BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780483|ref|YP_003064896.1| putative inner membrane
protein translocase component YidC [Candidatus Liberibacter asiaticus
str. psy62]
         (581 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|118589754|ref|ZP_01547159.1| putative inner membrane protein translocase component YidC [Stappia
           aggregata IAM 12614]
 gi|118437840|gb|EAV44476.1| putative inner membrane protein translocase component YidC [Stappia
           aggregata IAM 12614]
          Length = 606

 Score =  486 bits (1249), Expect = e-135,   Method: Composition-based stats.
 Identities = 252/600 (42%), Positives = 369/600 (61%), Gaps = 24/600 (4%)

Query: 3   RNWNYFVAIALSVIIVYAWQNFYVYPRIE--------------------EMNNERKNIQT 42
            N N  +AI LS+I++  WQ F   P++E                       ++ +   +
Sbjct: 4   ENRNTILAIVLSLIVLLGWQYFVAAPQLERQQAELQAQQEAAQQTATDSANPSKPQPTGS 63

Query: 43  VKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVS 102
                    +   +   +R  AL+ S RV +  PSL GS+NLKG + DD+ L+ YH  V+
Sbjct: 64  QGANTAAPAAGQQMAFANREAALAASQRVTIDTPSLEGSVNLKGGRLDDIRLKDYHETVN 123

Query: 103 SNSPIVTLLSPSNTKNAYFAELDYVS-TANNIELPNSNTVWNLISGKILTPTTPIKLVFK 161
            +SP + L SPS +   Y+A+  +V     N+ LP  +TVW++     LTP+TP+ L + 
Sbjct: 124 KSSPTIVLFSPSGSPKPYYADYGWVGDPGTNLALPGPDTVWSVDGEATLTPSTPLTLSWD 183

Query: 162 NANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFI 221
           N   ++F+RT S+D++Y+F +  +V N   D +   P G I R         + + EG +
Sbjct: 184 NGAGLIFKRTFSVDDNYMFTVNQSVENTGSDAVTLYPYGLIARKGMPETNGIYILHEGLL 243

Query: 222 AVLGDKSLVEQKYSDIEKSS-ISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
            V G + L E  Y D+ + S I        WLGI+DKYWA+  IP+    F   F + S 
Sbjct: 244 GVFGAEGLKEVDYDDLVEESSIRPSKVDQGWLGITDKYWAATLIPTPGQEFQPGFSH-SA 302

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
               +QA +  N +T+  G +  T+++LFAGAKE   +  YE+ L+I RFE+LIDWGWFY
Sbjct: 303 TTDVFQADYLGNGVTVAGGSTGETSSYLFAGAKETKLLDGYEEALSIERFELLIDWGWFY 362

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           F+ KPMF  + YF++L GNFG+AI++ TV VKL+FFPLA K YVS + MK +QP++ E+R
Sbjct: 363 FLTKPMFFAIDYFFHLFGNFGVAILVVTVIVKLIFFPLANKSYVSMSKMKLVQPQMTEIR 422

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           EK+     Q  Q+A+++LYK   INPLAGC PI++QIPVFF++YKV+ +++EMRHAPF+G
Sbjct: 423 EKYSD-DRQKQQQALMELYKKEKINPLAGCLPIVVQIPVFFSLYKVLYVTIEMRHAPFFG 481

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMIL 520
           WI+DL+A DPT +F LFG++P+  P  + +G+WP+IM ++MFIQMKM+P P D  Q MI 
Sbjct: 482 WIQDLSAPDPTTLFNLFGLIPWDPPQMLMLGVWPLIMGITMFIQMKMNPAPPDPTQQMIF 541

Query: 521 NWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNS 580
            WMPV+F F L+SFPAGL+IYW+W+N +S+ QQ VIM+  GA++ L D L S F +   +
Sbjct: 542 TWMPVIFTFMLASFPAGLVIYWAWNNTLSVTQQYVIMRRQGAKVELWDNLGSLFKRKKAA 601


>gi|307943178|ref|ZP_07658523.1| inner membrane protein OxaA [Roseibium sp. TrichSKD4]
 gi|307773974|gb|EFO33190.1| inner membrane protein OxaA [Roseibium sp. TrichSKD4]
          Length = 603

 Score =  485 bits (1248), Expect = e-135,   Method: Composition-based stats.
 Identities = 246/597 (41%), Positives = 360/597 (60%), Gaps = 21/597 (3%)

Query: 3   RNWNYFVAIALSVIIVYAWQNFYVYPRIEE-----------------MNNERKNIQTVKQ 45
            N N  +AIALS+ ++ AWQ F   P++E+                              
Sbjct: 4   ENRNTLLAIALSLAVLLAWQYFVAQPQLEKQQAALQAQQAAEQAQSDPQRPSAQNAPGAA 63

Query: 46  PNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNS 105
                ++        R QA++ S RV L  P L GS+NL G + DD+ L+ YH  V  +S
Sbjct: 64  TTGAPSASGQEQFQTREQAIAASERVTLDTPRLSGSVNLVGGRIDDIRLKDYHETVDKSS 123

Query: 106 PIVTLLSPSNTKNAYFAELDYVS-TANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           P V L SP  +   ++A+  +VS    ++ LP ++TVW+  +G  LTP TP+ L F N  
Sbjct: 124 PTVVLFSPKGSPEPFYADYGWVSDPGADVALPGADTVWSAPAGAQLTPNTPLTLTFDNGG 183

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVL 224
            + F+RT S+DE+Y+F +  +V N+  + +   P G + R      TN + + EG + V 
Sbjct: 184 GLTFKRTFSIDENYMFSVTQSVENSGSEAVTLYPYGLLARTGQPETTNFYILHEGLLGVF 243

Query: 225 GDKSLVEQKYSDIEKSSISNF-HESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
           G++ L E  Y D+ ++ +         WLGI+DKYWA+  +P    +F   F + +    
Sbjct: 244 GEEGLKEVDYDDLAETGVDRPGKVDRGWLGITDKYWAATLVPEPGQTFQPSFTHSNV-TD 302

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
            YQA F  + + I  G +    ++LFAGAKE   +  YE  L I +FE+LIDWGWFYF+ 
Sbjct: 303 NYQADFLGSAVVIAAGSTSEANSYLFAGAKETKLLDSYEATLNIEQFELLIDWGWFYFLT 362

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           KPMF  + + + + GNFG+AI+L TV +KL+FFPLA K YVS + MK +QP++ E+R+++
Sbjct: 363 KPMFFAIDWLFMMFGNFGVAILLVTVAIKLVFFPLANKSYVSMSKMKLVQPQMQEIRDRY 422

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
                +  Q+A+++LYK   INPLAGC PIL+QIPVFFA+YKV+ +++EMRHAPF+GWI+
Sbjct: 423 GDDKAK-QQQALMELYKKEKINPLAGCLPILIQIPVFFALYKVLFVTIEMRHAPFFGWIQ 481

Query: 464 DLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWM 523
           DL+A DPT IF LFG++P+  P  + VGIWP++M ++MF+QMKM+P P D  Q MI  WM
Sbjct: 482 DLSAPDPTTIFNLFGMIPWDPPQLLTVGIWPLLMGITMFVQMKMNPAPPDPTQQMIFTWM 541

Query: 524 PVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNS 580
           P++F F L+SFPAGL+IYW+W+N +SI QQ VIM   G ++ L D L+STF +    
Sbjct: 542 PIIFTFMLASFPAGLVIYWAWNNFLSIAQQWVIMSRQGVKVELFDNLKSTFKRKPAK 598


>gi|254502069|ref|ZP_05114220.1| 60Kd inner membrane protein [Labrenzia alexandrii DFL-11]
 gi|222438140|gb|EEE44819.1| 60Kd inner membrane protein [Labrenzia alexandrii DFL-11]
          Length = 608

 Score =  485 bits (1247), Expect = e-134,   Method: Composition-based stats.
 Identities = 257/602 (42%), Positives = 368/602 (61%), Gaps = 26/602 (4%)

Query: 3   RNWNYFVAIALSVIIVYAWQNFYVYPRIEE----------------------MNNERKNI 40
            N N  +AI LS+I++ AWQ FY  P++E                         +     
Sbjct: 4   ENRNTILAIVLSLIVLLAWQYFYAGPQLERQQAALQAQQEAEAAQQSAPGGVNPDAPTPS 63

Query: 41  QTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLD 100
                     ++ +      R QALS + RV +  P L GSINL G + DDL L+ YH  
Sbjct: 64  VAGSGTTVAPSATSPQGFASREQALSATQRVVIDTPRLEGSINLTGGRLDDLRLKDYHET 123

Query: 101 VSSNSPIVTLLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWNLISGKILTPTTPIKLV 159
           V  +SP + L SP+ + N Y+++  +V+ A  +I LP  +T+W++     LTP+TP+ L 
Sbjct: 124 VDRSSPTIVLFSPTGSPNPYYSDYGWVADAGASITLPGPDTIWSVNGSSDLTPSTPLTLS 183

Query: 160 FKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEG 219
           + N   ++F RT S+DE+Y+F +  +VTNNS D +   P G I R      T  + + EG
Sbjct: 184 WDNGEGLVFNRTFSVDENYMFDVTQSVTNNSGDVVTLYPYGLIARKGIPETTGIWILHEG 243

Query: 220 FIAVLGDKSLVEQKYSDIEKS-SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYL 278
            + V G++ LVE  YSD+E+   +        WLGI+DKYWA+  IP+    F   F Y 
Sbjct: 244 LLGVFGEEGLVEVDYSDLEEDGPVRPAAVDRGWLGITDKYWAATLIPTPGQEFQPGFSYA 303

Query: 279 SDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGW 338
           +     +QA +  N + +  G    T+++LFAGAKE   +  YE  L+I RFE+LIDWGW
Sbjct: 304 AQSGN-FQADYLGNAVVVPAGGVGETSSYLFAGAKETNLLDAYEASLSIERFELLIDWGW 362

Query: 339 FYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDE 398
           FYF+ KPMF  + + ++  GNFG+AI+L TV +KL FFPLA K YVS + MK +QP++ E
Sbjct: 363 FYFLTKPMFYAIDFLFHYFGNFGVAILLVTVIIKLFFFPLANKSYVSMSKMKLVQPQMTE 422

Query: 399 LREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF 458
           +REK+     Q  Q+A+++LYK   INPLAGC PIL+QIPVFFA+YKV+ +++EMRHAPF
Sbjct: 423 IREKYAD-DRQKQQQALMELYKKEKINPLAGCLPILIQIPVFFALYKVLFVTIEMRHAPF 481

Query: 459 WGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAM 518
           +GWI+DL+A DPT++F LFG++P+  P  + +G+WP+IM ++MF+QMKM+P P D  Q M
Sbjct: 482 FGWIQDLSAPDPTSLFNLFGLIPWDPPQLLMLGVWPLIMGITMFVQMKMNPAPPDPTQQM 541

Query: 519 ILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNY 578
           I  WMPVVF F L+SFPAGL+IYW+W+N +SI QQ VIM   G ++ L D + S F +  
Sbjct: 542 IFTWMPVVFTFMLASFPAGLVIYWAWNNSLSIAQQWVIMSRQGVKVELWDNIGSMFKRKK 601

Query: 579 NS 580
            +
Sbjct: 602 PA 603


>gi|241202849|ref|YP_002973945.1| inner membrane protein translocase component YidC [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240856739|gb|ACS54406.1| 60 kDa inner membrane insertion protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 597

 Score =  484 bits (1246), Expect = e-134,   Method: Composition-based stats.
 Identities = 287/593 (48%), Positives = 385/593 (64%), Gaps = 17/593 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNI----------------QTVK 44
           ME N NYF+AIALSV+IV  WQ  Y+ PRIE     ++                  QT  
Sbjct: 1   MENNRNYFIAIALSVLIVLGWQFLYMNPRIEAQRKVQEAQKAQQQTEQVQQPAAGGQTPA 60

Query: 45  QPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
           QP+    +  A       QAL+ SPRV +   +L GSINL GA+ DDL L+GYH  V  +
Sbjct: 61  QPSGAAPTSQAAATATLEQALAKSPRVVIDTAALSGSINLAGARLDDLKLKGYHETVDDS 120

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           SPI+TL SP+ TK+ YF EL Y+ +     +P  +T+W    G  LT  TP+ L + N  
Sbjct: 121 SPIITLFSPAETKDGYFTELGYIGSDATGSVPGPSTLWTAPEGAKLTEKTPVTLSYTNDK 180

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVL 224
            + F RTIS+DE Y+F + D + N        +  GR+ R+   T  + + + EGFI V+
Sbjct: 181 GLTFTRTISVDERYMFTVADKIENAGQAPASLNSYGRVTRYNKPTTPSVYVLHEGFIGVI 240

Query: 225 GDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR 284
           GD  LVE KY+  EK ++     +  WLGI+DKYWA+  +P +   + + F + +DG  R
Sbjct: 241 GDDGLVETKYTAAEKEAVKPAKSTGGWLGITDKYWAATIVPPQSAPYEASFSHFADGQPR 300

Query: 285 YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAK 344
           YQA +  +  T+ PG+SI   N +FAGAKE P I  YE   +IP+F+ LIDWGWFYFI K
Sbjct: 301 YQADYKEDAFTVAPGQSIELKNLVFAGAKEVPVIDGYEASYSIPKFDRLIDWGWFYFITK 360

Query: 345 PMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK 404
           PMF LM +F+   GNFG+AI+ TT+ VKLLFFPLA KQY S ANMK +QPK++EL+ KF 
Sbjct: 361 PMFKLMDFFFRYFGNFGVAILCTTIVVKLLFFPLASKQYASMANMKRMQPKMEELKAKFA 420

Query: 405 QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKD 464
                 LQ+A +QLYK   INP+AGCWP+ LQIP+FF++YKVI I++EMRHAPF+GWIKD
Sbjct: 421 D-DRMGLQQATMQLYKEEKINPIAGCWPVALQIPIFFSLYKVIYITIEMRHAPFFGWIKD 479

Query: 465 LAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMP 524
           L+A DPT I  LFG+LPF  P  +H+G+WP+IM ++MF+QM+M+P P D  QAMI  WMP
Sbjct: 480 LSAPDPTTIVNLFGLLPFEAPTILHLGVWPLIMGVTMFLQMRMNPTPPDPTQAMIFTWMP 539

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           +VF+F L+SFPAGL+IYW+W+N +S+ QQ+VIMK HG ++ L D L+  F + 
Sbjct: 540 LVFMFMLASFPAGLVIYWAWNNTLSVAQQSVIMKRHGVKVELFDNLKGLFRRK 592


>gi|150395307|ref|YP_001325774.1| putative inner membrane protein translocase component YidC
           [Sinorhizobium medicae WSM419]
 gi|166977420|sp|A6U5K9|OXAA_SINMW RecName: Full=Inner membrane protein oxaA
 gi|150026822|gb|ABR58939.1| 60 kDa inner membrane insertion protein [Sinorhizobium medicae
           WSM419]
          Length = 597

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 289/594 (48%), Positives = 395/594 (66%), Gaps = 16/594 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYA------ 54
           ME N NYFVAIALSV+I+ AWQ FYV P++E+     +  Q  +       +        
Sbjct: 2   MENNRNYFVAIALSVLILIAWQFFYVSPKMEKDRIAAEKAQQAQSQPGTQQAAPGQAAPG 61

Query: 55  --------AVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSP 106
                       + R QA+  S RV +  P+L GSINL GA+FDDL L+GY   V   SP
Sbjct: 62  QALPGGAIPSAAESRDQAIGKSARVAIDTPALSGSINLTGARFDDLKLKGYRETVDPKSP 121

Query: 107 IVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNI 166
           ++TL SP+ T + YF E+ Y+ +     +P   TVW L  G  LTP+TP+ L + N   I
Sbjct: 122 VITLFSPAETADGYFTEIGYIGSDATGSVPGPQTVWMLSGGDKLTPSTPVTLSYTNDKGI 181

Query: 167 LFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGD 226
            F RTIS+D+ Y+F++VD++ N++   +  S  GR+ R    +  + + + EGF+ V G+
Sbjct: 182 TFTRTISVDDRYMFEVVDSIKNDAAAAVSLSSYGRVTRFNKPSTPSIYVLHEGFVGVAGE 241

Query: 227 KSLVEQKYSDIEKSSISNFHESNS-WLGISDKYWASVFIPSKETSFHSQFKYLSDGHARY 285
             L E  YSD+E        +S   WLGI+DKYWA+  +P ++T F  +F + +DG  RY
Sbjct: 242 HGLQEVGYSDVEDEEPVEPGKSTGGWLGITDKYWAATIVPPQDTPFDIRFSHFADGRPRY 301

Query: 286 QAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKP 345
           Q+ + ++ +T+ PG+S    N +FAGAKE P + +YE   +IP F+ LIDWGWFYFI KP
Sbjct: 302 QSDYKSDAVTVAPGQSAEVKNLIFAGAKEVPVVDNYELTYSIPNFDKLIDWGWFYFITKP 361

Query: 346 MFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQ 405
           MF +M +F+ L GNFGIAI++TT+ VKL+FFPLA KQY S ANMK +QPK++EL++KF  
Sbjct: 362 MFKMMDFFFRLFGNFGIAILITTIVVKLIFFPLANKQYASMANMKKVQPKMEELKKKFGD 421

Query: 406 SPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDL 465
                LQ+AM+QLYK   INPLAGCWPIL+QIPVFFA+YKVI +++EMRHAPF+GWI+DL
Sbjct: 422 -DRMGLQQAMMQLYKEEKINPLAGCWPILIQIPVFFALYKVIYVTIEMRHAPFFGWIQDL 480

Query: 466 AAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPV 525
           +A DPT I  LFG+LPF  P F+H+GIWPI+M ++MF+QM+M+P P D  QAM+  WMPV
Sbjct: 481 SAPDPTTIINLFGLLPFEGPAFLHLGIWPIVMGVTMFLQMRMNPTPPDPTQAMLFTWMPV 540

Query: 526 VFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYN 579
           VF F L+SFPAGL+IYW+W+N +SI+QQ +IMK  G ++ L D L+S FSK   
Sbjct: 541 VFTFMLASFPAGLVIYWAWNNTLSILQQGIIMKRQGVKVELFDNLKSLFSKKPK 594


>gi|220925223|ref|YP_002500525.1| YidC translocase/secretase [Methylobacterium nodulans ORS 2060]
 gi|254773002|sp|B8IMM9|OXAA_METNO RecName: Full=Inner membrane protein oxaA
 gi|219949830|gb|ACL60222.1| YidC translocase/secretase [Methylobacterium nodulans ORS 2060]
          Length = 605

 Score =  480 bits (1235), Expect = e-133,   Method: Composition-based stats.
 Identities = 243/602 (40%), Positives = 362/602 (60%), Gaps = 25/602 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYA------- 54
               N  +AIALS+ ++  W  F   P++E    ++        P +   S         
Sbjct: 3   NDKTNMIIAIALSLAVLLGWNYFVAAPQVERQRQQQAQTSASPSPKEGGPSAPVPGTLPG 62

Query: 55  -----AVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVT 109
                      R +AL+ SPRV +   +L GS+ LKG + DD+ L+GYH  V   SP + 
Sbjct: 63  ASGGNPQAALTREEALARSPRVRIDTEALKGSVALKGGRIDDVALKGYHETVDPKSPEIV 122

Query: 110 LLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFE 169
           LLSP+ + N Y+AE  +V       LPN +TVW    G +LT   P+ L + N   ++F 
Sbjct: 123 LLSPAGSANPYYAEFGWVGQGAGP-LPNGDTVWT-ADGDLLTAKKPLTLTWDNGAGLVFR 180

