BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780483|ref|YP_003064896.1| putative inner membrane
protein translocase component YidC [Candidatus Liberibacter asiaticus
str. psy62]
         (581 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780483|ref|YP_003064896.1| putative inner membrane protein translocase component YidC
           [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040160|gb|ACT56956.1| putative inner membrane protein translocase component YidC
           [Candidatus Liberibacter asiaticus str. psy62]
          Length = 581

 Score = 1192 bits (3085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/581 (100%), Positives = 581/581 (100%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD
Sbjct: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY
Sbjct: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF 180
           FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF
Sbjct: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF 180

Query: 181 KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS 240
           KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS
Sbjct: 181 KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS 240

Query: 241 SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGK 300
           SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGK
Sbjct: 241 SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGK 300

Query: 301 SITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF 360
           SITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF
Sbjct: 301 SITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF 360

Query: 361 GIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYK 420
           GIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYK
Sbjct: 361 GIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYK 420

Query: 421 THNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL 480
           THNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL
Sbjct: 421 THNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL 480

Query: 481 PFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLII 540
           PFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLII
Sbjct: 481 PFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLII 540

Query: 541 YWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ 581
           YWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ
Sbjct: 541 YWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ 581


>gi|315122061|ref|YP_004062550.1| putative inner membrane protein translocase component YidC
           [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495463|gb|ADR52062.1| putative inner membrane protein translocase component YidC
           [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 578

 Score =  923 bits (2385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/581 (76%), Positives = 501/581 (86%), Gaps = 3/581 (0%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           ME+NWNYF AIA+SV IVY WQ  YV PRIE +   +K   T+++   + N+   V ID+
Sbjct: 1   MEKNWNYFAAIAISVAIVYVWQLVYVQPRIEAIKEGKKTPLTIEK-QSIQNT--IVPIDN 57

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           RAQALS SPRVE+ +PSL GSINLKGAQFDDL+L+GY +DVS NSP+V LL+P NT+NAY
Sbjct: 58  RAQALSRSPRVEINSPSLAGSINLKGAQFDDLSLKGYRVDVSRNSPMVALLNPLNTENAY 117

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF 180
           FAEL+Y+ST N    PN NTVWNL+SG++LTP++PIKL FK+ANNILFER ISLDE+YLF
Sbjct: 118 FAELNYISTTNTTVFPNENTVWNLVSGQVLTPSSPIKLAFKSANNILFERIISLDENYLF 177

Query: 181 KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS 240
            IVDT+TNN  + I FSP G+I R+K Q  +N+FGVQEGFIAVLGD+SL+E+KYSDIEKS
Sbjct: 178 TIVDTITNNGTNLISFSPYGKITRYKLQKESNSFGVQEGFIAVLGDQSLIEKKYSDIEKS 237

Query: 241 SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGK 300
           S+SNFHESNSWLGISDKYWAS FIP KE SF S+F Y SDG ARYQA F  NEI + PGK
Sbjct: 238 SVSNFHESNSWLGISDKYWASAFIPPKEKSFQSRFDYFSDGRARYQANFKINEIILSPGK 297

Query: 301 SITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF 360
           S  TTN LF GAKE P I HYEK+L IPRFEMLIDWGWFYFIAKPMF LMSYFYNLVGNF
Sbjct: 298 STKTTNSLFVGAKELPIIQHYEKELEIPRFEMLIDWGWFYFIAKPMFALMSYFYNLVGNF 357

Query: 361 GIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYK 420
           GIAIMLTT+FVK LFFPLAKKQYVSTANMKNIQPKID LREKFKQ+ PQVLQK M+QLYK
Sbjct: 358 GIAIMLTTIFVKALFFPLAKKQYVSTANMKNIQPKIDALREKFKQASPQVLQKEMLQLYK 417

Query: 421 THNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL 480
           TH INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF+GWI+DLAA DPTNIFTLFGIL
Sbjct: 418 THKINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFFGWIQDLAAPDPTNIFTLFGIL 477

Query: 481 PFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLII 540
           PF LP F+HVGIWPIIMSLSMF+Q+KMSPPP DKGQA++LNWMPVVFVFALSSFPAGLII
Sbjct: 478 PFQLPEFIHVGIWPIIMSLSMFLQLKMSPPPTDKGQAIVLNWMPVVFVFALSSFPAGLII 537

Query: 541 YWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ 581
           YWSWSN+ISI+QQ VIMKM+GA+I +IDRLRS F+K+ NS+
Sbjct: 538 YWSWSNIISIIQQTVIMKMYGAKIDIIDRLRSMFAKSSNSK 578


>gi|86356094|ref|YP_467986.1| putative inner membrane protein translocase component YidC
           [Rhizobium etli CFN 42]
 gi|86280196|gb|ABC89259.1| putative inner membrane transmembrane protein [Rhizobium etli CFN
           42]
          Length = 597

 Score =  636 bits (1640), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 293/593 (49%), Positives = 391/593 (65%), Gaps = 17/593 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNI----------------QTVK 44
           ME N NYF+AIALSV+IV  WQ  Y+ PRIE     ++                  Q   
Sbjct: 1   MENNRNYFIAIALSVLIVLGWQFLYMNPRIEAQRKAQEAQKAQQQTEQTQQPAAGGQAPA 60

Query: 45  QPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
           Q +    S  A     R QAL  +PR+ +   +L GSINL GA+ DDL L+GYH  V  +
Sbjct: 61  QTSGAAPSGQAAATATREQALEKTPRIAIDTAALSGSINLAGARLDDLKLKGYHETVDDS 120

