Sbjct: 494 LMGASMFIQMSLNPTPPDPMQAKIMKLMPLIFTVFFLWFPAGLVLYWLVNNILSISQQWY 553

Query: 556 IMKMHGAE 563
           I +   AE
Sbjct: 554 ITRKIEAE 561


>gi|311696590|gb|ADP99463.1| inner membrane protein translocase component YidC [marine bacterium
           HP15]
          Length = 571

 Score =  210 bits (535), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 127/415 (30%), Positives = 220/415 (53%), Gaps = 34/415 (8%)

Query: 156 IKLVFKNANNILFERTISLDEH-YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQ--TATN 212
           + L + + N +   +    + + Y   +   V N S ++ + +  G+I+R +    T+  
Sbjct: 182 VDLTYTSDNGVQITKRYEFERNSYEISVKYLVENQSSEEWQANFTGKIVRDQSPDPTSQT 241

Query: 213 TFGVQE--GFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETS 270
           + G+Q   G +    +    +  + D++++ I N   +N WL     Y+ S ++P ++  
Sbjct: 242 SMGIQAFLGLVISSPEDPYEKFDFGDLQENQI-NQSVTNGWLAFLQHYFLSAWVPERD-- 298

Query: 271 FHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRF 330
             +Q++    G   Y   F     ++ PG++       + G    P I    + +A P  
Sbjct: 299 IPAQYQTTRRG-PNYVMGFVYPATSVAPGETAEIGARAYVG----PKIIERLEGMA-PNL 352

Query: 331 EMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMK 390
           +  +D+GW +FI+ P+F+++ +F++LVGN+G++I+L TV VK +FF L+   Y S A M+
Sbjct: 353 DRTVDFGWLFFISLPLFIILDWFHSLVGNWGVSIILLTVLVKAVFFHLSATSYKSMAKMR 412

Query: 391 NIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISIS 450
            + P++  L+E +     Q + + M+ LYK   INPL GC PIL+Q+PVF ++Y V+  S
Sbjct: 413 AVAPQLTRLKELYGDD-RQRMSQEMMALYKREKINPLGGCLPILVQMPVFISLYWVLFES 471

Query: 451 LEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPP 510
           +++RHAPF  WI+DL+  DP  I                    PI+M  SMF+QM ++P 
Sbjct: 472 VQLRHAPFMLWIQDLSVMDPYFIL-------------------PILMGASMFLQMSLNPT 512

Query: 511 PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIG 565
           P D  QA I+  MP++F      FPAGL++YW  +N++SI QQ  I +   AE+ 
Sbjct: 513 PPDPMQAKIMKMMPLIFTVFFLWFPAGLVLYWLVNNILSIAQQWYITRKIEAEMA 567


>gi|116053719|ref|YP_794046.1| putative inner membrane protein translocase component YidC
           [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218894670|ref|YP_002443540.1| putative inner membrane protein translocase component YidC
           [Pseudomonas aeruginosa LESB58]
 gi|296392435|ref|ZP_06881910.1| putative inner membrane protein translocase component YidC
           [Pseudomonas aeruginosa PAb1]
 gi|313111480|ref|ZP_07797281.1| putative inner membrane protein, 60 kDa [Pseudomonas aeruginosa
           39016]
 gi|122256261|sp|Q02DE0|OXAA_PSEAB RecName: Full=Inner membrane protein oxaA
 gi|254773013|sp|B7V7A5|OXAA_PSEA8 RecName: Full=Inner membrane protein oxaA
 gi|115588940|gb|ABJ14955.1| putative inner membrane protein, 60 kDa [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218774899|emb|CAW30718.1| putative inner membrane protein, 60 kDa [Pseudomonas aeruginosa
           LESB58]
 gi|310883783|gb|EFQ42377.1| putative inner membrane protein, 60 kDa [Pseudomonas aeruginosa
           39016]
          Length = 578

 Score =  210 bits (535), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 116/325 (35%), Positives = 183/325 (56%), Gaps = 32/325 (9%)

Query: 236 DIEKSSISNFHES--NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANE 293
           D++K     F ES    W+     Y+ + ++P+K      Q     DG   Y   F+   
Sbjct: 275 DMDKE---QFKESVQGGWVAWLQHYFVTAWVPTKGE--QHQVMTRKDGQGNYIVGFTGPT 329

Query: 294 ITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYF 353
           +++  G  + T   L+AG    P +  + K+L+ P  E+ +D+G+ +FIA+P+F L+ + 
Sbjct: 330 LSVPAGSKVETDLTLYAG----PKLQKHLKELS-PGLELTVDYGFLWFIAQPIFWLLQHI 384

Query: 354 YNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQK 413
           ++L+GN+G +I+  TV +KL FFPL+   Y S A M+ + PK+  ++E+      Q + +
Sbjct: 385 HSLIGNWGWSIIALTVLIKLAFFPLSAASYRSMARMRAVSPKMQAIKEQHGDDR-QKMSQ 443

Query: 414 AMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNI 473
           AM++LYK   INPL GC PIL+Q+PVF ++Y V+  S+EMR AP+ GWI DL+  D    
Sbjct: 444 AMMELYKKEKINPLGGCLPILVQMPVFLSLYWVLLESVEMRQAPWLGWITDL