Query: 170 RTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSL 229
           RT+S+D+ Y+F + D+V N     +   P G + R         + + EG I VLGDK L
Sbjct: 181 RTLSVDDKYMFTVEDSVENKGQSAVTLYPYGLVSRWGKPHTQGYYVLHEGLIGVLGDKGL 240

Query: 230 VEQKYSDIEKSS---------ISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
            E  Y  + K +         +S    +  +LGI+DKYWA+  IP ++T +   F    +
Sbjct: 241 QEYTYDKMAKENPLGSPGTRGLSWPGVTGGFLGITDKYWAAATIPDQKTPYTGSFTERDE 300

Query: 281 GHAR-YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWF 339
           G  + YQ        T+ PG  +  +  LFAGAKE  TI  Y + L I +F+++IDWGWF
Sbjct: 301 GATKVYQTSSLGEARTLAPGAGVQASQHLFAGAKEVSTIDAYRQKLDIKQFDLMIDWGWF 360

Query: 340 YFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDEL 399
           YFI KPMF  + +FY L GNFG++I++ T+ +KL F P+A + YVS A MK +QP++  +
Sbjct: 361 YFITKPMFKALDFFYKLFGNFGVSILVVTLILKLFFLPIANRSYVSMAKMKAVQPEMTAI 420

Query: 400 REKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFW 459
           RE++     +  Q+AM++LY+   INP+AGCWP+++QIPVFFA+YKV+ +++EMRHAPF+
Sbjct: 421 RERYADDKVK-QQQAMMELYRKEKINPVAGCWPVVIQIPVFFALYKVLFVTIEMRHAPFF 479

Query: 460 GWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMI 519
           GWI+DLAA DPT++  LFG+LPF  P  +H+G+WPI+M ++MF+QMKM+P P D  QA +
Sbjct: 480 GWIRDLAAPDPTSVLNLFGLLPFAAPDLVHLGVWPIVMGITMFLQMKMNPAPPDPVQAQV 539

Query: 520 LNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYN 579
             +MP++F F L SFPAGL+IYW+W+N++SI+QQ  IM+ +G ++ L D LR+TFS++  
Sbjct: 540 FTFMPIIFTFMLGSFPAGLVIYWAWNNLLSILQQYWIMRRNGVKVELWDNLRTTFSRSSP 599

Query: 580 SQ 581
            +
Sbjct: 600 VK 601


>gi|116250222|ref|YP_766060.1| inner membrane protein translocase component YidC [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|166977404|sp|Q1MM58|OXAA_RHIL3 RecName: Full=Inner membrane protein oxaA
 gi|115254870|emb|CAK05944.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 598

 Score =  479 bits (1233), Expect = e-133,   Method: Composition-based stats.
 Identities = 289/593 (48%), Positives = 384/593 (64%), Gaps = 17/593 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNN----------------ERKNIQTVK 44
           ME N NYF+AIALSV+IV  WQ  Y+ PRIE                         QT  
Sbjct: 2   MENNRNYFIAIALSVLIVLGWQFLYMNPRIEAQRKAQEAQKAQQQTEQVQQPAAGGQTPA 61

Query: 45  QPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
           Q +    S  A       QAL  SPRV +  P+L GSINL GA+ DDL L+GYH  V  +
Sbjct: 62  QTSGAAPSGQAAATATLEQALQKSPRVVIDTPALSGSINLAGARLDDLKLKGYHETVDDS 121

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           SPI+TL SP+ TK+ YF EL Y+ +     +P  +T+W    G  LT  TP+ L + N  
Sbjct: 122 SPIITLFSPAETKDGYFTELGYIGSDATGSVPGPSTLWTAPEGAKLTEKTPVTLSYTNDK 181

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVL 224
            + F RTIS+DE Y+F + D + N        S  GR+ R+   T  + + + EGFI V+
Sbjct: 182 GLTFTRTISVDERYMFTVADKIENTGQAPAALSSYGRVTRYNKPTTPSVYVLHEGFIGVI 241

Query: 225 GDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR 284
           GD  L+E KYS +EK +++    +  WLGI+DKYWA+  +P +  ++ + F Y +DG  R
Sbjct: 242 GDDGLIETKYSAVEKEAVAPAKSTGGWLGITDKYWAATIVPPQSAAYEAHFSYFADGQPR 301

Query: 285 YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAK 344
           YQA +  +  T+ PG+SI   N +FAGAKE P I  YE   +IP+F+ LIDWGWFYFI K
Sbjct: 302 YQADYKDDAFTVAPGQSIELKNLVFAGAKEVPVIDGYEASYSIPKFDRLIDWGWFYFITK 361

Query: 345 PMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK 404
           PMF LM +F+   GNFG+AI+ TT+ VK LFFPLA KQY S ANMK +QPK++EL+ KF 
Sbjct: 362 PMFKLMDFFFRYFGNFGVAILCTTIVVKALFFPLASKQYASMANMKRMQPKMEELKAKFA 421

Query: 405 QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKD 464
                 LQ+A +QLYK   INP+AGCWP+ LQIP+FF++YKVI I++EMRHAPF+GWIKD
Sbjct: 422 D-DRMGLQQATMQLYKEEKINPIAGCWPVALQIPIFFSLYKVIYITIEMRHAPFFGWIKD 480

Query: 465 LAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMP 524
           L+A DPT I  LFG+LPF  P  +H+G+WP+IM ++MF+QM+M+P P D  QAMI NWMP
Sbjct: 481 LSAPDPTTIVNLFGLLPFEGPTLLHLGVWPLIMGVTMFVQMRMNPTPPDPTQAMIFNWMP 540

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           +VF+F L+SFPAGL+IYW+W+N +S+ QQ +IMK HG ++ L D L+  F + 
Sbjct: 541 LVFMFMLASFPAGLVIYWAWNNTLSVAQQGLIMKRHGVKVELFDNLKGLFRRK 593


>gi|153008692|ref|YP_001369907.1| putative inner membrane protein translocase component YidC
           [Ochrobactrum anthropi ATCC 49188]
 gi|151560580|gb|ABS14078.1| 60 kDa inner membrane insertion protein [Ochrobactrum anthropi ATCC
           49188]
          Length = 607

 Score =  479 bits (1232), Expect = e-133,   Method: Composition-based stats.
 Identities = 273/604 (45%), Positives = 380/604 (62%), Gaps = 26/604 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQ------------------- 41
           ME N N+F+ IALS++++  WQ FY+ P+ E    + +  +                   
Sbjct: 1   MENNRNFFITIALSILVLTLWQVFYLGPKTEAQREQARIEEQQQQKQQATQQQAQSGDTP 60

Query: 42  ----TVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGY 97
               T        +  AA     R  A++ + RVE+  PSL GSINL GA+ DDL L+ Y
Sbjct: 61  QMPATSGNIPGHSDVAAAGGTLTREAAVAQTQRVEIDTPSLRGSINLTGARLDDLFLKRY 120

Query: 98  HLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIK 157
           H  V  NSP + LL+PS  K  YF EL +        +P  NTVW +     LTP+TP+ 
Sbjct: 121 HETVDDNSPQIELLAPSALKQGYFVELGFTGNDTTGPVPGPNTVWTVEGNNKLTPSTPVT 180

Query: 158 LVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIM-RHKPQTATNTFGV 216
           L + N  NI F+R IS+D+ Y+F + DT+TNN+   I  +  GR+   ++P+ A+ T+ +
Sbjct: 181 LTYTNEKNITFKRVISVDDAYMFAVEDTITNNTGAPISLASYGRVTRFNQPEHASATYVL 240

Query: 217 QEGFIAVLGDKSLVEQKYSDIEKSS-ISNFHESNSWLGISDKYWASVFIPSKETSFHSQF 275
            EG I V+G   L E KYS +E    IS    S  WLGI+DKYWA+  +P ++  F  +F
Sbjct: 241 HEGLIGVMGQDGLQEIKYSKVEDDKDISFKDVSGGWLGITDKYWAATLVPPQDEKFTGRF 300

Query: 276 KYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLID 335
            + ++   RYQ  F    +TI PG++ T  N +FAGAK    I  YE+ L I +FE+LID
Sbjct: 301 SHFTNDRPRYQTDFLGAPMTIAPGQAQTLKNHVFAGAKVVSNIKAYEEKLGIKQFELLID 360

Query: 336 WGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPK 395
           WGWFYFI KPMF L+ + Y   GNFG+AI++ TV +K LFFPLA K Y S A MK +QPK
Sbjct: 361 WGWFYFITKPMFYLIDWIYKFSGNFGVAILVVTVLLKGLFFPLANKSYKSMARMKLVQPK 420

Query: 396 IDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRH 455
           + E+REK+     +  Q+ M++LYK   INPLAGCWP+L+QIPVFFA+YKV+ +++EMRH
Sbjct: 421 LTEIREKYADDKMK-QQQEMMRLYKEEKINPLAGCWPVLVQIPVFFALYKVLYVTIEMRH 479

Query: 456 APFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKG 515
           APF+GWI+DLAA DPT++F LFG+LPF +P F+ +G+WP++M ++MF+QM+M+P P D  
Sbjct: 480 APFFGWIQDLAAPDPTSLFNLFGLLPFGVPHFLMIGVWPLLMGITMFLQMRMNPTPPDPT 539

Query: 516 QAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFS 575
           QA I  WMPV+F F L+SFPAGL+IYW+W+N++SI QQ +IMK  G +I L D L+  F 
Sbjct: 540 QAAIFTWMPVIFTFMLASFPAGLVIYWAWNNLLSITQQGIIMKRQGVKIELFDNLKGLFK 599

Query: 576 KNYN 579
           +   
Sbjct: 600 RKPK 603


>gi|110632737|ref|YP_672945.1| putative inner membrane protein translocase component YidC
           [Mesorhizobium sp. BNC1]
 gi|110283721|gb|ABG61780.1| protein translocase subunit yidC [Chelativorans sp. BNC1]
          Length = 609

 Score =  478 bits (1230), Expect = e-132,   Method: Composition-based stats.
 Identities = 271/607 (44%), Positives = 369/607 (60%), Gaps = 29/607 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQ--------------- 45
           ME N N  + IALSV+I+  WQ FYV PR++      +      Q               
Sbjct: 1   MENNRNLLITIALSVVILTLWQVFYVNPRVDAQREAAQIEAQRAQETEEKLGTQGADIPA 60

Query: 46  ------PNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHL 99
                    V  S        R +AL+ + RV +  P L G+INL GA+ DDL L+ Y +
Sbjct: 61  PGATPGSTAVPGSAIPRTQVTRQEALAGAERVTIDTPRLAGTINLAGARLDDLLLKDYRV 120

Query: 100 DVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLV 159
            V  +SP + LL P+     YF E+ Y   A+   +P  +TVW L  G  L+P +P+ L 
Sbjct: 121 TVDKDSPNIDLLGPAGLPEGYFVEVGYTGNASTGAVPGPDTVWQLQEGSTLSPGSPVTLS 180

Query: 160 FKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEG 219
           F N   + F RT ++DE+YLF I DT+ N + + +     GR  R         + + EG
Sbjct: 181 FTNDRGLTFLRTFAVDENYLFTITDTIRNAAGEPVEIRNYGRTTRFGQPKTAGIYILHEG 240

Query: 220 FIAVLGDKSLVEQKYSDIEKSSISNFHES-NSWLGISDKYWASVFIPSKETSFHSQFKYL 278
           FI VLG++ L E  YS  ++       +S + WLGI+DKYWA   +P  +  F  +F Y 
Sbjct: 241 FIGVLGEEGLREVDYSTAQEDGQVLPGKSADGWLGITDKYWAVTMVPRAQKDFEPRFAYF 300

Query: 279 SDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGW 338
           SDG  RYQA +  + +T+ PG        +FAGAKE   +  YE    I +FE+LIDWGW
Sbjct: 301 SDGRERYQADYLTDPVTVAPGGEAKIETLVFAGAKEVHVVDAYETQHNIRQFELLIDWGW 360

Query: 339 FYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDE 398
           FYFI KPMF L+ + + L+GNFG+AI+ TTVFVKL+FFPLA K Y S ANMK +QP + E
Sbjct: 361 FYFITKPMFYLIDWLFRLLGNFGVAILATTVFVKLVFFPLANKSYKSMANMKKVQPALLE 420

Query: 399 LREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF 458
           +REK+     +  Q+AM++LYK   INPLAGCWPIL+QIPVFFA+YKV+ +++EMRHAPF
Sbjct: 421 IREKYADDKMK-QQQAMMELYKKEKINPLAGCWPILIQIPVFFALYKVLYVTIEMRHAPF 479

Query: 459 WGWIKDLAAADPTNIFTLFGILPFYLPG------FMHVGIWPIIMSLSMFIQMKMSPPPA 512
           +GWI+DL+A DPT IF LFG+LPF          F+ +G+WPIIM ++MF+QM+M+P P 
Sbjct: 480 FGWIQDLSAPDPTTIFNLFGLLPFDPSQVPVFGPFLMLGVWPIIMGITMFLQMRMNPTPP 539

Query: 513 DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRS 572
           D  QAMI NWMPV+F F L++FPAGL+IYW+W+N++SI+QQ VIMK  GA+I L D + +
Sbjct: 540 DPTQAMIFNWMPVIFTFMLATFPAGLVIYWAWNNLLSIIQQGVIMKRQGAKIELWDNMVN 599

Query: 573 TFSKNYN 579
            F +   
Sbjct: 600 LFRRKPK 606


>gi|209547692|ref|YP_002279609.1| inner membrane protein translocase component YidC [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209533448|gb|ACI53383.1| 60 kDa inner membrane insertion protein [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 597

 Score =  478 bits (1229), Expect = e-132,   Method: Composition-based stats.
 Identities = 288/593 (48%), Positives = 391/593 (65%), Gaps = 17/593 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDN--------- 51
           ME+N NYF+AIALSV+IV  WQ  Y+ PRIE     ++  +  ++  QV           
Sbjct: 1   MEKNRNYFIAIALSVLIVLGWQFLYMNPRIEAQRKAQEAQKAQQKTEQVQQPAANGAAPA 60

Query: 52  -------SYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
                  S  AV      QAL+ +PRV +  P+L GSINL GA+ DDL L+GYH  V  +
Sbjct: 61  PTSGTAPSGQAVATATLEQALAKNPRVVIDTPALSGSINLAGARLDDLKLKGYHETVDDS 120

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           SP +TL SP+ TK+ YF EL Y+ +     +P ++T+W    G  LT  TP+ L + N  
Sbjct: 121 SPTITLFSPAETKDGYFTELGYIGSDATGNVPGASTLWTAPEGAKLTDKTPVTLSYTNDK 180

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVL 224
            + F RTIS+DE Y+F + D V N     +  S  GR+ R+   T  + + + EGFI V+
Sbjct: 181 GLTFTRTISVDERYMFTVADKVENTGQAPVSLSSYGRVTRYNKPTTPSVYVLHEGFIGVI 240

Query: 225 GDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR 284
           GD  LVE KY+  EK ++     +  WLGI+DKYWA+  IP + +++ ++F + +DG  R
Sbjct: 241 GDDGLVETKYTAAEKEAVMPPKSTGGWLGITDKYWAATIIPPQTSAYEARFSHFADGQPR 300

Query: 285 YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAK 344
           YQA +  +  T+ PG+SI   N +FAGAKE P I  YE   +IP+F+ LIDWGWFYFI K
Sbjct: 301 YQADYKDDAFTVAPGQSIELKNLVFAGAKEVPVIDGYETSYSIPKFDRLIDWGWFYFITK 360

Query: 345 PMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK 404
           PMF LM +FY   GNFG+AI+ TT+ VK LFFPLA KQY S ANMK +QPK++EL+ KF 
Sbjct: 361 PMFKLMDFFYRFFGNFGVAILCTTIVVKALFFPLASKQYASMANMKRMQPKMEELKAKFA 420

Query: 405 QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKD 464
                 LQ+A +QLYK   INP+AGCWP+ LQIP+FF++YKVI I++EMRHAPF+GWIKD
Sbjct: 421 D-DRMGLQQATMQLYKEEKINPIAGCWPVALQIPIFFSLYKVIYITIEMRHAPFFGWIKD 479

Query: 465 LAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMP 524
           L+A DPT I  LFG+LPF  P  +H+G+WP+IM ++MF+QM+M+P P D  QAMI  WMP
Sbjct: 480 LSAPDPTTIVNLFGLLPFEAPTILHLGVWPLIMGVTMFLQMRMNPTPPDPTQAMIFTWMP 539

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           +VF+F L+SFPAGL+IYW+W+N +S++QQ+VIMK  G ++ L D L+  F + 
Sbjct: 540 LVFMFMLASFPAGLVIYWAWNNTLSVIQQSVIMKRQGVKVELFDNLKGLFRRK 592


>gi|86356094|ref|YP_467986.1| putative inner membrane protein translocase component YidC
           [Rhizobium etli CFN 42]
 gi|86280196|gb|ABC89259.1| putative inner membrane transmembrane protein [Rhizobium etli CFN
           42]
          Length = 597

 Score =  478 bits (1229), Expect = e-132,   Method: Composition-based stats.
 Identities = 293/593 (49%), Positives = 389/593 (65%), Gaps = 17/593 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNN----------------ERKNIQTVK 44
           ME N NYF+AIALSV+IV  WQ  Y+ PRIE                         Q   
Sbjct: 1   MENNRNYFIAIALSVLIVLGWQFLYMNPRIEAQRKAQEAQKAQQQTEQTQQPAAGGQAPA 60

Query: 45  QPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
           Q +    S  A     R QAL  +PR+ +   +L GSINL GA+ DDL L+GYH  V  +
Sbjct: 61  QTSGAAPSGQAAATATREQALEKTPRIAIDTAALSGSINLAGARLDDLKLKGYHETVDDS 120

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           SP +TL SP+ TK+ YF EL Y+ +     +P  +T+W    G  LT  TP+ L + N  
Sbjct: 121 SPTITLFSPAETKDGYFTELGYIGSDTTGAVPGPSTLWTAPEGAKLTEKTPVTLSYTNDK 180

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVL 224
            + F RTIS+DE Y+F + D + N        S  GR+MR+   T  + + + EGFI V+
Sbjct: 181 GLTFTRTISVDERYMFTVADKIENTGQAPAALSSYGRVMRYNKPTTPSVYVLHEGFIGVI 240

Query: 225 GDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR 284
           GD  L+E KYS +EK ++S    +  WLGI+DKYWA+  +P + +++ ++F Y SDG  R
Sbjct: 241 GDDGLIESKYSAVEKEAVSPAKSAGGWLGITDKYWAATIVPPQSSAYEAKFSYFSDGQPR 300

Query: 285 YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAK 344
           YQA +  +  ++ PG+SI   N +FAGAKE P I  YE   +IP+F+ LIDWGWFYFI K
Sbjct: 301 YQADYKNDAFSVAPGQSIELKNLVFAGAKEVPVIDGYEASYSIPKFDRLIDWGWFYFITK 360

Query: 345 PMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK 404
           PMF LM +FY   GNFG+AI+ TT+ VK LFFPLA KQY S ANMK +QPK++EL+ KF 
Sbjct: 361 PMFKLMDFFYRFFGNFGVAILCTTIVVKALFFPLASKQYASMANMKRMQPKMEELKAKFG 420

Query: 405 QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKD 464
                 LQ+AM+QLYK   INP+AGCWP+ LQIP+FF++YKVI I++EMRHAPF+GWIKD
Sbjct: 421 D-DRMGLQQAMMQLYKDEKINPIAGCWPVALQIPIFFSLYKVIYITIEMRHAPFFGWIKD 479