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           SP +TL SP+ TK+ YF EL Y+ +     +P  +T+W    G  LT  TP+ L + N  
Sbjct: 121 SPTITLFSPAETKDGYFTELGYIGSDTTGAVPGPSTLWTAPEGAKLTEKTPVTLSYTNDK 180

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVL 224
            + F RTIS+DE Y+F + D + N        S  GR+MR+   T  + + + EGFI V+
Sbjct: 181 GLTFTRTISVDERYMFTVADKIENTGQAPAALSSYGRVMRYNKPTTPSVYVLHEGFIGVI 240

Query: 225 GDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR 284
           GD  L+E KYS +EK ++S    +  WLGI+DKYWA+  +P + +++ ++F Y SDG  R
Sbjct: 241 GDDGLIESKYSAVEKEAVSPAKSAGGWLGITDKYWAATIVPPQSSAYEAKFSYFSDGQPR 300

Query: 285 YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAK 344
           YQA +  +  ++ PG+SI   N +FAGAKE P I  YE   +IP+F+ LIDWGWFYFI K
Sbjct: 301 YQADYKNDAFSVAPGQSIELKNLVFAGAKEVPVIDGYEASYSIPKFDRLIDWGWFYFITK 360

Query: 345 PMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK 404
           PMF LM +FY   GNFG+AI+ TT+ VK LFFPLA KQY S ANMK +QPK++EL+ KF 
Sbjct: 361 PMFKLMDFFYRFFGNFGVAILCTTIVVKALFFPLASKQYASMANMKRMQPKMEELKAKFG 420

Query: 405 QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKD 464
                 LQ+AM+QLYK   INP+AGCWP+ LQIP+FF++YKVI I++EMRHAPF+GWIKD
Sbjct: 421 DD-RMGLQQAMMQLYKDEKINPIAGCWPVALQIPIFFSLYKVIYITIEMRHAPFFGWIKD 479

Query: 465 LAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMP 524
           L+A DPT I  LFG+LPF  P F+H+G+WP+IM ++MF+QM+M+P P D  QAMI NWMP
Sbjct: 480 LSAPDPTTIVNLFGLLPFEAPTFLHLGVWPLIMGVTMFLQMRMNPTPPDPTQAMIFNWMP 539

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           +VF+F L+SFPAGL+IYW+W+N +S++QQ+VIMK HG +I L D LR  F + 
Sbjct: 540 LVFMFMLASFPAGLVIYWAWNNTLSVIQQSVIMKRHGVKIELFDNLRGLFRRK 592


>gi|150395307|ref|YP_001325774.1| putative inner membrane protein translocase component YidC
           [Sinorhizobium medicae WSM419]
 gi|166977420|sp|A6U5K9|OXAA_SINMW RecName: Full=Inner membrane protein oxaA
 gi|150026822|gb|ABR58939.1| 60 kDa inner membrane insertion protein [Sinorhizobium medicae
           WSM419]
          Length = 597

 Score =  627 bits (1617), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 294/592 (49%), Positives = 399/592 (67%), Gaps = 16/592 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMN-NERKNIQTVKQPN--QVDNSYAA-- 55
           ME N NYFVAIALSV+I+ AWQ FYV P++E+      K  Q   QP   Q     AA  
Sbjct: 2   MENNRNYFVAIALSVLILIAWQFFYVSPKMEKDRIAAEKAQQAQSQPGTQQAAPGQAAPG 61

Query: 56  ---------VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSP 106
                       + R QA+  S RV +  P+L GSINL GA+FDDL L+GY   V   SP
Sbjct: 62  QALPGGAIPSAAESRDQAIGKSARVAIDTPALSGSINLTGARFDDLKLKGYRETVDPKSP 121

Query: 107 IVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNI 166
           ++TL SP+ T + YF E+ Y+ +     +P   TVW L  G  LTP+TP+ L + N   I
Sbjct: 122 VITLFSPAETADGYFTEIGYIGSDATGSVPGPQTVWMLSGGDKLTPSTPVTLSYTNDKGI 181

Query: 167 LFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGD 226
            F RTIS+D+ Y+F++VD++ N++   +  S  GR+ R    +  + + + EGF+ V G+
Sbjct: 182 TFTRTISVDDRYMFEVVDSIKNDAAAAVSLSSYGRVTRFNKPSTPSIYVLHEGFVGVAGE 241

Query: 227 KSLVEQKYSDIE-KSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARY 285
             L E  YSD+E +  +     +  WLGI+DKYWA+  +P ++T F  +F + +DG  RY
Sbjct: 242 HGLQEVGYSDVEDEEPVEPGKSTGGWLGITDKYWAATIVPPQDTPFDIRFSHFADGRPRY 301

Query: 286 QAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKP 345
           Q+ + ++ +T+ PG+S    N +FAGAKE P + +YE   +IP F+ LIDWGWFYFI KP
Sbjct: 302 QSDYKSDAVTVAPGQSAEVKNLIFAGAKEVPVVDNYELTYSIPNFDKLIDWGWFYFITKP 361

Query: 346 MFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQ 405
           MF +M +F+ L GNFGIAI++TT+ VKL+FFPLA KQY S ANMK +QPK++EL++KF  
Sbjct: 362 MFKMMDFFFRLFGNFGIAILITTIVVKLIFFPLANKQYASMANMKKVQP