Query: 465 LAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMP 524
           L+A DPT I  LFG+LPF  P F+H+G+WP+IM ++MF+QM+M+P P D  QAMI NWMP
Sbjct: 480 LSAPDPTTIVNLFGLLPFEAPTFLHLGVWPLIMGVTMFLQMRMNPTPPDPTQAMIFNWMP 539

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           +VF+F L+SFPAGL+IYW+W+N +S++QQ+VIMK HG +I L D LR  F + 
Sbjct: 540 LVFMFMLASFPAGLVIYWAWNNTLSVIQQSVIMKRHGVKIELFDNLRGLFRRK 592


>gi|328545250|ref|YP_004305359.1| transmembrane protein, OxaA-like, preprotein translocase component
           [polymorphum gilvum SL003B-26A1]
 gi|326414992|gb|ADZ72055.1| Transmembrane protein, OxaA-like, preprotein translocase component
           [Polymorphum gilvum SL003B-26A1]
          Length = 607

 Score =  477 bits (1227), Expect = e-132,   Method: Composition-based stats.
 Identities = 258/603 (42%), Positives = 365/603 (60%), Gaps = 26/603 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIE----------------------EMNNERK 38
           M  N N F+AIALS++++  WQ F   P++E                             
Sbjct: 1   MADNRNTFLAIALSLVVLLGWQYFVARPQLERQQAELAQQDAQQQAAGQDAQAPTPGATA 60

Query: 39  NIQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYH 98
                   +    + A  +   R  AL  S RV ++ P + GSINL GA+ DDL L+ Y 
Sbjct: 61  PGSLPAPGSTAPAAGAQPVALTREAALGTSARVTIETPRVSGSINLAGARIDDLRLKDYR 120

Query: 99  LDVSSNSPIVTLLSPSNTKNAYFAELDYVSTA-NNIELPNSNTVWNLISGKILTPTTPIK 157
             V   SP + L SP      Y+A+  +V+     + LP  +++W++     LTP TP+ 
Sbjct: 121 ETVDPKSPTIVLFSPKGGPKPYYADFGWVTDGTKTVALPGPDSLWSVEGSDRLTPQTPVT 180

Query: 158 LVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQ 217
           L F N   ++F+RT ++DE+Y+F +   V N + + IR  P G I+R         + + 
Sbjct: 181 LTFDNGEGLVFKRTFTIDENYMFSVSQEVVNGTQEAIRLFPYGLIVRRGKPETAGFYILH 240

Query: 218 EGFIAVLGDKSLVEQKYSDIEKSSISNF-HESNSWLGISDKYWASVFIPSKETSFHSQFK 276
           EG I V G+K L E  YSD+E+          + WLGI+DKYWA+  IP   +SF   F 
Sbjct: 241 EGLIGVFGEKGLQEVDYSDVEEDGQIRPGQVDSGWLGITDKYWAATLIPMPGSSFQPSFG 300

Query: 277 YLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDW 336
           Y       +QA F    + +  G S + +++LFAGAKE   I  YE+ L I RFE+LIDW
Sbjct: 301 YT-ATTDNFQADFLGAAVDVASGASGSASSYLFAGAKETKVIDAYEEALNIARFELLIDW 359

Query: 337 GWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKI 396
           GWFYF+ KPMF ++ + ++LVGNFGIAI+L TV VKL+FFPLA K YVS + MK +QP++
Sbjct: 360 GWFYFLTKPMFFVIDWLFHLVGNFGIAILLVTVLVKLVFFPLANKSYVSMSKMKLVQPQM 419

Query: 397 DELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHA 456
            E+R+++K    +  Q+A+++LYK   INPLAGC PIL+QIPVFFA+YKV+ +++EMRHA
Sbjct: 420 TEIRDRYKDDKAK-QQQALMELYKKEKINPLAGCLPILIQIPVFFALYKVLFVTIEMRHA 478

Query: 457 PFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQ 516
           PF+GWI+DL+A DPT IF LFG++P+  P  + +GIWP+IM ++MF+QMKM+P P D  Q
Sbjct: 479 PFFGWIQDLSAPDPTTIFNLFGLIPWDPPQMLMLGIWPLIMGVTMFVQMKMNPAPPDPTQ 538

Query: 517 AMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSK 576
            MI  WMPV+F F L+SFPAGL+IYW+W+N +SI QQ VIM+  GA++ L D L+ TF +
Sbjct: 539 QMIFTWMPVIFTFMLASFPAGLVIYWAWNNSLSIAQQYVIMRRQGAKVELWDNLKITFKR 598

Query: 577 NYN 579
              
Sbjct: 599 KKP 601


>gi|114706827|ref|ZP_01439727.1| putative inner membrane transmembrane protein [Fulvimarina pelagi
           HTCC2506]
 gi|114537775|gb|EAU40899.1| putative inner membrane transmembrane protein [Fulvimarina pelagi
           HTCC2506]
          Length = 603

 Score =  477 bits (1226), Expect = e-132,   Method: Composition-based stats.
 Identities = 274/601 (45%), Positives = 373/601 (62%), Gaps = 24/601 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQ------TVKQPNQVDNSYA 54
           ME N N+ +A+ALS++++  WQ   + PR++E   + +  Q      T + P   D    
Sbjct: 1   MEMNRNFLIAMALSIMVLVGWQFLVIGPRMDEQQRQNEIAQNEGSLQTPQTPAGSDQDSL 60

Query: 55  AVLI--------------DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLD 100
                               R Q ++   RV +  P L GSINL GA+ DDL L+ YH  
Sbjct: 61  TAPSGRESMVPSPNLPQNQSREQVIAGGNRVTIDTPELTGSINLTGARLDDLRLKHYHET 120

Query: 101 VSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVF 160
           V  +SP + LLSP    N YFAE   +      +L  +NT W    G  LTP TP+ L  
Sbjct: 121 VDDSSPTIVLLSPEELPNGYFAEYGLIQPGTG-QLVGANTEWQAEDGAELTPDTPVTLTA 179

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGF 220
              + +   R IS+D++++F   DTV N     ++ SP GRI R+        F + EG 
Sbjct: 180 TTESGLTVTRRISVDDNFMFTYEDTVENTGDAAVQVSPYGRIARYSKPEVAAAFVLFEGL 239

Query: 221 IAVLGDKSLVEQKYSDIEKSSISNFHESNS--WLGISDKYWASVFIPSKETSFHSQFKYL 278
           + V G++ L E  YSDIE  +      S+   WLGI+DKYWA+  +P     F SQF Y 
Sbjct: 240 LGVFGEEGLDEVSYSDIEDDTRLRQPASSGGGWLGITDKYWATALVPEVGRDFESQFLYR 299

Query: 279 SDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGW 338
           ++G + YQ +F ++ ++I PG + +  N  FAGAKE   I+ YE+ L I +F  LIDWGW
Sbjct: 300 TNGRSHYQTEFVSDPVSIAPGAAASMVNRTFAGAKEVDKINAYEEQLNIRQFGQLIDWGW 359

Query: 339 FYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDE 398
           FYFI +PMF  + Y Y LVGNFGIAI+  TV +KL+FFPLA K Y S A MK IQPK+ E
Sbjct: 360 FYFITRPMFTALDYIYRLVGNFGIAILAVTVILKLIFFPLANKSYKSMARMKTIQPKVME 419

Query: 399 LREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF 458
           LRE+FK    Q  Q+ M+QLY++  INP AGCWPIL+QIPVFFA+YKV+ +++EMRHAPF
Sbjct: 420 LRERFKD-DRQKQQQEMMQLYRSEKINPAAGCWPILIQIPVFFALYKVLYVTIEMRHAPF 478

Query: 459 WGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAM 518
           +GWI+DLAA DPT+IF LFG+LP+ +PG + +G+WP++M L+MFIQM+++P P D  QAM
Sbjct: 479 FGWIQDLAAPDPTSIFNLFGLLPYDVPGILLIGVWPLLMGLTMFIQMRLNPTPPDPTQAM 538

Query: 519 ILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNY 578
           I  WMPVVF F L++FPAGL+IYW+W+N +SI+QQ+VIMK +GA+I L D LR  F +  
Sbjct: 539 IFTWMPVVFTFMLATFPAGLVIYWTWNNFLSIIQQSVIMKRNGAKIELFDNLRGMFKRKE 598

Query: 579 N 579
            
Sbjct: 599 K 599


>gi|90419893|ref|ZP_01227802.1| putative inner membrane protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335934|gb|EAS49682.1| putative inner membrane protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 609

 Score =  477 bits (1226), Expect = e-132,   Method: Composition-based stats.
 Identities = 264/607 (43%), Positives = 370/607 (60%), Gaps = 30/607 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQ-----------TVKQPNQV 49
           M+ N N+ +A+ LS+ ++  WQ   V PR+E    E +  Q           T + P   
Sbjct: 1   MQNNRNFLIAMILSIGVLVGWQFLVVSPRMEAQRLETEAAQPTVAQNDGSLQTPQTPAGT 60

Query: 50  DNSYAAVLI----------------DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLN 93
                A                   + R QA++   RV +  P+L GSINL GA+ DDL 
Sbjct: 61  PQDNVAAPAGRESVVPEQDALPATDETREQAIAAGSRVAIDTPALSGSINLTGARLDDLR 120

Query: 94  LRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPT 153
           L+ YH  V  +SP + LLSP    + YFAE  Y+      ELP  +T+W    G+ LTP 
Sbjct: 121 LKNYHETVDDSSPTIVLLSPERLPSGYFAEFGYLGRDAG-ELPGPSTIWQAEGGQSLTPN 179

Query: 154 TPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNT 213
           +P+ L   N   + FERTIS+D+ ++F   DT+ N     +  S  GR+ R+      + 
Sbjct: 180 SPVTLTATNGAGVTFERTISVDDRFMFTYEDTIRNEGSAPLTLSSYGRVTRYSKPEVASV 239

Query: 214 FGVQEGFIAVLGDKSLVEQKYSDIEKSS-ISNFHESNSWLGISDKYWASVFIPSKETSFH 272
           + + EG + V GD  L E KYS IE     +    S+ WLGI+DKYWA+  +P     F 
Sbjct: 240 YVLFEGLLGVFGDDGLSEIKYSTIEDDQRYTPPKSSSGWLGITDKYWATTLVPEAGRPFQ 299

Query: 273 SQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEM 332
           S+F Y++DG   YQ ++  + +T+ PG + T  +  FAGAK    I  YE+   I +F  
Sbjct: 300 SRFLYMTDGRPHYQTEYVTDPVTVEPGATATNVSRTFAGAKVVSDIDSYEERYDIRQFGQ 359

Query: 333 LIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNI 392
           LIDWGWFYFI +PMF  + + Y+++GNFG+AI+  TV +KL+FFPLA K Y S A MKN+
Sbjct: 360 LIDWGWFYFITRPMFHALDWLYSVIGNFGVAILAVTVVLKLIFFPLANKSYKSMARMKNM 419

Query: 393 QPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLE 452
           QPKI E+RE+FK    Q  Q+ M+++Y+   INP AGCWPIL+QIPVFFA+YKV+ +++E
Sbjct: 420 QPKIMEMRERFKDDK-QKQQQEMMRIYREEKINPAAGCWPILIQIPVFFALYKVLYVTIE 478

Query: 453 MRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPA 512
           MRHAPF+GWI+DLAA DPT+IF LFG++P  LP  + VG+WPI+M ++MF+QM+++P P 
Sbjct: 479 MRHAPFFGWIQDLAAPDPTSIFNLFGLIPLELPHLLMVGVWPILMGITMFVQMRLNPTPP 538

Query: 513 DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRS 572
           D  Q MI  WMPVVF F L+SFPAGL+IYW+W+N++S++QQ+VIMK +G +I L D LR 
Sbjct: 539 DPTQQMIFTWMPVVFTFMLASFPAGLVIYWTWNNLLSVIQQSVIMKRNGTKIELWDNLRG 598

Query: 573 TFSKNYN 579
            F +   
Sbjct: 599 MFRRKEK 605


>gi|239832645|ref|ZP_04680974.1| Inner membrane protein oxaA [Ochrobactrum intermedium LMG 3301]
 gi|239824912|gb|EEQ96480.1| Inner membrane protein oxaA [Ochrobactrum intermedium LMG 3301]
          Length = 624

 Score =  476 bits (1224), Expect = e-132,   Method: Composition-based stats.
 Identities = 270/607 (44%), Positives = 378/607 (62%), Gaps = 29/607 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQT----------------VK 44
           ME N N+F+ IALS++++  WQ FY+ P+ E    + +  +                   
Sbjct: 15  MENNRNFFITIALSILVLTLWQVFYLGPKSEAQREQARIEEQQQQKQQATQQQAQGSQNG 74

Query: 45  QPNQVDNSYAAVL----------IDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNL 94
              Q+  +   V              R  A++ + R+E+  PSL GSINL GA+ DD+ L
Sbjct: 75  DTPQMPAASGNVPGHSDVAAGGGTLTREAAVAQTQRIEIDTPSLRGSINLTGARLDDIFL 134

Query: 95  RGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTT 154
           + YH  V +NSP + LL+PS  +  YF EL +        +P  NTVW +     LT T 
Sbjct: 135 KNYHETVDNNSPNIELLAPSPLQQGYFVELGFTGNETTGPVPGPNTVWTVEGNNRLTQTA 194

Query: 155 PIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIM-RHKPQTATNT 213
           P+ L + N  NI F+R IS+DE Y+F + DT+ NNS   I  +  GR+   ++P+ A+ T
Sbjct: 195 PVTLTYTNEKNITFKRIISVDESYMFSVEDTIVNNSGAPISLASYGRVTRFNQPEHASAT 254

Query: 214 FGVQEGFIAVLGDKSLVEQKYSD-IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFH 272
           + + EG I V+G   L E KYS   +   IS       WLGI+DKYWA+  IP ++  F 
Sbjct: 255 YVLHEGLIGVMGQDGLQEIKYSKIEDNKDISFKDVQGGWLGITDKYWAATLIPPQDEKFT 314

Query: 273 SQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEM 332
            +F + ++   RYQA F    +TI PG++ T  N +FAGAK    I +YE+ L I +FE+
Sbjct: 315 GRFSHFTNDRPRYQADFLGAPMTIAPGQTQTVKNHVFAGAKVVSLIKNYEETLGIKQFEL 374

Query: 333 LIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNI 392
           LIDWGWFYFI KPMF L+ + Y   GNFG+AI++ TV +K LFFPLA K Y S A MK +
Sbjct: 375 LIDWGWFYFITKPMFYLIDWIYKFSGNFGVAILVVTVLLKGLFFPLANKSYKSMARMKLV 434

Query: 393 QPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLE 452
           QPK+ E+REK+        Q+ M++LYK   INPLAGCWP+L+QIPVFFA+YKV+ +++E
Sbjct: 435 QPKLTEIREKYADDK-MRQQQEMMKLYKEEKINPLAGCWPVLVQIPVFFALYKVLYVTIE 493

Query: 453 MRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPA 512
           MRHAPF+GWI+DLAA DPT++F LFG+LPF +P F+ +G+WP++M ++MF+QM+M+P P 
Sbjct: 494 MRHAPFFGWIQDLAAPDPTSLFNLFGLLPFAVPHFLMIGVWPLLMGITMFLQMRMNPTPP 553

Query: 513 DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRS 572
           D  QA I  WMPV+F F L+SFPAGL+IYW+W+N++SI QQ +IMK  G +I L D L+S
Sbjct: 554 DPTQAAIFTWMPVIFTFMLASFPAGLVIYWAWNNLLSITQQGIIMKRQGVKIELFDNLKS 613

Query: 573 TFSKNYN 579
            F +   
Sbjct: 614 LFKRKPK 620


>gi|85717142|ref|ZP_01048101.1| putative inner membrane protein translocase component YidC
           [Nitrobacter sp. Nb-311A]
 gi|85696033|gb|EAQ33932.1| putative inner membrane protein translocase component YidC
           [Nitrobacter sp. Nb-311A]
          Length = 614

 Score =  476 bits (1224), Expect = e-132,   Method: Composition-based stats.
 Identities = 240/606 (39%), Positives = 361/606 (59%), Gaps = 29/606 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNI-----------QTVKQPNQV 49
           M  N N  +AI LS +++ AWQ FY  P++E+    ++             +        
Sbjct: 1   MSENRNTIIAIVLSALVLIAWQYFYNIPQMEKDRAAQQAQSELAKSQKESSEAAPNSPTP 60

Query: 50  DNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVT 109
               A   +  R  A++  PRV++  P L GS++L GA+ DDL L  Y   V   SP + 
Sbjct: 61  GQPAAKSAVVARDVAIASKPRVKIHTPRLSGSLSLTGARIDDLLLTKYRETVDPASPAIE 120

Query: 110 LLSPSNTKNAYFAELDYVS-TANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILF 168
           L SPS T N Y+AE  +V  T + + +P+ +T W       LT +TP+ L + N   + F
Sbjct: 121 LFSPSGTANPYYAEFGWVPATGSTVRVPDRDTPWQQEGSGALTESTPVTLKYDNGEGLTF 180

Query: 169 ERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKS 228
            RTIS+D+ YLF I D V+N     +   P   I RH     +  + + EG I  LGD+ 
Sbjct: 181 RRTISVDDQYLFTIKDEVSNTGSAPVTLYPFALISRHGTPQVSGYYILHEGLIGYLGDQK 240

Query: 229 LVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR-YQA 287
           L E  Y  I+++   +F  +N WLGI+DKYWA+  +P       ++F     G  + YQ 
Sbjct: 241 LQEYSYKKIDEAKSVSFDVTNGWLGITDKYWAAALLPDTSARLQARFSSDQAGSVKTYQT 300

Query: 288 KFSANEITILPGKSITTTNFLFAGAKEFPT---------IHHYEKDLAIPRFEMLIDWGW 338
            +  +  TI  G + + +  LFAGAKE            +  Y K L +  F++LIDWGW
Sbjct: 301 DYLEDARTIPAGGTGSLSTRLFAGAKEAGVVGLNFPLVELGGYNKQLGLNHFDLLIDWGW 360

Query: 339 FYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDE 398
           FYFI KPMF+ + +F+++ GNFG+AI++ TV +KL+FFPLA + Y S A MK +QP+I  
Sbjct: 361 FYFITKPMFLALDFFFHVFGNFGVAILVVTVLIKLVFFPLANRSYASMAKMKAVQPQITA 420

Query: 399 LREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF 458
           L+E++     + LQ+ M+++YK   INP++GC P+LLQIPVFF++YKV+ +++EMRHAPF
Sbjct: 421 LKEQYPDDRMK-LQQEMMEIYKKEKINPISGCLPMLLQIPVFFSLYKVLFVTIEMRHAPF 479

Query: 459 WGWIKDLAAADPTNIFTLFGILPFYLPG------FMHVGIWPIIMSLSMFIQMKMSPPPA 512
           + WIKDL+A DPT+IF LFG+LP+          ++ +G WPIIM ++M+ QMK++P P 
Sbjct: 480 FAWIKDLSAPDPTHIFNLFGLLPYDPSVVPLLGPYLAIGAWPIIMGITMWFQMKLNPTPP 539

Query: 513 DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRS 572
           D  Q +I +WMPV+F F L++FPAGL+IYW+W+N +S++QQ+ IM+ +G ++ L D ++S
Sbjct: 540 DPTQKIIFDWMPVIFTFMLAAFPAGLVIYWAWNNTLSVIQQSYIMRRNGVKVELFDNVKS 599

Query: 573 TFSKNY 578
           TF +  
Sbjct: 600 TFRRKP 605


>gi|307301342|ref|ZP_07581104.1| YidC/Oxa1 family domain containing membrane protein insertase
           [Sinorhizobium meliloti BL225C]
 gi|307318012|ref|ZP_07597449.1| YidC/Oxa1 family domain containing membrane protein insertase
           [Sinorhizobium meliloti AK83]
 gi|38503127|sp|Q92SF5|OXAA_RHIME RecName: Full=Inner membrane protein oxaA
 gi|306896414|gb|EFN27163.1| YidC/Oxa1 family domain containing membrane protein insertase
           [Sinorhizobium meliloti AK83]
 gi|306903798|gb|EFN34385.1| YidC/Oxa1 family domain containing membrane protein insertase
           [Sinorhizobium meliloti BL225C]
          Length = 594

 Score =  476 bits (1223), Expect = e-132,   Method: Composition-based stats.
 Identities = 289/592 (48%), Positives = 392/592 (66%), Gaps = 14/592 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMN------------NERKNIQTVKQPNQ 48
           ME N NYFVAIALSV+I+ AWQ FYV P++E+               ++   Q       
Sbjct: 1   MENNRNYFVAIALSVLILIAWQFFYVSPKMEKDRIAAEQAQQAQQTQQQPGAQPAAPGQA 60

Query: 49  VDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIV 108
           +         + R QA+  S RV +  P+L GSINL GA+FDDL L+GY   V   SP++
Sbjct: 61  LPGGAIPSAGESRDQAIGKSARVAIDTPALSGSINLTGARFDDLKLKGYRETVDPKSPVI 120

Query: 109 TLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILF 168
           TL SP+ T + YF E+ Y+ +     +P   T W L  G  LTP+TP+ L + N   I F
Sbjct: 121 TLFSPAETADGYFTEIGYIGSDATGSVPGPQTTWTLSGGDKLTPSTPVTLSYTNDKGITF 180

Query: 169 ERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKS 228
            RTIS+D+ Y+F++VD++ N +   +  S  GR+ R    T  + + + EGF+ V G+  
Sbjct: 181 ARTISVDDRYMFQVVDSIKNETAAPVSLSSYGRVTRFNKPTTPSIYVLHEGFVGVAGEHG 240

Query: 229 LVEQKYSDIEKSSISNFHESNS-WLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA 287
           L E  YS +E        +S   WLGI+DKYWA+  +P + T F  +F + +DG  RYQ+
Sbjct: 241 LQEVGYSKVEDDEPVEPGKSTGGWLGITDKYWAATIVPPQATPFDIRFSHFADGRPRYQS 300

Query: 288 KFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMF 347
            + ++ +T+ PG+S+   N +FAGAKE P + +YE   +IP F+ LIDWGWFYFI KPMF
Sbjct: 301 DYKSDAVTVAPGQSVELKNLVFAGAKEVPVVDNYEVAYSIPNFDKLIDWGWFYFITKPMF 360

Query: 348 MLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSP 407
            +M +F+ L GNFGIAI++TT+ VKL+FFPLA KQY S ANMK +QPK++EL++KF    
Sbjct: 361 KMMDFFFRLFGNFGIAILITTIVVKLIFFPLANKQYASMANMKKVQPKMEELKKKFGD-D 419

Query: 408 PQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAA 467
              LQ+AM+QLYK   INPLAGCWPIL+QIPVFFA+YKVI +++EMRHAPF+GWI+DL+A
Sbjct: 420 RMGLQQAMMQLYKEEKINPLAGCWPILIQIPVFFALYKVIYVTIEMRHAPFFGWIQDLSA 479

Query: 468 ADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVF 527
            DPT I  LFG+LPF  P F+H+GIWPIIM ++MF+QM+M+P P D  QAM+  WMPVVF
Sbjct: 480 PDPTTIINLFGLLPFEGPAFLHLGIWPIIMGVTMFLQMRMNPTPPDPTQAMLFTWMPVVF 539

Query: 528 VFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYN 579
            F L+SFPAGL+IYW+W+N +SI+QQ +IMK  G ++ L D L+S FSK   
Sbjct: 540 TFMLASFPAGLVIYWAWNNTLSILQQGIIMKRQGVKVELFDNLKSLFSKKPK 591


>gi|298290371|ref|YP_003692310.1| membrane protein insertase, YidC/Oxa1 family domain containing
           protein [Starkeya novella DSM 506]
 gi|296926882|gb|ADH87691.1| membrane protein insertase, YidC/Oxa1 family domain containing
           protein [Starkeya novella DSM 506]
          Length = 609

 Score =  475 bits (1222), Expect = e-132,   Method: Composition-based stats.
 Identities = 242/605 (40%), Positives = 361/605 (59%), Gaps = 27/605 (4%)

Query: 3   RNWNYFVAIALSVIIVYAWQNFYVYPRIEE------------------MNNERKNIQTVK 44
            N N  +AI LS+ ++ AWQ F   P++E+                   + E        
Sbjct: 4   ENRNMIIAIVLSMAVLIAWQYFSGIPQMEQQRQQHAAQQQAAQQQAAQPSGEAGTAAPAP 63

Query: 45  QPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
             +    +  A     RA+AL+ SPR  +  P +IGS+ LKG + DDL+L+ Y   V  N
Sbjct: 64  GTSAPAPAGTAPKALTRAEALARSPRAVIDTPRVIGSVALKGGRIDDLSLKDYRETVDPN 123

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWNLISGKILTPTTPIKLVFKNA 163
           SPI+ LLSPS   N ++AE  +V  A  ++++PN+ T+W    G  LT   P+ L + N 
Sbjct: 124 SPIIVLLSPSGGPNPFYAEFGWVPGAGASVQVPNAETLWTAPEGAKLTHEAPLVLSWDNG 183

Query: 164 NNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAV 223
             ++F RT+S+D +Y+F +VD V N +   +   P G + RH        + + EG I V
Sbjct: 184 AGLIFRRTLSIDANYMFHVVDEVENTTAAPVALHPYGLVSRHGTPHVLGYYILHEGLIGV 243

Query: 224 LGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
             +  L E KY DI +     F     WLGI+DKYWA+  IP  +    ++F     G+ 
Sbjct: 244 TSEAGLHEIKYKDIAERKTETFPSVGGWLGITDKYWAATVIPGIQEKVQARFSAAQAGND 303

Query: 284 -RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFI 342
             YQ  F  + +++ PG   +T   LFAGAKE   +  Y+    I RF++LIDWGWFYFI
Sbjct: 304 FSYQTDFLGDAVSVAPGAKASTEGRLFAGAKEVRVVDGYQSTYNIDRFDLLIDWGWFYFI 363

Query: 343 AKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREK 402
            KP+F+++ + Y  VGNFG+AI++ TV +K++FFPLA K Y S A MK +QP+I  LRE+
Sbjct: 364 TKPLFLVIDWIYKGVGNFGVAILIVTVMLKIVFFPLANKSYASMAKMKAVQPEITALRER 423

Query: 403 FKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWI 462
           +     + LQ+ M+++YK   INP+AGC PI++QIPVFFA+YKV+ +++EMRHAPF+GWI
Sbjct: 424 YGDDRVK-LQQEMMEIYKKEKINPVAGCLPIVIQIPVFFALYKVLFVTIEMRHAPFFGWI 482

Query: 463 KDLAAADPTNIFTLFGILPFYLPG------FMHVGIWPIIMSLSMFIQMKMSPPPADKGQ 516
           KDL+A DPT IF LFG++P+          F+ +G+WPIIM ++M+ QMK++P P D  Q
Sbjct: 483 KDLSAPDPTTIFNLFGLIPWDPGQVPVIGHFLLLGVWPIIMGITMWAQMKLNPAPPDPTQ 542

Query: 517 AMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSK 576
             I +WMP++F F L SF +GL+IYW+W+N +S++QQ++IM+ +G +I L D ++  F +
Sbjct: 543 KAIFDWMPLIFTFMLGSFASGLVIYWAWNNTLSVIQQSIIMRRNGVKIELWDNVKELFGR 602

Query: 577 NYNSQ 581
               +
Sbjct: 603 KKKPK 607


>gi|170749903|ref|YP_001756163.1| 60 kDa inner membrane insertion protein [Methylobacterium
           radiotolerans JCM 2831]
 gi|254773004|sp|B1LTW1|OXAA_METRJ RecName: Full=Inner membrane protein oxaA
 gi|170656425|gb|ACB25480.1| 60 kDa inner membrane insertion protein [Methylobacterium
           radiotolerans JCM 2831]
          Length = 617

 Score =  475 bits (1222), Expect = e-132,   Method: Composition-based stats.
 Identities = 254/612 (41%), Positives = 365/612 (59%), Gaps = 35/612 (5%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNN-ERKNIQTVKQPNQVDNSYAAVLID- 59
               N FVAI LS++++  WQ F   PR+E+    E +N    +QP  V           
Sbjct: 3   NDKTNMFVAIGLSLLVLLGWQYFVAGPRMEQQRQIEAQNKAAQQQPPGVTPDGVPSPSPK 62

Query: 60  --------------------DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHL 99
                                R  AL+ SPRV ++ P+L GSI LKG + DD++L+ YH 
Sbjct: 63  EGGPAAPAPGTLPTAQGGPVSREAALARSPRVRIETPALSGSIALKGGRVDDVSLKNYHE 122

Query: 100 DVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLV 159
            +   SP + L SP+ T+  Y+AE  +V       LP ++T+W    GK L+P  P+ L 
Sbjct: 123 TIDPKSPEIVLFSPAGTETPYYAEFGWVGANAGP-LPTNDTLWT-SDGKTLSPGMPVTLT 180

Query: 160 FKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEG 219
           + N   ++F+R I++D+ Y+F I D V N     I   P   + R         + + EG
Sbjct: 181 WDNGAGLVFKRIIAVDDKYMFTIRDEVENKGSGAITLYPYSLVSRWGKPHTQGYYVLHEG 240

Query: 220 FIAVLGDKSLVEQKYSD---------IEKSSISNFHESNSWLGISDKYWASVFIPSKETS 270
            I  LG+  L E  Y                 +    +  ++GI+DKYWA+  IP ++T 
Sbjct: 241 MIGYLGNDGLQEFTYDKLAKEGAYGGANTKGKAWTGVTGGFVGITDKYWAAAAIPDQDTP 300

Query: 271 FHSQFKYLSDG-HARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPR 329
           +   F   +DG    YQA    + + +  G S T T  LFAGAKE   I++YEKDL I  
Sbjct: 301 YTGAFTDRTDGATNVYQASVRGDAVNLAAGASATATQRLFAGAKEVNVINNYEKDLGIKH 360

Query: 330 FEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANM 389
           F+++IDWGWF+FI KPMF  + +FY+L GNFG++I++ T  +KLLF P+A + YVS A M
Sbjct: 361 FDLMIDWGWFFFITKPMFRALDFFYHLFGNFGVSILVVTFCLKLLFLPIANRSYVSMAKM 420

Query: 390 KNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISI 449
           K +QP++  +RE++K    +  Q+A ++LYK   INP+AGCWP+L+QIPVFFA+YKV+ I
Sbjct: 421 KAVQPEMAAIRERYKDDRMK-QQQATMELYKKEKINPVAGCWPVLIQIPVFFALYKVLFI 479

Query: 450 SLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSP 509
           ++EMRHAPF+GWI+DLAA DPT+I  LFG+LPF  P F+H+G+WPIIM ++MF+QMKM+P
Sbjct: 480 TIEMRHAPFFGWIRDLAAPDPTSIVNLFGLLPFPAPDFVHLGVWPIIMGITMFVQMKMNP 539

Query: 510 PPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDR 569
            P D  QA I  +MP+VF F L SFPAGL+IYW+W+N +S++QQ VIM+ +G ++ L D 
Sbjct: 540 APPDPVQAQIFTFMPIVFTFMLGSFPAGLVIYWAWNNTLSVIQQYVIMRRNGVKVELWDN 599

Query: 570 LRSTFSKNYNSQ 581
           LRSTF +   ++
Sbjct: 600 LRSTFRRGNGTK 611


>gi|327192535|gb|EGE59487.1| inner membrane transmembrane protein [Rhizobium etli CNPAF512]
          Length = 597

 Score =  474 bits (1220), Expect = e-131,   Method: Composition-based stats.
 Identities = 291/593 (49%), Positives = 390/593 (65%), Gaps = 17/593 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNN----------------ERKNIQTVK 44
           ME N NYF+AIALSV+IV  WQ  Y+ PRIE                          T  
Sbjct: 1   MENNRNYFIAIALSVLIVLGWQFLYMNPRIEAQRKAQEAQKAQQQTEQVQQPAAGGATPA 60

Query: 45  QPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
             +    S  AV      QAL+ +PRV +  P+L GSINL GA+ DDL L+GYH  V  +
Sbjct: 61  PTSGTAPSGQAVATATLEQALAKTPRVAIDTPALSGSINLAGARLDDLKLKGYHETVDDS 120

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           SPI+TL SP+ TK+ YF EL Y+ +     +P ++T+W    G  LT  TP+ L + N  
Sbjct: 121 SPIITLFSPAETKDGYFTELGYIGSDATGSVPGASTLWTAPEGAKLTEKTPVTLSYTNDK 180

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVL 224
            + F RTIS+DE Y+F I D V N     +  S  GR+ R+   T  + + + EGFI V+
Sbjct: 181 GLTFTRTISVDERYMFTIADKVANTGQAPVSLSSYGRVTRYNKPTTPSAYVLHEGFIGVI 240

Query: 225 GDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR 284
           GD  L+E KY+ +EK ++     +  WLGI+DKYWA+  +P + +++ ++F + +DG  R
Sbjct: 241 GDDGLIESKYTAVEKEAVMPAKSTGGWLGITDKYWAATIVPPQASAYEARFSHFADGQPR 300

Query: 285 YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAK 344
           YQA +  +  TI PG+SI   N +FAGAKE P I  YE   +IPRF+ LIDWGWFYFI K
Sbjct: 301 YQADYKDDAFTIAPGQSIELKNLVFAGAKEVPVIDGYEASYSIPRFDRLIDWGWFYFITK 360

Query: 345 PMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK 404
           PMF LM +F+   GNFG+AI+ TT+ VK LFFPLA KQY S ANMK +QPK++EL+ KF 
Sbjct: 361 PMFKLMDFFFRFFGNFGVAILCTTIVVKALFFPLASKQYASMANMKRMQPKMEELKAKFG 420

Query: 405 QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKD 464
                 LQ+A +QLYK   INP+AGCWP+ LQIP+FF++YKVI I++EMRHAPF+GWI+D
Sbjct: 421 D-DRMGLQQATMQLYKEEKINPIAGCWPVALQIPIFFSLYKVIYITIEMRHAPFFGWIQD 479

Query: 465 LAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMP 524
           L+A DPT I  LFG+LPF  P F+H+G+WP+IM ++MF+QM+M+P P D  QAMI NWMP
Sbjct: 480 LSAPDPTTIVNLFGLLPFTAPTFLHLGVWPLIMGVTMFLQMRMNPTPPDPTQAMIFNWMP 539

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           +VF+F L+SFPAGL+IYW+W+N +S++QQ+VIMK HG +I L D L+  F + 
Sbjct: 540 LVFMFMLASFPAGLVIYWAWNNTLSVIQQSVIMKRHGVKIELFDNLKGLFRRK 592


>gi|15964197|ref|NP_384550.1| putative inner membrane protein translocase component YidC
           [Sinorhizobium meliloti 1021]
 gi|15073373|emb|CAC41881.1| Putative inner-membrane transmembrane protein [Sinorhizobium
           meliloti 1021]
          Length = 595

 Score =  474 bits (1219), Expect = e-131,   Method: Composition-based stats.
 Identities = 289/592 (48%), Positives = 392/592 (66%), Gaps = 14/592 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMN------------NERKNIQTVKQPNQ 48
           ME N NYFVAIALSV+I+ AWQ FYV P++E+               ++   Q       
Sbjct: 2   MENNRNYFVAIALSVLILIAWQFFYVSPKMEKDRIAAEQAQQAQQTQQQPGAQPAAPGQA 61

Query: 49  VDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIV 108
           +         + R QA+  S RV +  P+L GSINL GA+FDDL L+GY   V   SP++
Sbjct: 62  LPGGAIPSAGESRDQAIGKSARVAIDTPALSGSINLTGARFDDLKLKGYRETVDPKSPVI 121

Query: 109 TLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILF 168
           TL SP+ T + YF E+ Y+ +     +P   T W L  G  LTP+TP+ L + N   I F
Sbjct: 122 TLFSPAETADGYFTEIGYIGSDATGSVPGPQTTWTLSGGDKLTPSTPVTLSYTNDKGITF 181

Query: 169 ERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKS 228
            RTIS+D+ Y+F++VD++ N +   +  S  GR+ R    T  + + + EGF+ V G+  
Sbjct: 182 ARTISVDDRYMFQVVDSIKNETAAPVSLSSYGRVTRFNKPTTPSIYVLHEGFVGVAGEHG 241

Query: 229 LVEQKYSDIEKSSISNFHESNS-WLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA 287
           L E  YS +E        +S   WLGI+DKYWA+  +P + T F  +F + +DG  RYQ+
Sbjct: 242 LQEVGYSKVEDDEPVEPGKSTGGWLGITDKYWAATIVPPQATPFDIRFSHFADGRPRYQS 301

Query: 288 KFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMF 347
            + ++ +T+ PG+S+   N +FAGAKE P + +YE   +IP F+ LIDWGWFYFI KPMF
Sbjct: 302 DYKSDAVTVAPGQSVELKNLVFAGAKEVPVVDNYEVAYSIPNFDKLIDWGWFYFITKPMF 361

Query: 348 MLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSP 407
            +M +F+ L GNFGIAI++TT+ VKL+FFPLA KQY S ANMK +QPK++EL++KF    
Sbjct: 362 KMMDFFFRLFGNFGIAILITTIVVKLIFFPLANKQYASMANMKKVQPKMEELKKKFGD-D 420

Query: 408 PQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAA 467
              LQ+AM+QLYK   INPLAGCWPIL+QIPVFFA+YKVI +++EMRHAPF+GWI+DL+A
Sbjct: 421 RMGLQQAMMQLYKEEKINPLAGCWPILIQIPVFFALYKVIYVTIEMRHAPFFGWIQDLSA 480

Query: 468 ADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVF 527
            DPT I  LFG+LPF  P F+H+GIWPIIM ++MF+QM+M+P P D  QAM+  WMPVVF
Sbjct: 481 PDPTTIINLFGLLPFEGPAFLHLGIWPIIMGVTMFLQMRMNPTPPDPTQAMLFTWMPVVF 540

Query: 528 VFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYN 579
            F L+SFPAGL+IYW+W+N +SI+QQ +IMK  G ++ L D L+S FSK   
Sbjct: 541 TFMLASFPAGLVIYWAWNNTLSILQQGIIMKRQGVKVELFDNLKSLFSKKPK 592


>gi|222084728|ref|YP_002543257.1| preprotein translocase 60 kD membrane subunit [Agrobacterium
           radiobacter K84]
 gi|221722176|gb|ACM25332.1| preprotein translocase 60 kD membrane subunit [Agrobacterium
           radiobacter K84]
          Length = 600

 Score =  473 bits (1216), Expect = e-131,   Method: Composition-based stats.
 Identities = 285/598 (47%), Positives = 393/598 (65%), Gaps = 20/598 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMN-------------------NERKNIQ 41
           ME   NYF+AIALSV+IV AWQ FY+ PR+E                      N      
Sbjct: 1   MENKRNYFIAIALSVLIVLAWQFFYMNPRLEAQRKAEQAAKLQQQTQQAQTTQNPAAGAT 60

Query: 42  TVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDV 101
                     S    L  D++ A S + RV +  P+L GSINL+GA+FDDL L+ YH  V
Sbjct: 61  VDGAAPSSGQSAPTTLTHDQSVAKSAASRVAIDTPALSGSINLEGARFDDLQLKAYHETV 120

Query: 102 SSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFK 161
             +SPI+TL SP++TK+ YF EL YV +     +P  +TVW L SG  LT +TP+ L + 
Sbjct: 121 DKSSPIITLFSPADTKDGYFTELGYVGSDATGAVPGPSTVWTLASGSKLTDSTPVTLSYT 180

Query: 162 NANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFI 221
           N   I F RT+S+DE Y+F I D + N+    +  S  GR+ R+   T  + + + EGFI
Sbjct: 181 NDKGITFTRTVSVDERYMFTITDKIANSGQAPVSLSSYGRVTRYNKPTTPSAYVLHEGFI 240

Query: 222 AVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDG 281
            V+GD  L+E KY+  EK +++    +  WLGI+DKYWA+  +P +  ++ + F + +DG
Sbjct: 241 GVIGDDGLIETKYTAAEKEAVNPAKATGGWLGITDKYWAATIVPPQSGAYDAHFSHFADG 300

Query: 282 HARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYF 341
             RYQA +  + +T+ PG+S    + +FAGAKE P I  YE   +IP+F+ LIDWGWFYF
Sbjct: 301 QPRYQADYKQDAVTVAPGQSQELKSLVFAGAKEVPVIDRYETSYSIPKFDRLIDWGWFYF 360

Query: 342 IAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELRE 401
           I KPMF LM +F+   GNFG+AI+ TT+ VK LFFPLA KQY S ANMK +QPK++EL+ 
Sbjct: 361 ITKPMFKLMDFFFRYFGNFGVAILCTTIVVKGLFFPLASKQYASMANMKRMQPKMEELKA 420

Query: 402 KFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGW 461
           KF       LQ+A +QLYK   INP+AGCWP+LLQIP+FF++YKVI I++EMRHAPF+GW
Sbjct: 421 KFGD-DRMGLQQATMQLYKEEKINPIAGCWPVLLQIPIFFSLYKVIYITIEMRHAPFFGW 479

Query: 462 IKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILN 521
           I+DL+A DPT+I  LFG+LPF  P  +H+G+WP+IM ++MF+QM+M+P P D  QAMI N
Sbjct: 480 IQDLSAPDPTSIVNLFGLLPFTAPTILHLGVWPLIMGITMFLQMRMNPTPPDPTQAMIFN 539

Query: 522 WMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYN 579
           WMP+VF+F L+SFPAGL+IYW+W+N +S++QQ++IMK HG ++ L D ++  F +   
Sbjct: 540 WMPLVFMFMLASFPAGLVIYWAWNNTLSVIQQSIIMKRHGVKVELFDNMKGLFKRKPA 597


>gi|163757863|ref|ZP_02164952.1| putative inner membrane protein translocase component YidC [Hoeflea
           phototrophica DFL-43]
 gi|162285365|gb|EDQ35647.1| putative inner membrane protein translocase component YidC [Hoeflea
           phototrophica DFL-43]
          Length = 605

 Score =  473 bits (1216), Expect = e-131,   Method: Composition-based stats.
 Identities = 268/604 (44%), Positives = 379/604 (62%), Gaps = 26/604 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIE------------------------EMNNE 36
           ME N NYFVAI LSV+++  WQ  YV P+IE                             
Sbjct: 1   METNRNYFVAILLSVLVLIGWQYLYVSPKIEREREAAQALQAEQAATQPGATGAGTTTPG 60

Query: 37  RKNIQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRG 96
             +         +    A      R  AL+ S R+ +  P+L GSINL GA+ DDL L  
Sbjct: 61  AVSGSAPGGETAMPGVVAPETGLSREDALAQSERIAIDTPALSGSINLTGARIDDLLLSE 120

Query: 97  YHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPI 156
           Y   +   SP + L SP+   + YFAE+ +++ A++   P  +TVW+   G+ LT  +P+
Sbjct: 121 YRETIDPESPNIRLFSPAQQADGYFAEVGFIADADSGPAPGPDTVWSAAPGQTLTQGSPV 180

Query: 157 KLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGV 216
            L + N   +LF R IS+D+H+LF+  DT++N+S      +  GR+ R         + +
Sbjct: 181 TLTYDNGAGLLFTRKISVDDHFLFQFEDTISNSSSQTASVAGYGRVTRFFRPQTAGIYVL 240

Query: 217 QEGFIAVLGDKSLVEQKYSDIEKSSI-SNFHESNSWLGISDKYWASVFIPSKETSFHSQF 275
            EG I V+G++ L E  YSD+E++ I +    +  W+GI+DKYWA+  +P +   F ++F
Sbjct: 241 HEGLIGVIGEEGLQEIDYSDVEETPILAQPKATAGWMGITDKYWAAALVPPQGAGFDTRF 300

Query: 276 KYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLID 335
            + +DG ARYQA F  +   I  G S+T+T  +FAGAKE P I  YE    I  F+++ID
Sbjct: 301 AHFTDGRARYQADFRTDAQAIAAGGSVTSTTLVFAGAKEVPIIEGYESQFNILNFDLMID 360

Query: 336 WGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPK 395
           WGWFYFI KPMF ++ + + L+GNFG+AI+ TTV VKL+FFPLA K YVS ANMK +QPK
Sbjct: 361 WGWFYFITKPMFWMIDFLFKLLGNFGLAILATTVIVKLIFFPLANKSYVSMANMKKVQPK 420

Query: 396 IDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRH 455
           ++EL+ K        LQ+ M++LYK   INP+AGCWP+LLQIPVFFA+YKV+ +++EMRH
Sbjct: 421 LEELKAKHGD-DRMALQQGMMELYKKEKINPVAGCWPVLLQIPVFFALYKVLYVTIEMRH 479

Query: 456 APFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKG 515
           APF+GWI+DL+A DPT++F LFG+LP+ +PGF+ +G+WP+IM ++MF+QM+M+P P D  
Sbjct: 480 APFFGWIQDLSAPDPTSLFNLFGLLPYDVPGFLLIGVWPLIMGITMFLQMRMNPTPPDPT 539

Query: 516 QAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFS 575
           QAMI  WMPVVF F L++FPAGL+IYW+W+N +SI+QQ  IMK  GA+I L D L + F 
Sbjct: 540 QAMIFTWMPVVFTFMLATFPAGLVIYWAWNNTLSILQQGFIMKRQGAKIELWDNLMALFK 599

Query: 576 KNYN 579
               
Sbjct: 600 PKDK 603


>gi|188581560|ref|YP_001925005.1| 60 kDa inner membrane insertion protein [Methylobacterium populi
           BJ001]
 gi|254773003|sp|B1Z8E7|OXAA_METPB RecName: Full=Inner membrane protein oxaA
 gi|179345058|gb|ACB80470.1| 60 kDa inner membrane insertion protein [Methylobacterium populi
           BJ001]
          Length = 614

 Score =  472 bits (1215), Expect = e-131,   Method: Composition-based stats.
 Identities = 250/610 (40%), Positives = 363/610 (59%), Gaps = 34/610 (5%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNE-RKNIQTVKQPNQVDNSYAAVL--- 57
               N FVAIALS++++  W  F   P  E      +        P   D   +      
Sbjct: 3   NDKTNMFVAIALSLVVLLGWHYFVTGPASERQRQAVQSQTAQNTAPQSADGIPSPSPREG 62

Query: 58  -----------------IDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLD 100
                               R  AL+ S RV +  P+L GSI LKGA+ DD++L+ YH  
Sbjct: 63  SPNAPVPGTVPGAAAQGPISREDALARSARVRIDTPALYGSIGLKGARIDDVSLKNYHET 122

Query: 101 VSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVF 160
           VS  SP + LLSP+ + N Y+AE  +V       LPN +T+W    G +L P  P+ L +
Sbjct: 123 VSDESPRIVLLSPAGSANPYYAEFGWVGANAGP-LPNGDTLWK-ADGDLLAPGKPLTLTW 180

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGF 220
            N   +LF+R +++D+ ++F + D V N+S + +   P   + R         + + EG 
Sbjct: 181 DNGQGLLFKRIVAVDDKFMFTVRDEVENSSANPVTLYPYSLVSRWGKPQTQGYYVLHEGL 240

Query: 221 IAVLGDKSLVEQKYSDIEKSS---------ISNFHESNSWLGISDKYWASVFIPSKETSF 271
           I VLG   L E  Y  + K            +  + +  W+GI+DKYWA+  IP ++  F
Sbjct: 241 IGVLGSDGLQEYTYDKVGKEPAYGGAATQGKAWSNVTGGWVGITDKYWAAAAIPDQDKPF 300

Query: 272 HSQFKYLSDGHAR-YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRF 330
              F   +DG  + YQ     + +T+ P  S  TT  LFAGAKE   I+ YE+DL I +F
Sbjct: 301 TGAFTERTDGATKIYQTSVRGDAVTVAPSASSATTQRLFAGAKEVNQINAYERDLGIKQF 360

Query: 331 EMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMK 390
           +++IDWGWF+F+ KPMF  + +FY+L+GNFG++I+L T+ +K+ F P+A + YVS A MK
Sbjct: 361 DLMIDWGWFWFLTKPMFRALDFFYHLLGNFGVSILLVTLILKIFFLPIANRSYVSMAKMK 420

Query: 391 NIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISIS 450
            +QP++  +RE++K    +  Q+AM++LYK   INP+AGCWP+L+QIPVFFA+YKV+ I+
Sbjct: 421 AVQPEMTSIRERYKDDRTK-QQQAMMELYKKEKINPVAGCWPVLIQIPVFFALYKVLFIT 479

Query: 451 LEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPP 510
           +EMRHAPF+GWI DLAA DPT+I  LFG+LPF  P F+H+G+WPIIM ++MFIQMKM+P 
Sbjct: 480 IEMRHAPFFGWIHDLAAPDPTSIMNLFGLLPFAAPDFIHLGVWPIIMGITMFIQMKMNPA 539

Query: 511 PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL 570
           P D  QA +  +MP+VF F L SFPAGL+IYW+W+N +S++QQ +IM+ +G ++ L D L
Sbjct: 540 PPDPVQAQVFAFMPIVFTFMLGSFPAGLVIYWAWNNTLSVIQQYIIMRRNGVKVELWDNL 599

Query: 571 RSTFSKNYNS 580
           R  F +   S
Sbjct: 600 RGMFKRGNKS 609


>gi|126734531|ref|ZP_01750277.1| inner membrane protein oxaA, putative [Roseobacter sp. CCS2]
 gi|126715086|gb|EBA11951.1| inner membrane protein oxaA, putative [Roseobacter sp. CCS2]
          Length = 607

 Score =  472 bits (1213), Expect = e-131,   Method: Composition-based stats.
 Identities = 206/595 (34%), Positives = 326/595 (54%), Gaps = 21/595 (3%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYP--RIEEMNNERKNIQTVKQPNQVDNSYAAVLID 59
           ++N N  +A  LS  ++ AW   +      ++      + +     P     + AA    
Sbjct: 3   DQNKNLILATVLSFAVIVAWTTLFPPEDLPVDPATETAQTLDDPTLPAADPVNPAATTPT 62

Query: 60  DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNA 119
           +  +  + +PRV ++     GSI+L+G + DDL L  Y   +  ++ +V LL P     A
Sbjct: 63  EAPEPAADAPRVAIETGEFSGSISLQGGRIDDLALTNYRETIDEDAEVVRLLKPVGEPGA 122

Query: 120 YFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEH 177
           YFA   + +T       +P  +T+W L SG  LTP +P+ L + N    +F   I++D+ 
Sbjct: 123 YFASFGWTATDGIDASAVPGPDTIWALESGDTLTPNSPVTLSWDNGAGQIFRTEIAVDDA 182

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           ++F    +V N +   I   P G + RH        F +    +  + D  L E  Y DI
Sbjct: 183 FMFTFAQSVENATSTAISARPYGLLRRHGEPDDLKNFFILHEGMVRMTDGELEETGYDDI 242

Query: 238 EKSSISNFHESN---------SWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAK 288
            + ++     +           W+G +D YW +  IP +   F S  KY  D    YQA+
Sbjct: 243 TEYAVDPRERTQAERLDVSESGWIGYTDHYWMTTLIPEQGVPFRSTSKYF-DVRDLYQAE 301

Query: 289 FSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFM 348
                 T+  G++ T T  LFAGAKE+  I +YE +  +  F   IDWGWF+F+ KP+F 
Sbjct: 302 AVMPIETVAAGETATVTTRLFAGAKEWEAIRNYENEGGVGGFLDSIDWGWFFFLTKPIFA 361

Query: 349 LMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPP 408
           L+ Y    +GN G +I+  TV +K++  PLA K YVS A MK +QP++++L+E+      
Sbjct: 362 LLHYLNIFIGNMGWSILALTVILKIIVLPLAYKSYVSMAKMKELQPEMEKLKERTGDDK- 420

Query: 409 QVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAA 468
           Q +Q+ M++LYK + +NP AGC PILLQIP+FF++YKVI +++E+RHAP+ GWI+DL+A 
Sbjct: 421 QAMQQGMMKLYKDNKVNPAAGCLPILLQIPIFFSLYKVIFVTIELRHAPWIGWIRDLSAP 480

Query: 469 DPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNW 522
           DP++   LFG+LP+  P        + +GI PI++ +SM++Q K++P P D  Q MI  W
Sbjct: 481 DPSSFINLFGLLPYAAPEPGSILALIFIGILPILLGVSMWLQQKLNPAPTDPTQQMIFAW 540

Query: 523 MPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           MP VF+F L SF +GL++YW  +NVI+ +QQ  IM+ HGA+  +   ++++  K 
Sbjct: 541 MPWVFMFMLGSFASGLVLYWIANNVITFIQQYAIMRSHGAKPDVFGNIKASLKKR 595


>gi|75677253|ref|YP_319674.1| putative inner membrane protein translocase component YidC
           [Nitrobacter winogradskyi Nb-255]
 gi|74422123|gb|ABA06322.1| protein translocase subunit yidC [Nitrobacter winogradskyi Nb-255]
          Length = 614

 Score =  472 bits (1213), Expect = e-131,   Method: Composition-based stats.
 Identities = 244/610 (40%), Positives = 367/610 (60%), Gaps = 30/610 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEM------------NNERKNIQTVKQPNQ 48
           M  N N  +AI LS +++ AWQ FY  P++E+             +  +   +       
Sbjct: 1   MSENRNTIIAIVLSALVLIAWQYFYNIPQMEKDRAAHQAQSELAKSQSKSQGEAAPNTAA 60

Query: 49  VDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIV 108
              S A   +  R  A++  PRV++  P L GSI+L GA+ DDL L  Y   V+  SP +
Sbjct: 61  PGQSAAGSAVVARDVAIASKPRVQINTPRLSGSISLTGARIDDLLLTKYRETVNPASPAI 120

Query: 109 TLLSPSNTKNAYFAELDYVS-TANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNIL 167
            L SPS T + Y+AE  +V  T + + +P+ +T+W       LTP+TP+ L + N   + 
Sbjct: 121 ELFSPSGTASPYYAEFGWVPGTGSTVRVPDRSTLWQQEGAGALTPSTPVTLKYDNGEGLT 180

Query: 168 FERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDK 227
           F RT+S+D+ YLF I D VTN     +   P   I RH     +  + + EG I  LGD+
Sbjct: 181 FRRTVSVDDQYLFTIKDEVTNTGSAPVTLYPFALISRHGTPEISGYYILHEGLIGYLGDQ 240

Query: 228 SLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR-YQ 286
            L E  Y +I+++    F+ +N WLGI+DKYWA+  +P       ++F     G  R YQ
Sbjct: 241 KLQEYSYKNIDEAGSVTFNVTNGWLGITDKYWAAALLPDTSARLQARFSSDQAGAVRTYQ 300

Query: 287 AKFSANEITILPGKSITTTNFLFAGAKE---------FPTIHHYEKDLAIPRFEMLIDWG 337
             +  +  TI  G +   +  LFAGAKE            +  Y K L +  F++LIDWG
Sbjct: 301 TDYLEDARTIPAGGTGAVSTRLFAGAKEAGVVGLNFPLAELGGYNKQLGLNHFDLLIDWG 360

Query: 338 WFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKID 397
           WFYFI KPMF+ + +F+++ GNFG++I++ TV +KL+FFPLA + Y S A MK IQP+I+
Sbjct: 361 WFYFITKPMFLALDFFFHVFGNFGVSILVVTVLIKLVFFPLANRSYASMAKMKAIQPQIN 420

Query: 398 ELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAP 457
            LRE +     + LQ+ M+++YK   INP++GC P+LLQIPVFF++YKV+ +++EMRHAP
Sbjct: 421 ALRELYPDDRMK-LQQEMMEIYKKEKINPISGCLPVLLQIPVFFSLYKVLFVTIEMRHAP 479

Query: 458 FWGWIKDLAAADPTNIFTLFGILPFYLPG------FMHVGIWPIIMSLSMFIQMKMSPPP 511
           F+ WIKDL+A DPT+IF LFG+LP+          ++ +G WPIIM ++M+ QMK++P P
Sbjct: 480 FFAWIKDLSAPDPTHIFNLFGLLPYDPSVVPLIGPYLAIGAWPIIMGVTMWFQMKLNPTP 539

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLR 571
            D  Q +I +WMPV+F F L++FPAGL+IYW+W+N +S++QQ+ IM+ +G ++ L D ++
Sbjct: 540 PDPTQKIIFDWMPVIFTFMLAAFPAGLVIYWAWNNTLSVIQQSYIMRRNGVKVELFDNVK 599

Query: 572 STFSKNYNSQ 581
           STF +  + +
Sbjct: 600 STFRRKSSDK 609


>gi|240138939|ref|YP_002963414.1| transmembrane protein, OxaA-like, preprotein translocase component
           [Methylobacterium extorquens AM1]
 gi|240008911|gb|ACS40137.1| transmembrane protein, OxaA-like, preprotein translocase component
           [Methylobacterium extorquens AM1]
          Length = 637

 Score =  472 bits (1213), Expect = e-130,   Method: Composition-based stats.
 Identities = 245/612 (40%), Positives = 363/612 (59%), Gaps = 36/612 (5%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI--- 58
               N FVAIALS++++  W  F   P  E      ++        Q  +   +      
Sbjct: 24  NDKTNMFVAIALSLVVLLGWHYFVTGPASERQRQAAQSQTAQTGAPQTADGIPSPSPREG 83

Query: 59  ------------------DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLD 100
                               R  AL+ S RV +  P+L GSI LKGA+ DD++L+ YH  
Sbjct: 84  SPNAPAPGTLPGAGALGPVSREDALARSARVRIDTPALYGSIGLKGARIDDVSLKNYHET 143

Query: 101 VSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVF 160
           VS  SP + LLSP+ + N Y+AE  +V       LPN++T+W    G +L P  P+ L +
Sbjct: 144 VSDESPRIVLLSPTGSANPYYAEFGWVGANAGP-LPNADTLWK-ADGDLLAPGRPLTLTW 201

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGF 220
            N   ++F+R +++D+ ++F + D V N S + +   P   + R         + + EG 
Sbjct: 202 DNGQGLVFKRIVAVDDKFMFTVRDEVENTSANPVTLYPYSLVSRWGKPQTQGYYVLHEGL 261

Query: 221 IAVLGDKSLVEQKYSDIEKSS---------ISNFHESNSWLGISDKYWASVFIPSKETSF 271
           I VLG   L E  Y  + K            +  + +  W+GI+DKYWA+  IP ++  F
Sbjct: 262 IGVLGGDGLQEYTYDKVGKEPAYGGAATQGKAWTNVTGGWVGITDKYWAAAAIPEQDKPF 321

Query: 272 HSQFKYLSDGHAR-YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRF 330
              F   +DG  + YQ     + +T+ P  S  TT  LFAGAKE   I+ YE++  I +F
Sbjct: 322 TGAFTERTDGATKIYQTSVRGDAVTLAPNASSVTTQRLFAGAKEVNQINAYEREFGIKQF 381

Query: 331 EMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMK 390
           +++IDWGWF+F+ KPMF  + +F++L+GNFG++I+L T+ +KL F P+A + YVS A MK
Sbjct: 382 DLMIDWGWFWFLTKPMFRALDFFFHLLGNFGVSILLVTLILKLFFLPIANRSYVSMAKMK 441

Query: 391 NIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISIS 450
            +QP++  +RE++K    +  Q+AM++LYK   INP+AGCWP+L+QIPVFFA+YKV+ I+
Sbjct: 442 AVQPEMTSIRERYKDDRVK-QQQAMMELYKKEKINPVAGCWPVLIQIPVFFALYKVLFIT 500

Query: 451 LEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHV--GIWPIIMSLSMFIQMKMS 508
           +EMRHAPF+GWI+DLAA DPT+I  LFG+LPF  P ++ +  G+WPIIM ++MFIQMKM+
Sbjct: 501 IEMRHAPFFGWIQDLAAPDPTSIVNLFGLLPFTPPEYIPIHLGVWPIIMGITMFIQMKMN 560

Query: 509 PPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLID 568
           P P D  QA +  +MP+VF F L SFPAGL+IYW+W+N +S++QQ VIM+ +G ++ L D
Sbjct: 561 PAPPDPVQAQVFAFMPIVFTFMLGSFPAGLVIYWAWNNTLSVIQQYVIMRRNGVKVELWD 620

Query: 569 RLRSTFSKNYNS 580
            LR  F +   S
Sbjct: 621 NLRGMFKRGNKS 632


>gi|316932100|ref|YP_004107082.1| membrane protein insertase [Rhodopseudomonas palustris DX-1]
 gi|315599814|gb|ADU42349.1| membrane protein insertase, YidC/Oxa1 family [Rhodopseudomonas
           palustris DX-1]
          Length = 625

 Score =  471 bits (1211), Expect = e-130,   Method: Composition-based stats.
 Identities = 240/615 (39%), Positives = 350/615 (56%), Gaps = 46/615 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEE---------------------------- 32
           M  N N  +A+ LS +++  WQ F   P++E+                            
Sbjct: 1   MSDNRNTILAVVLSGLVLLGWQYFINIPQMEKQRAAQQAQQAQQQPQTTSPGTAPSGTPS 60

Query: 33  MNNERKNIQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDL 92
                        P+  +   AA     R  AL+ +PR++++   L GSI LKGA+ DDL
Sbjct: 61  ATPAPGTPSAPGAPSPANPQAAATPTVSREAALAATPRIKVETTQLSGSIALKGARIDDL 120

Query: 93  NLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWNLISGKILT 151
            L  Y   V   SP + L SPS +   Y+AE  +V  A  N++LP+ NTVW       LT
Sbjct: 121 ALTQYRETVDPKSPPIELFSPSGSARPYYAEFGWVGAAGANVKLPDHNTVWTQEGSGALT 180

Query: 152 PTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTAT 211
           P  P+ L + N   + F R I++D+ YLF + D VTN     +   P   I RH      
Sbjct: 181 PANPVTLKWDNGEGLTFRRQIAVDDRYLFTVKDDVTNTGAAPVTLYPFALISRHGTPHVE 240

Query: 212 NTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSF 271
             + + EG I  LG+  L E  YS I+++    F  +N WLGI+DKYWAS  +P      
Sbjct: 241 GYYILHEGLIGYLGEHGLQEYSYSKIDEAKSVGFKATNGWLGITDKYWASALLPDNTAQL 300

Query: 272 HSQFKYLSDGH-ARYQAKFSANEITILPGKSITTTNFLFAGAKEFPT---------IHHY 321
            ++F     G+   YQ  +  +  T+  G +++    LFAGAKE            +  Y
Sbjct: 301 QARFSANKAGNVTTYQTDYLEDARTVPIGGTVSANARLFAGAKEARVVGINFPFAGLGGY 360

Query: 322 EKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKK 381
           ++ L +  F++LIDWGWFYFI KPMF+ + +F++LVGNFG+AI+L TV +KL+F PLA K
Sbjct: 361 DRQLGLNHFDLLIDWGWFYFITKPMFLALDFFFHLVGNFGVAILLVTVLIKLIFLPLANK 420

Query: 382 QYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFF 441
            Y S A MK IQP++  L+E+      +  Q+ M+++Y+   INP+AGC PILLQIPVFF
Sbjct: 421 SYASMAKMKAIQPQLLALKERHPDDKVK-QQQEMMEIYRKEKINPVAGCLPILLQIPVFF 479

Query: 442 AIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPG------FMHVGIWPI 495
           ++YKV+ +++EMRHAPF+GWI DL+AADPTN+F LFG++P+          ++ +G WP+
Sbjct: 480 SLYKVLFVTIEMRHAPFFGWIHDLSAADPTNLFNLFGLIPYDPTAIPVLGHYLVLGAWPL 539

Query: 496 IMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAV 555
           +M  +M+ QMK++P P D  Q MI  WMPV+F F L+ FPAGL+IYW+W+N++S++QQA 
Sbjct: 540 VMGFTMWFQMKLNPQPPDPTQQMIFAWMPVIFTFMLAHFPAGLVIYWAWNNLLSVIQQAY 599

Query: 556 IMKMHGAEIGLIDRL 570
           IM+ +G ++ L D L
Sbjct: 600 IMRRNGVKVELFDNL 614


>gi|254561547|ref|YP_003068642.1| transmembrane protein, OxaA-like, preprotein translocase component
           [Methylobacterium extorquens DM4]
 gi|254268825|emb|CAX24786.1| transmembrane protein, OxaA-like, preprotein translocase component
           [Methylobacterium extorquens DM4]
          Length = 637

 Score =  471 bits (1211), Expect = e-130,   Method: Composition-based stats.
 Identities = 247/612 (40%), Positives = 363/612 (59%), Gaps = 36/612 (5%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVD----------- 50
               N FVAIALS++++  W  F   P  E      ++        Q             
Sbjct: 24  NDKTNMFVAIALSLVVLLGWHYFVTGPASERQRQAAQSQTAQTGAPQTADGIPSPSPREG 83

Query: 51  ----------NSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLD 100
                        AA     R  AL+ S RV +  P+L GSI LKGA+ DD++L+ YH  
Sbjct: 84  SPNAPAPGTLPGAAAQGPVSREDALARSARVRIDTPALYGSIGLKGARIDDVSLKNYHET 143

Query: 101 VSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVF 160
           VS  SP + LLSP+ + N Y+AE  +V       LPN++T+W    G +L P  P+ L +
Sbjct: 144 VSDESPRIVLLSPTGSANPYYAEFGWVGANAGP-LPNADTLWK-ADGDLLAPGRPLTLTW 201

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGF 220
            N   ++F+R +++D+ ++F + D V N S + +   P   + R         + + EG 
Sbjct: 202 DNGQGLVFKRIVAVDDKFMFTVRDEVENTSANPVTLYPYSLVSRWGKPQTQGYYVLHEGL 261

Query: 221 IAVLGDKSLVEQKYSDIEKSS---------ISNFHESNSWLGISDKYWASVFIPSKETSF 271
           I VLG   L E  Y  + K            +  + +  W+GI+DKYWA+  IP ++  F
Sbjct: 262 IGVLGGDGLQEYTYDKVGKEPAYGGAATQGKAWTNVTGGWVGITDKYWAAAAIPEQDKPF 321

Query: 272 HSQFKYLSDGHAR-YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRF 330
              F   +DG  + YQ     + +T+ P  S  TT  LFAGAKE   I+ YE++  I +F
Sbjct: 322 TGAFTERTDGATKIYQTSVRGDAVTLAPNASSVTTQRLFAGAKEVNQINAYEREFGIKQF 381

Query: 331 EMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMK 390
           +++IDWGWF+F+ KPMF  + +F++L+GNFG++I+L T+ +KL F P+A + YVS A MK
Sbjct: 382 DLMIDWGWFWFLTKPMFRALDFFFHLLGNFGVSILLVTLILKLFFLPIANRSYVSMAKMK 441

Query: 391 NIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISIS 450
            +QP++  +RE++K    +  Q+AM++LYK   INP+AGCWP+L+QIPVFFA+YKV+ I+
Sbjct: 442 AVQPEMTSIRERYKDDRVK-QQQAMMELYKKEKINPVAGCWPVLIQIPVFFALYKVLFIT 500

Query: 451 LEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHV--GIWPIIMSLSMFIQMKMS 508
           +EMRHAPF+GWI+DLAA DPT+I  LFG+LPF  P ++ +  G+WPIIM ++MFIQMKM+
Sbjct: 501 IEMRHAPFFGWIQDLAAPDPTSIVNLFGLLPFTPPEYIPIHLGVWPIIMGITMFIQMKMN 560

Query: 509 PPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLID 568
           P P D  QA +  +MP+VF F L SFPAGL+IYW+W+N +S++QQ VIM+ +G ++ L D
Sbjct: 561 PAPPDPVQAQVFAFMPIVFTFMLGSFPAGLVIYWAWNNTLSVIQQYVIMRRNGVKVELWD 620

Query: 569 RLRSTFSKNYNS 580
            LR  F +   S
Sbjct: 621 NLRGMFKRGNKS 632


>gi|13474029|ref|NP_105597.1| putative inner membrane protein translocase component YidC
           [Mesorhizobium loti MAFF303099]
 gi|38503148|sp|Q98D88|OXAA_RHILO RecName: Full=Inner membrane protein oxaA
 gi|14024781|dbj|BAB51383.1| mlr4812 [Mesorhizobium loti MAFF303099]
          Length = 603

 Score =  471 bits (1210), Expect = e-130,   Method: Composition-based stats.
 Identities = 273/600 (45%), Positives = 375/600 (62%), Gaps = 23/600 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNN----------ERKNIQTVKQPNQVD 50
           ME N N+F+ IALSV+I+  WQ FYV PR E              E+K       P    
Sbjct: 1   MENNRNFFITIALSVLILAVWQYFYVLPRSEAQREAARVEQQRVEEQKKAAEAANPGAGT 60

Query: 51  NSYAAVLIDD-----------RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHL 99
            + A   I +           R QAL+ S RV++  PSL GSINL GA+ DDL L+ Y  
Sbjct: 61  PAPAPGTIPNAPGGDTVTVAGRDQALAASKRVKIDTPSLEGSINLTGARLDDLKLKHYTE 120

Query: 100 DVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLV 159
            V  NSP + LL+P      YFAE+ +V       +P + TVWN+     L+P+TP+ L 
Sbjct: 121 TVDKNSPEIELLNPQALPTGYFAEIGFVGNDKTGAVPGAETVWNVDGNPTLSPSTPVTLT 180

Query: 160 FKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEG 219
           + N   + F+RT S+D +Y+F + DTV N+    +     GR+ R+      +T+ + EG
Sbjct: 181 YTNDKGLTFKRTFSVDANYMFTVSDTVQNSGSSAVSLFNYGRVTRYDKPAVASTYVLHEG 240

Query: 220 FIAVLGDKSLVEQKYSDIEKSSISNF-HESNSWLGISDKYWASVFIPSKETSFHSQFKYL 278
            I   G + L E KY+ IEK         ++ WLGI+DKYWA   +P+++  F  ++ + 
Sbjct: 241 LIGFTGTEGLQEHKYASIEKDKQYQPGKATDGWLGITDKYWAVTLVPTEKQPFQPRYAFF 300

Query: 279 SDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGW 338
            DG  RYQ+ F  + I +  G+S T    +FAGAKE   I+ Y +D  I RF++LIDWGW
Sbjct: 301 EDGRHRYQSDFLTDAINVEAGQSATVETEVFAGAKEVAKINAYAEDRHIKRFDLLIDWGW 360

Query: 339 FYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDE 398
           F+FI KPMF L+   Y  +GNFG+AI+ TTV VK LFFPLA K Y S ANMK +QPK+ E
Sbjct: 361 FHFITKPMFWLIDTLYKFLGNFGLAILATTVIVKALFFPLANKSYASMANMKKVQPKMLE 420

Query: 399 LREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF 458
           +REK+     +  Q+AM++LYKT  INPLAGCWP+ LQIPVFF++YKV+ I++EMRHAPF
Sbjct: 421 IREKYADDKMK-QQQAMMELYKTEKINPLAGCWPVALQIPVFFSLYKVLYITIEMRHAPF 479

Query: 459 WGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAM 518
           +GWI+DLAA DPT++F LFG++P  LP  + +G+WP+IM ++MF+QM+M+P P D  QA 
Sbjct: 480 FGWIQDLAAPDPTSLFNLFGLIPVTLPHMLMIGVWPLIMGVTMFLQMRMNPTPPDPTQAA 539

Query: 519 ILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNY 578
           I  WMPV+F F ++ FPAGL+IYW+W+N++SI+QQ VIMK  GA+I L D L + F K  
Sbjct: 540 IFTWMPVIFTFMMAGFPAGLVIYWAWNNMLSILQQGVIMKRQGAKIELWDNLMALFKKKP 599


>gi|154250755|ref|YP_001411579.1| 60 kDa inner membrane insertion protein [Parvibaculum
           lavamentivorans DS-1]
 gi|154154705|gb|ABS61922.1| 60 kDa inner membrane insertion protein [Parvibaculum
           lavamentivorans DS-1]
          Length = 609

 Score =  470 bits (1209), Expect = e-130,   Method: Composition-based stats.
 Identities = 247/595 (41%), Positives = 356/595 (59%), Gaps = 27/595 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNI-------------------- 40
           M  N N+ +AI LSV++   WQ F++ P++E     ++ +                    
Sbjct: 1   MGDNRNFIIAIFLSVLVFIGWQYFFIEPQMEAERARQEQLAADNGTAEPAPGAAPSAPGD 60

Query: 41  ---QTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGY 97
               +V  P       AA     R +AL+ S RV + +  L GS++L+GA+FDDL L  Y
Sbjct: 61  ARLPSVDAPATRAPGVAASGAVARDEALAQSARVPILSEELQGSVSLRGARFDDLKLLKY 120

Query: 98  HLDVSSNSPIVTLLSPSNTKNAYFAELDYVS-TANNIELPNSNTVWNLISGKILTPTTPI 156
           ++ V   SP V L SP  T+  YF+E  +++    NI LP S T W L +G  LTP TP+
Sbjct: 121 NVTVDPESPEVELFSPVRTERPYFSEFGFIAAPGANINLPTSATEWELEAGDRLTPQTPV 180

Query: 157 KLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGV 216
            L + N   ++F R I+LDEH+LF + D + N S +++   P G I R      ++ F +
Sbjct: 181 TLRWDNGQGLVFHREIALDEHFLFTVTDRIENLSANEVTLYPYGLISRTGRPAGSSFFIL 240

Query: 217 QEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFK 276
            EGFI            Y D E+       ++  WLGI+DKYWA+  +P    +F + F 
Sbjct: 241 HEGFIGEFPSVGEKAITYDDAEEDDPVQVTDTEGWLGITDKYWAAALVPQSGLNFVANFS 300

Query: 277 -YLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLID 335
            +       YQA F     T+  G SIT  N LFAGAK    I  Y  D  I +F +LID
Sbjct: 301 EHPDPAIVNYQADFRYGAQTVPAGGSITLNNRLFAGAKVSTVIDSYR-DAGIYKFSLLID 359

Query: 336 WGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPK 395
           WGWF+F+ +PMF  + +    VGNFGIAI++ TV +KL+F+PLA K YV+ + MK +QP+
Sbjct: 360 WGWFWFLTQPMFDALHFIALHVGNFGIAILVITVLIKLVFYPLANKSYVAMSKMKKLQPE 419

Query: 396 IDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRH 455
           +++LRE++K    +  Q+ +++LYK   +NPLAGC P+L+QIPVFFA+YKV+ +++EMRH
Sbjct: 420 MEKLRERYKDDKLK-QQQEIMELYKKEKVNPLAGCLPVLIQIPVFFALYKVLFVTIEMRH 478

Query: 456 APFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKG 515
           APF+GWI DL+A DPT+IF LFG++P+  P  + +GIWP+IM  +MF+Q +M+P PAD  
Sbjct: 479 APFFGWINDLSAPDPTSIFNLFGLIPWDPPSMLMIGIWPLIMGFTMFVQQRMNPLPADPI 538

Query: 516 QAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL 570
           QA I  WMPV+F F L+SFPAGL+IYW+W+N +S++QQ VIMK  G +I +   L
Sbjct: 539 QAQIFTWMPVIFTFMLASFPAGLVIYWAWNNTLSVIQQGVIMKRQGVKIEIFSNL 593


>gi|260577136|ref|ZP_05845113.1| 60 kDa inner membrane insertion protein [Rhodobacter sp. SW2]
 gi|259020610|gb|EEW23929.1| 60 kDa inner membrane insertion protein [Rhodobacter sp. SW2]
          Length = 646

 Score =  470 bits (1209), Expect = e-130,   Method: Composition-based stats.
 Identities = 216/598 (36%), Positives = 333/598 (55%), Gaps = 21/598 (3%)

Query: 1   ME-RNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLID 59
           M+ +N N  +A ALS +++  W   +  P      N    I   +               
Sbjct: 1   MDGQNKNLILATALSFLVILVWFVLFPPPEPVVDPNAPA-ISATEALTPPVADQTTAATT 59

Query: 60  DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNA 119
           + A A+  +PR+ +  P L GSI++ G + DDL+L+GY   +   S IV LLSP    +A
Sbjct: 60  EPAAAVPETPRLTIDTPLLQGSISMLGGRIDDLSLKGYKESLDPASDIVRLLSPVGKDSA 119

Query: 120 YFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEH 177
           Y+A   +    +  N ++P +NT W L +G  L P  P+ L + N   + F RTI++D+H
Sbjct: 120 YYALYGWAPGGDLANEDVPGANTEWKLAAGTSLAPGQPVTLAWDNGKGLNFTRTIAIDDH 179

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           Y+F +   V N +  ++R +P G + RH        F V    +    D  L E KY D+
Sbjct: 180 YMFTVTQGVENTTGAEVRLAPYGIVARHGKPAGLQNFYVLHEGVVGRTDGKLEEVKYKDL 239

Query: 238 EKSSISNFH---------ESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAK 288
               +              ++ W+G +DKYW +  IP++   F S  KY+      YQ +
Sbjct: 240 VDLPVVEREGAQAEVVEATTDGWIGFTDKYWMTTLIPAQGKPFTSVTKYV-ASADIYQVE 298

Query: 289 FSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFM 348
                + + PG    TT+ LFAGAKE+ TI  Y+ D  +P F   IDWGWF+F+ KPMF 
Sbjct: 299 TREPVLVVAPGAKAETTSRLFAGAKEWATIRGYQNDAGVPGFIDSIDWGWFFFLTKPMFW 358

Query: 349 LMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPP 408
           ++     L+GN G+AI+  T+ +K++ FPLA K YVS A MK +QP+I+ ++E+      
Sbjct: 359 VLHNLNALIGNMGLAIIGLTLVLKVIVFPLAYKSYVSMARMKELQPEIEAMKERVGDDK- 417

Query: 409 QVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAA 468
           Q +Q  M++LYK   +NP AGC P+L+QIP+FF++YKVI ++LE+RHAPF+GW+ DL+A 
Sbjct: 418 QKVQVEMMKLYKEKKVNPAAGCLPVLIQIPIFFSLYKVIFVTLELRHAPFFGWLTDLSAR 477

Query: 469 DPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNW 522
           D +++F  FG+ P+  P        + +G+ PI++ +SM++Q K++P PAD  Q MI  W
Sbjct: 478 DSSSLFNFFGLAPWAAPEHGTLLATIFIGLLPILLGISMWLQQKLNPAPADPTQQMIFAW 537

Query: 523 MPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNS 580
           MP VF+F L SF +GL++YW  +NVI+  QQ +IM+ HG    +   ++S F K   +
Sbjct: 538 MPWVFMFMLGSFASGLVLYWITNNVITFTQQYIIMRSHGHHPDIFGNIKSGFKKKPAA 595


>gi|163795447|ref|ZP_02189414.1| 60 kDa inner membrane insertion protein [alpha proteobacterium
           BAL199]
 gi|159179433|gb|EDP63964.1| 60 kDa inner membrane insertion protein [alpha proteobacterium
           BAL199]
          Length = 584

 Score =  469 bits (1207), Expect = e-130,   Method: Composition-based stats.
 Identities = 220/582 (37%), Positives = 330/582 (56%), Gaps = 21/582 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIE------------------EMNNERKNIQT 42
           M    N  +AI LSV+I+  +Q     P+I+                             
Sbjct: 1   MTDQKNMILAIVLSVLILLGFQFLVERPKIDQQRQQQAQQQGQTSQADGSSVPVPGQSTA 60

Query: 43  VKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVS 102
              P    +S      + R  AL++SPR+ +  P + GSI LKGA+ DD+ L  Y + + 
Sbjct: 61  PSAPGAARDSAGQTAGESREAALALSPRITISTPRVQGSIALKGARIDDVVLTDYRVTID 120

Query: 103 SNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKN 162
             SP + LL P+  K+ Y+AE  +V+ + +     +           LTP  P+ L + N
Sbjct: 121 PKSPPIHLLDPTGLKHPYYAEFGWVAASGSSVAVPTPETIWTTDSTTLTPERPVTLSWSN 180

Query: 163 ANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIA 222
                FERTI++D+ Y+F +   V N S D I   P G I R       + + + EG + 
Sbjct: 181 GQGQTFERTIAIDKDYMFTVSQRVVNKSTDAITLYPYGLISRGGTPETLDFYILHEGPLG 240

Query: 223 VLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYL-SDG 281
           V  D +L E  YSD+ +        +  W+GI+DKYW +  +P +  +++  F++   + 
Sbjct: 241 VFND-TLTEINYSDLREDGDVQRAATGGWIGITDKYWLAALVPGQGQTWNYNFRHSVRNQ 299

Query: 282 HARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYF 341
             RYQ  F     +I  G++ +T N LFAGAK    +  YE+   +  F++ ID+GWFYF
Sbjct: 300 SDRYQVDFLGEATSIAAGETASTENRLFAGAKLVKVLDRYEEQYGVANFDLAIDFGWFYF 359

Query: 342 IAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELRE 401
           + KP F ++++ + L+GNFG+AI+  T+ VKLLFFPLA K Y S A MK + PK+ E+RE
Sbjct: 360 LTKPFFYVLTWLHALLGNFGLAILGLTICVKLLFFPLANKSYASMAKMKALTPKLQEMRE 419

Query: 402 KFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGW 461
           K      Q L   M+ LYK   +NP AGC PI++QIPVFFA+YK + +++EMRHAPF+GW
Sbjct: 420 KHGD-DRQRLNDEMMALYKREKVNPAAGCLPIVIQIPVFFALYKTLFVNIEMRHAPFYGW 478

Query: 462 IKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILN 521
           IKDL+A DPT IF L G++P+  P F+ +GIWP++M ++MF+Q K++P PAD  QA I  
Sbjct: 479 IKDLSAPDPTTIFNLLGVIPWDPPQFLMIGIWPVLMGITMFLQQKLNPAPADPVQAKIFM 538

Query: 522 WMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           ++P++F F L  F AGL+IYW+W+N++SI QQ +IM+  G +
Sbjct: 539 FLPLMFTFLLGHFAAGLVIYWTWNNLLSITQQWIIMRRMGIK 580


>gi|182680230|ref|YP_001834376.1| 60 kDa inner membrane insertion protein [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|254772748|sp|B2IDV5|OXAA_BEII9 RecName: Full=Inner membrane protein oxaA
 gi|182636113|gb|ACB96887.1| 60 kDa inner membrane insertion protein [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 604

 Score =  469 bits (1206), Expect = e-130,   Method: Composition-based stats.
 Identities = 242/600 (40%), Positives = 357/600 (59%), Gaps = 25/600 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYA------- 54
           + + N ++AI LS++++  W  F+  P++E+    +   +   Q     ++ A       
Sbjct: 3   QDSRNLYLAIGLSLLVLIGWNYFFAGPQVEKARQAQIVREQQAQTQTTSDTTARSDLNVP 62

Query: 55  ---------AVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNS 105
                          R +AL+ SPRV+L  P+L GSINL+GA+ DD++L+ Y   V+ +S
Sbjct: 63  GQRSLPGESPQTQLSRPEALAASPRVKLDTPNLFGSINLRGARIDDVSLKAYRETVAKDS 122

Query: 106 PIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANN 165
           P + LLSPS T   Y+A+  +V+ A    L   +        ++LTP  P+ L + N   
Sbjct: 123 PNIVLLSPSGTPAPYYADAGFVAPAEAGLLLPKSDTLWSADREVLTPEAPVTLTYDNGQG 182

Query: 166 ILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLG 225
           ++F RTIS+D+ ++F + D V N +   +   P   + RH          + EG + V+G
Sbjct: 183 LIFHRTISVDDRFMFTLTDKVENKTDKPVTLYPYSLVSRHGRPVTAGYAVLHEGMVGVIG 242

Query: 226 DKSLVEQKYSDIEKSSI--SNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
           D  L E  Y  I K      +F  +  WLG +DKYWA+V  P + T F  +F        
Sbjct: 243 DNGLQEITYDKIHKEENATKSFKGTGGWLGFTDKYWAAVIAPDQATPFEGRFSERGTTTP 302

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
            YQ       +TI PG +    + LFAGAKE  T+  Y  +L I +F++LIDWG+FYFI 
Sbjct: 303 LYQTDALGPALTIAPGGTGGDMSRLFAGAKETQTLDDYRNELGIKKFDLLIDWGYFYFIT 362

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           +PMF ++   Y +VGNFG+AI+  TV VK +FFPLA + Y+S A MK IQP++  LRE++
Sbjct: 363 RPMFWILHTIYQVVGNFGVAILCITVLVKAVFFPLANRSYLSMAKMKAIQPQMLALRERY 422

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
                +  Q+ +++LYK   INP+AGC P+L+QIPVFFA+YKV+ +++EMR APF+GWI+
Sbjct: 423 ADDKVK-QQQELMELYKREKINPVAGCLPMLIQIPVFFALYKVLFVTIEMRQAPFFGWIR 481

Query: 464 DLAAADPTNIFTLFGILPFYLPG------FMHVGIWPIIMSLSMFIQMKMSPPPADKGQA 517
           DL+A DPTNIF LFG+LPF          F+ +GIWP+IM +SMF QMKM+P PAD  Q 
Sbjct: 482 DLSAPDPTNIFNLFGLLPFDPTHLPMIGHFLAIGIWPLIMGVSMFFQMKMNPEPADPVQK 541

Query: 518 MILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
            + +WMPV+F F L +FP+GL+IYW+W+N +S++QQ++IMK  G ++ L D L STF K 
Sbjct: 542 QMFSWMPVIFTFMLGTFPSGLVIYWTWNNTLSVLQQSLIMKRAGVKVELWDNLMSTFRKK 601


>gi|227820669|ref|YP_002824639.1| putative inner membrane protein translocase component YidC
           [Sinorhizobium fredii NGR234]
 gi|254773017|sp|C3MF49|OXAA_RHISN RecName: Full=Inner membrane protein oxaA
 gi|227339668|gb|ACP23886.1| putative inner membrane protein translocase component YidC
           [Sinorhizobium fredii NGR234]
          Length = 592

 Score =  468 bits (1204), Expect = e-130,   Method: Composition-based stats.
 Identities = 286/589 (48%), Positives = 387/589 (65%), Gaps = 11/589 (1%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDN--------- 51
           ME N NYFVAIALSV+I+ AWQ FYV PR+++     +  Q  +Q               
Sbjct: 2   MENNRNYFVAIALSVLILVAWQYFYVNPRMDKDRIAAEKAQQTQQVQPQQGGQQPAPGQA 61

Query: 52  -SYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTL 110
               AV  + R QA++ S RV +  P+L GSINL GA+FDDL L+GYH  V   SP++TL
Sbjct: 62  LPGGAVPGESRDQAVAKSARVAIDTPALSGSINLTGARFDDLKLKGYHETVDPKSPVITL 121

Query: 111 LSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFER 170
            SP+ T + YF E+ Y+    +  +P   TVW L  G+ LTP TP+ L + N   I F R
Sbjct: 122 FSPAETADGYFTEIGYIGNDASGSVPGPQTVWTLSGGEKLTPATPVTLTYTNDKGITFAR 181

Query: 171 TISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLV 230
           TIS+DE+Y+F++VD++ N+    +  S  GR+ R    T  + + + EGFI V G     
Sbjct: 182 TISIDENYMFQVVDSIKNDGSAPVSLSSYGRVTRFNKPTTPSIYVLHEGFIGVAGGSLQE 241

Query: 231 EQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFS 290
                  E   +     +  W GI+DKYWA+  +P +ET F  +F + +DG  R+Q+ + 
Sbjct: 242 VGYSKIEENLPVEPGKTTGGWHGITDKYWAAAIVPPQETPFDIRFSHFTDGRPRFQSDYK 301

Query: 291 ANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLM 350
            + +T+ PG+S    N +FAGAKE   +  Y    AIP+FE LIDWGWF+FI +PMF +M
Sbjct: 302 GDAVTVAPGQSAEVKNLVFAGAKEVQVVDTYTTAYAIPKFEKLIDWGWFWFITQPMFKMM 361

Query: 351 SYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQV 410
            +F+ L GNFG+AI++TT+ VKL+FFPLA KQY S ANMK +QPK++EL++KF       
Sbjct: 362 DFFFRLFGNFGVAILVTTIVVKLIFFPLANKQYASMANMKKVQPKMEELKKKFGD-DRMG 420

Query: 411 LQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADP 470
           LQ+AM+QLYK   INPLAGCWPIL+QIPVFFA+YKVI I++EMRHAPF+GWI+DL+A DP
Sbjct: 421 LQQAMMQLYKDEKINPLAGCWPILIQIPVFFALYKVIYITIEMRHAPFFGWIRDLSAPDP 480

Query: 471 TNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFA 530
           T I  LFG+LPF  P F+H+GIWPIIM ++MF+QM+M+P P D  QAM+  WMP+VF F 
Sbjct: 481 TTIVNLFGLLPFDGPAFLHLGIWPIIMGVTMFLQMRMNPTPPDPTQAMLFTWMPLVFTFM 540

Query: 531 LSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYN 579
           L+SFPAGL+IYW+W+N +SI QQ++IMK  G +I L D L+  F+K   
Sbjct: 541 LASFPAGLVIYWAWNNTLSITQQSIIMKRQGVKIELFDNLKGLFTKRPK 589


>gi|163851774|ref|YP_001639817.1| 60 kDa inner membrane insertion protein [Methylobacterium
           extorquens PA1]
 gi|254773001|sp|A9W590|OXAA_METEP RecName: Full=Inner membrane protein oxaA
 gi|163663379|gb|ABY30746.1| 60 kDa inner membrane insertion protein [Methylobacterium
           extorquens PA1]
          Length = 616

 Score =  468 bits (1204), Expect = e-129,   Method: Composition-based stats.
 Identities = 248/612 (40%), Positives = 363/612 (59%), Gaps = 36/612 (5%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVD----------- 50
               N FVAIALS++++  W  F   P  E      ++        Q             
Sbjct: 3   NDKTNMFVAIALSLVVLLGWHYFVTGPASERQRQAAQSQTAQTGAPQTADGIPSPSPREG 62

Query: 51  ----------NSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLD 100
                        AA     R  AL+ S RV +  P+L GSI LKGA+ DD++L+ YH  
Sbjct: 63  GPNAPAPGTLPGAAAQGPVSREDALARSARVRIDTPALYGSIGLKGARIDDVSLKNYHET 122

Query: 101 VSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVF 160
           VS  SP + LLSP+ T N Y+AE  +V       LPN++T+W    G +L P  P+ L +
Sbjct: 123 VSDESPRIVLLSPTGTANPYYAEFGWVGANAGP-LPNADTLWK-ADGDLLAPGRPLTLTW 180

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGF 220
            N   ++F+R +++D+ ++F + D V N S + +   P   + R         + + EG 
Sbjct: 181 DNGQGLVFKRIVAVDDKFMFTVRDEVENTSANPVTLYPYSLVSRWGKPQTQGYYVLHEGL 240

Query: 221 IAVLGDKSLVEQKYSDIEKSS---------ISNFHESNSWLGISDKYWASVFIPSKETSF 271
           I VLG   L E  Y  + K            +  + +  W+GI+DKYWA+  IP ++  F
Sbjct: 241 IGVLGGDGLQEYTYDKVGKEPAYGGAATQGKAWTNVTGGWVGITDKYWAAAAIPEQDKPF 300

Query: 272 HSQFKYLSDGHAR-YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRF 330
              F   +DG  + YQ     + +T+ P  S  TT  LFAGAKE   I+ YE++  I +F
Sbjct: 301 TGAFTERTDGATKIYQTSVRGDAVTLAPNASSVTTQRLFAGAKEVNQINAYEREFGIKQF 360

Query: 331 EMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMK 390
           +++IDWGWF+F+ KPMF  + +F++L+GNFG++I+L T+ +KL F P+A + YVS A MK
Sbjct: 361 DLMIDWGWFWFLTKPMFRALDFFFHLLGNFGVSILLVTLILKLFFLPIANRSYVSMAKMK 420

Query: 391 NIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISIS 450
            +QP++  +RE++K    +  Q+AM++LYK   INP+AGCWP+L+QIPVFFA+YKV+ I+
Sbjct: 421 AVQPEMTSIRERYKDDRVK-QQQAMMELYKKEKINPVAGCWPVLIQIPVFFALYKVLFIT 479

Query: 451 LEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHV--GIWPIIMSLSMFIQMKMS 508
           +EMRHAPF+GWI+DLAA DPT+I  LFG+LPF  P ++ +  G+WPIIM ++MFIQMKM+
Sbjct: 480 IEMRHAPFFGWIQDLAAPDPTSIVNLFGLLPFTPPEYIPIHLGVWPIIMGITMFIQMKMN 539

Query: 509 PPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLID 568
           P P D  QA +  +MP+VF F L SFPAGL+IYW+W+N +S++QQ VIM+ +G ++ L D
Sbjct: 540 PAPPDPVQAQVFAFMPIVFTFMLGSFPAGLVIYWAWNNTLSVIQQYVIMRRNGVKVELWD 599

Query: 569 RLRSTFSKNYNS 580
            LR  F +   S
Sbjct: 600 NLRGMFKRGNKS 611


>gi|84685375|ref|ZP_01013273.1| putative inner membrane protein translocase component YidC
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84666532|gb|EAQ13004.1| putative inner membrane protein translocase component YidC
           [Rhodobacterales bacterium HTCC2654]
          Length = 613

 Score =  468 bits (1204), Expect = e-129,   Method: Composition-based stats.
 Identities = 217/613 (35%), Positives = 333/613 (54%), Gaps = 34/613 (5%)

Query: 1   ME-RNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLID 59
           ME +N N  +A  LS +++ AW   +     E +  E               +       
Sbjct: 1   MENQNRNLLIATVLSFVVITAWMLLFPPAEPEAVQPEEVAETLAPGATDGAATPPNAAEQ 60

Query: 60  DRAQA--------------LSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNS 105
               A              L  SPR+ ++ P L GSI+L G + DDL+L  Y + +   S
Sbjct: 61  TGTDAAPEATPDTTTTAQTLENSPRIPVETPKLSGSISLIGGRIDDLHLSDYRVSLDKGS 120

Query: 106 PIVTLLSPSNTKNAYFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNA 163
             VTLL PS +  AY+    +    N  N ++P + T W L  G  LTP TPI L + N 
Sbjct: 121 DTVTLLRPSGSDEAYYTLYGWAPGGNLGNADVPGAMTQWELEEGDTLTPETPITLAWTND 180

Query: 164 NNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAV 223
             ++F RTIS+DE YLF +  +V N S    R +P G I RH   +    F +    +  
Sbjct: 181 AGMIFRRTISVDEDYLFTVRQSVENGSDIAQRLAPYGLIARHGEPSNLKGFFILHEGVIR 240

Query: 224 LGDKSLVEQKYSDIEKSSISNF---------HESNSWLGISDKYWASVFIPSKETSFHSQ 274
             D  L E  Y D  +                  N W+G +D YW ++ +P     + + 
Sbjct: 241 QDDTELSEIDYKDARELDRDPREGAPAEATAITENGWVGFTDHYWETILVPESGQPYTAV 300

Query: 275 FKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLI 334
            KY+ +G   YQ +     I + PG +   +  LFAGAKE+ TI  Y+ D  I RF   I
Sbjct: 301 VKYV-EGADIYQTEVRLPTIEVAPGATAEVSTRLFAGAKEWDTIRDYQNDEGIYRFLDSI 359

Query: 335 DWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQP 394
           DWG F+F+ KP+F ++ + ++ +GN G +I+  T  +K++ FPLA + YVS A MK +QP
Sbjct: 360 DWGMFFFLTKPIFAVLHWLHSFIGNMGWSIIALTFVIKMVLFPLAYRSYVSMAKMKELQP 419

Query: 395 KIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMR 454
           ++++LRE+      ++ Q+ M++LYK + +NP +GC PILLQIP++F++YKVI ++LE+R
Sbjct: 420 EMEKLREQAGDDRMKM-QQGMMELYKKNKVNPASGCLPILLQIPIWFSLYKVIFVTLELR 478

Query: 455 HAPFWGWIKDLAAADPTNIFTLFGILPFYLPG------FMHVGIWPIIMSLSMFIQMKMS 508
           H P++GWI+DL+A DP++I  LFG+LP   P       F  +G+ PI++ +SM++Q K++
Sbjct: 479 HEPWFGWIRDLSAPDPSSILNLFGLLPNAAPDPTSWFYFFSLGVLPILLGISMWLQQKLN 538

Query: 509 PPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLID 568
           P PAD  QA I+NWMP VF+F L  F +GL+IYW  +N ++ +QQ  IM+ HGA+  +  
Sbjct: 539 PAPADATQATIMNWMPWVFMFMLGRFASGLVIYWIANNTLTFIQQYTIMRSHGAKPDIFG 598

Query: 569 RLRSTFSKNYNSQ 581
            ++S+F K   ++
Sbjct: 599 NIKSSFKKKPATE 611


>gi|225686778|ref|YP_002734750.1| putative inner membrane protein translocase component YidC
           [Brucella melitensis ATCC 23457]
 gi|256262088|ref|ZP_05464620.1| inner membrane protein [Brucella melitensis bv. 2 str. 63/9]
 gi|225642883|gb|ACO02796.1| Inner membrane protein oxaA [Brucella melitensis ATCC 23457]
 gi|263091777|gb|EEZ16108.1| inner membrane protein [Brucella melitensis bv. 2 str. 63/9]
 gi|326411186|gb|ADZ68250.1| putative inner membrane protein translocase component YidC
           [Brucella melitensis M28]
 gi|326554477|gb|ADZ89116.1| putative inner membrane protein translocase component YidC
           [Brucella melitensis M5-90]
          Length = 610

 Score =  468 bits (1204), Expect = e-129,   Method: Composition-based stats.
 Identities = 267/607 (43%), Positives = 379/607 (62%), Gaps = 29/607 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQ------------------- 41
           ME   N+F+ IALS++I+  WQ FY+ P+ E    + +  +                   
Sbjct: 1   MENKRNFFITIALSILILALWQVFYLGPKTEAQREQARIEEQQRQAQQAAQNRQASSSTG 60

Query: 42  -------TVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNL 94
                           ++ AA     R  A++ SPR+E+  PSL GSINL GA+ DDL L
Sbjct: 61  DTPQMPANPDSIPGQGDTKAAGAPLTRDAAIAQSPRIEIDTPSLRGSINLTGARLDDLYL 120

Query: 95  RGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTT 154
           + YH  VS  SP + LL+PS+ K  YF EL +        +P  NTVW +     LTP+T
Sbjct: 121 KKYHETVSDKSPEIELLAPSSLKQGYFVELGFTGNDATGAVPGPNTVWVVEGNNKLTPST 180

Query: 155 PIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIM-RHKPQTATNT 213
           P+ L + N  N+ F+R IS+D+ Y+F + DT+ NN    +  +  GR+   ++P+ A+ T
Sbjct: 181 PVTLTYTNDKNLTFKRVISVDDAYMFTVDDTIINNGGSTVSLASYGRVTRFNQPEHASAT 240

Query: 214 FGVQEGFIAVLGDKSLVEQKYSD-IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFH 272
           + + EG I V+G   L E KY+   +   IS       W+GI+DKYWA+  IP ++  F 
Sbjct: 241 YVLHEGLIGVMGQDGLQEIKYAKIEDNKDISFKDVIGGWVGITDKYWAATLIPPQDEKFT 300

Query: 273 SQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEM 332
            +F + ++   RYQ+   +  +T+ PG+S    N +FAGAK   TI +YE    I +F++
Sbjct: 301 GRFSHFTNDRPRYQSDLLSAPLTVAPGQSQKIQNRVFAGAKVVNTIQNYETKYHIKQFDL 360

Query: 333 LIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNI 392
           LIDWGWFYFI KPMF L+ + Y   GNFG+AI++ TV +K LFFPLA K Y S A MK +
Sbjct: 361 LIDWGWFYFITKPMFYLIDWIYKFTGNFGVAILVVTVLLKALFFPLANKSYKSMARMKLM 420

Query: 393 QPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLE 452
           QPK+ E+REK+     +  Q+AM++LYK   INPLAGCWP+L+QIPVFFA+YKV+ +++E
Sbjct: 421 QPKMTEIREKYADDKMK-QQQAMMELYKRERINPLAGCWPVLVQIPVFFALYKVLYVTIE 479

Query: 453 MRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPA 512
           MRHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G+WPIIM ++MF+QM+M+P P 
Sbjct: 480 MRHAPFFGWIQDLAAPDPTSIFNLFGLLPYTVPHFLMIGVWPIIMGITMFLQMRMNPTPP 539

Query: 513 DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRS 572
           D  QA I  WMP++F F L+SFPAGL+IYW+W+N +SI+QQ+VIMK  G +I L D L+ 
Sbjct: 540 DPTQAAIFTWMPIIFTFMLASFPAGLVIYWAWNNTLSIIQQSVIMKRQGVKIELFDNLKG 599

Query: 573 TFSKNYN 579
            F +   
Sbjct: 600 LFRRKPK 606


>gi|254473802|ref|ZP_05087197.1| 60 kDa inner membrane insertion protein [Pseudovibrio sp. JE062]
 gi|211957188|gb|EEA92393.1| 60 kDa inner membrane insertion protein [Pseudovibrio sp. JE062]
          Length = 603

 Score =  468 bits (1203), Expect = e-129,   Method: Composition-based stats.
 Identities = 258/603 (42%), Positives = 371/603 (61%), Gaps = 24/603 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRI--------------------EEMNNERKNI 40
           M  N N  VAI LS++++  WQ F   P++                           +  
Sbjct: 1   MNDNRNMIVAIVLSLVVLLGWQYFIAGPQLEAQQEAQQAQLANDAQQAGSSSPVALPEGA 60

Query: 41  QTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLD 100
                    ++  AA     R QAL+ SPR+ +  PSL GS+NLKGA+ DDL L+GY   
Sbjct: 61  SGQVTAPGTESGTAAQSFVSREQALAASPRLTIDTPSLSGSVNLKGAKLDDLRLKGYRQT 120

Query: 101 VSSNSPIVTLLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWNLISGKILTPTTPIKLV 159
           ++ +S  V L SP  +   Y+AE  +V+     I+LPN+ TVW   +   LTP++PI L 
Sbjct: 121 IAKDSETVVLFSPKGSPAPYYAEHGWVADPGVQIKLPNAETVWTAETSGNLTPSSPIVLN 180

Query: 160 FKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEG 219
           + N   ++F+RT S+DE+Y+F +   V NNS   ++  P G I R+        F + EG
Sbjct: 181 WDNGEGLVFKRTFSVDENYMFTVDQEVQNNSGQNVQLYPYGLIARNGEPETAGFFVLHEG 240

Query: 220 FIAVLGDKSLVEQKYSDIEKSSISNF-HESNSWLGISDKYWASVFIPSKETSFHSQFKYL 278
            I V+GD+ L E  YSD+           +  WLG +DKYWA+  IP+  T F   F Y 
Sbjct: 241 LIGVIGDEGLQEINYSDLIDDGSIRPGRANMGWLGFTDKYWAATLIPTPGTEFQPNFSY- 299

Query: 279 SDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGW 338
           +     +Q+ +  +   ++ G  IT ++ L+AGAK    I  Y+    I  F+++IDWGW
Sbjct: 300 NARTQNFQSDYLGSATQVVDGAKITNSSLLYAGAKITSLIDGYQNSYDILNFDLMIDWGW 359

Query: 339 FYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDE 398
           FYF+ KPMF  + + Y+LVGNFGIAI+L TV VK +FFPLA K YVS + MK +QPK+ E
Sbjct: 360 FYFLTKPMFWTIDWLYSLVGNFGIAILLVTVIVKAIFFPLANKSYVSMSRMKLVQPKMTE 419

Query: 399 LREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF 458
           +REK+K    Q  Q+AM++LYKT  INPLAGC P+L+QIPVFF++YKV+ +++EMRHAPF
Sbjct: 420 IREKYKDDK-QKQQQAMMELYKTEKINPLAGCLPMLIQIPVFFSLYKVLFVTIEMRHAPF 478

Query: 459 WGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAM 518
           +GWI+DL+A DPT IF LFG++P+  P F+ +G+WP+IM ++MF+QMKM+P PA+  Q M
Sbjct: 479 FGWIQDLSAPDPTTIFNLFGLIPWDPPTFLMIGVWPLIMGITMFLQMKMNPAPAEPAQQM 538

Query: 519 ILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNY 578
           I NWMPV+F F L++FPAGL+IYW+W+N +S++QQ VIM+  G ++ L D L++TF +  
Sbjct: 539 IFNWMPVIFTFMLATFPAGLVIYWAWNNTLSVLQQGVIMRRQGVKLELFDNLKATFKRKP 598

Query: 579 NSQ 581
             +
Sbjct: 599 KEE 601


>gi|146337896|ref|YP_001202944.1| putative inner membrane protein translocase component YidC
           [Bradyrhizobium sp. ORS278]
 gi|146190702|emb|CAL74706.1| Inner membrane protein oxaA [Bradyrhizobium sp. ORS278]
          Length = 622

 Score =  468 bits (1203), Expect = e-129,   Method: Composition-based stats.
 Identities = 254/623 (40%), Positives = 365/623 (58%), Gaps = 45/623 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERK------------NIQTVKQPNQ 48
           M  N N  +A+ LS +++  WQ FY  P++E+   + +                   P+ 
Sbjct: 1   MTDNRNTILAVILSGLVLILWQVFYNGPQMEKQRAQAQLQSELAKKQGPATQPDGTAPSA 60

Query: 49  VDNSYAAVL---------------IDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLN 93
                AA                 +  R  A++ +PRV++  P L GSI+LKGA+ DDL 
Sbjct: 61  TPQPNAAASGSPSAPGGAATTATGVVPRETAIAANPRVKIDTPRLSGSISLKGARIDDLA 120

Query: 94  LRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWNLISGKILTP 152
              Y   V  NSP + L SPSNT   Y+AE  +V+ A   +++P+ NTVW       LTP
Sbjct: 121 FVQYRETVDPNSPAIVLFSPSNTAEPYYAEFGWVNAAGAKVQVPDQNTVWQQDGANALTP 180

Query: 153 TTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN 212
            TP+KL + N + + F+RTIS+D+HYLF I D VTN     +   P G I RH     + 
Sbjct: 181 ATPVKLTYTNGDGLTFQRTISVDDHYLFTIKDDVTNAGSAPVTLYPYGLISRHGTPHVSG 240

Query: 213 TFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFH 272
            + + EG I  LG+K L E  Y  ++    + F  +N WLGI+DKYWA+  +P  +    
Sbjct: 241 YYILHEGLIGYLGEKGLQEFTYKKMDDEKAAKFDITNGWLGITDKYWAAALLPMTDARLQ 300

Query: 273 SQFKYL-SDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPT---------IHHYE 322
           + +     D   RYQ  +  N  T+  G S T +  LFAGAKE            +  Y 
Sbjct: 301 ANYSSKLVDNQHRYQTDYVENPQTVPAGGSATVSTRLFAGAKEAGVVGINFPLGGLGGYN 360

Query: 323 KDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQ 382
           + L +  F++LIDWGWFYF+ KPMF+ + +F+   GNFG++I+L TV VKL F PLA K 
Sbjct: 361 QQLGLNHFDLLIDWGWFYFLTKPMFLALDFFFRFFGNFGVSILLVTVLVKLAFLPLANKS 420

Query: 383 YVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFA 442
           Y S A MK IQP++  L+E++     +  Q+ M+++YK   INP+AGC P++LQIPVFF+
Sbjct: 421 YASMAKMKAIQPQLQALKERYPDDRMK-QQQEMMEIYKKEKINPVAGCLPVVLQIPVFFS 479

Query: 443 IYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPG------FMHVGIWPII 496
           +YKV+ +++EMRHAPF GWIKDL+A DPTN+FTLFG++PF          ++ +GIWPII
Sbjct: 480 LYKVLFVTIEMRHAPFIGWIKDLSAPDPTNLFTLFGLIPFDPTQLPLFGHYLALGIWPII 539

Query: 497 MSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVI 556
           M ++M+ QMK++P P D  QAMI NWMP++F F L+ FPAGL+IYW+W+N +S++QQ+ I
Sbjct: 540 MGITMWFQMKLNPAPPDPTQAMIFNWMPLIFTFMLAGFPAGLVIYWAWNNTLSVLQQSFI 599

Query: 557 MKMHGAEIGLIDRLRSTFSKNYN 579
           M+ +G ++ L D +R TF K   
Sbjct: 600 MRRNGVKVELFDNIRGTFRKKPA 622


>gi|190890108|ref|YP_001976650.1| inner membrane transmembrane protein [Rhizobium etli CIAT 652]
 gi|254773016|sp|B3Q040|OXAA_RHIE6 RecName: Full=Inner membrane protein oxaA
 gi|190695387|gb|ACE89472.1| inner membrane transmembrane protein [Rhizobium etli CIAT 652]
          Length = 598

 Score =  468 bits (1203), Expect = e-129,   Method: Composition-based stats.
 Identities = 290/593 (48%), Positives = 394/593 (66%), Gaps = 17/593 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQP-------------- 46
           ME N NYF+AIALSV+IV  WQ  Y+ PRIE     ++  +  +Q               
Sbjct: 2   MENNRNYFIAIALSVLIVLGWQFLYMNPRIEAQRKAQEAQKAQQQTEQVQQPAAGGATPA 61

Query: 47  --NQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
             +    S  AV      QAL+ +PRV +  P+L GSINL GA+ DDL L+GYH  V  +
Sbjct: 62  PASGTAPSGQAVATATLEQALAKTPRVAIDTPALSGSINLAGARLDDLKLKGYHETVDDS 121

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           SPI+TL SP+ TK+ YF EL Y+ +     +P ++T+W    G  LT  TP+ L + N  
Sbjct: 122 SPIITLFSPAETKDGYFTELGYIGSDATGSVPGASTLWTAPEGAKLTEKTPVTLSYTNDK 181

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVL 224
            + F RTIS+DE Y+F I D V N     +  S  GR+ R+   T  + + + EGFI V+
Sbjct: 182 GLTFTRTISVDERYMFTIADKVANTGQAPVSLSSYGRVTRYNKPTTPSAYVLHEGFIGVI 241

Query: 225 GDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR 284
           GD  L+E KY+ +EK ++     +  WLGI+DKYWA+  +P + +++ ++F + SDG  R
Sbjct: 242 GDDGLIESKYTAVEKEAVMPAKSTGGWLGITDKYWAATIVPPQASAYEARFSHFSDGQPR 301

Query: 285 YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAK 344
           YQA +  +  T+ PG+S+   N +FAGAKE P I  YE   +IPRF+ LIDWGWFYFI K
Sbjct: 302 YQADYKDDAFTVAPGQSVELKNLVFAGAKEVPVIDGYEASYSIPRFDRLIDWGWFYFITK 361

Query: 345 PMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK 404
           PMF LM +F+   GNFG+AI+ TT+ VK LFFPLA KQY S ANMK +QPK++EL+ KF 
Sbjct: 362 PMFKLMDFFFRFFGNFGVAILCTTIVVKALFFPLASKQYASMANMKRMQPKMEELKAKFG 421

Query: 405 QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKD 464
                 LQ+A +QLYK   INP+AGCWP+ LQIP+FF++YKVI I++EMRHAPF+GWI+D
Sbjct: 422 D-DRMGLQQATMQLYKEEKINPIAGCWPVALQIPIFFSLYKVIYITIEMRHAPFFGWIQD 480

Query: 465 LAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMP 524
           L+A DPT I  LFG+LPF  P F+H+G+WP+IM ++MF+QM+M+P P D  QAMI NWMP
Sbjct: 481 LSAPDPTTIVNLFGLLPFTAPTFLHLGVWPLIMGVTMFLQMRMNPTPPDPTQAMIFNWMP 540

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           +VF+F L+SFPAGL+IYW+W+N +S++QQ+VIMK HG +I L D L+  F + 
Sbjct: 541 LVFMFMLASFPAGLVIYWAWNNTLSVIQQSVIMKRHGVKIELFDNLKGLFRRK 593


>gi|254712779|ref|ZP_05174590.1| putative inner membrane protein translocase component YidC
           [Brucella ceti M644/93/1]
 gi|254715848|ref|ZP_05177659.1| putative inner membrane protein translocase component YidC
           [Brucella ceti M13/05/1]
 gi|261217609|ref|ZP_05931890.1| inner membrane protein oxaA [Brucella ceti M13/05/1]
 gi|261320486|ref|ZP_05959683.1| inner membrane protein oxaA [Brucella ceti M644/93/1]
 gi|260922698|gb|EEX89266.1| inner membrane protein oxaA [Brucella ceti M13/05/1]
 gi|261293176|gb|EEX96672.1| inner membrane protein oxaA [Brucella ceti M644/93/1]
          Length = 609

 Score =  468 bits (1203), Expect = e-129,   Method: Composition-based stats.
 Identities = 267/606 (44%), Positives = 379/606 (62%), Gaps = 28/606 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQ------------------- 41
           ME   N+F+ IALS++I+  WQ FY+ P+ E    + +  +                   
Sbjct: 1   MENKRNFFITIALSILILALWQVFYLGPKTEAQREQARIEEQQRQAQQAAQNRQASSTGD 60

Query: 42  ------TVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLR 95
                          ++ AA     R  A++ SPR+E+  PSL GSINL GA+ DDL L+
Sbjct: 61  TPQMPANPDSIPGQGDTKAAGAPLTRDAAIAQSPRIEIDTPSLRGSINLTGARLDDLYLK 120

Query: 96  GYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTP 155
            YH  VS  SP + LL+PS+ K  YF EL +        +P  NTVW +     LTP+TP
Sbjct: 121 KYHETVSDKSPEIELLAPSSLKQGYFVELGFTGNDATGAVPGPNTVWVVEGNNKLTPSTP 180

Query: 156 IKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIM-RHKPQTATNTF 214
           + L + N  N+ F+R IS+D+ Y+F + DT+ NN    +  +  GR+   ++P+ A+ T+
Sbjct: 181 VTLTYTNDKNLTFKRVISVDDAYMFTVDDTIINNGGSTVSLASYGRVTRFNQPEHASATY 240

Query: 215 GVQEGFIAVLGDKSLVEQKYSD-IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHS 273
            + EG I V+G   L E KY+   +   IS       W+GI+DKYWA+  IP ++  F  
Sbjct: 241 VLHEGLIGVMGQDGLQEIKYAKIEDNKDISFKDVIGGWVGITDKYWAATLIPPQDEKFTG 300

Query: 274 QFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEML 333
           +F + ++   RYQ+   +  +T+ PG+S    N +FAGAK   TI +YE    I +F++L
Sbjct: 301 RFSHFTNDRPRYQSDLLSAPLTVAPGQSQKIQNRVFAGAKVVNTIQNYETKYHIKQFDLL 360

Query: 334 IDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQ 393
           IDWGWFYFI KPMF L+ + Y   GNFG+AI++ TV +K LFFPLA K Y S A MK +Q
Sbjct: 361 IDWGWFYFITKPMFYLIDWIYKFTGNFGVAILVVTVLLKALFFPLANKSYKSMARMKLMQ 420

Query: 394 PKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEM 453
           PK+ E+REK+     +  Q+AM++LYK   INPLAGCWP+L+QIPVFFA+YKV+ +++EM
Sbjct: 421 PKMTEIREKYADDKMK-QQQAMMELYKREKINPLAGCWPVLVQIPVFFALYKVLYVTIEM 479

Query: 454 RHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPAD 513
           RHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G+WPIIM ++MF+QM+M+P P D
Sbjct: 480 RHAPFFGWIQDLAAPDPTSIFNLFGLLPYTVPHFLMIGVWPIIMGITMFLQMRMNPTPPD 539

Query: 514 KGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRST 573
             QA I  WMP++F F L+SFPAGL+IYW+W+N +SI+QQ+VIMK  G +I L D L+  
Sbjct: 540 PTQAAIFTWMPIIFTFMLASFPAGLVIYWAWNNTLSIIQQSVIMKRQGVKIELFDNLKGL 599

Query: 574 FSKNYN 579
           F +   
Sbjct: 600 FRRKPK 605


>gi|154245865|ref|YP_001416823.1| putative inner membrane protein translocase component YidC
           [Xanthobacter autotrophicus Py2]
 gi|154159950|gb|ABS67166.1| 60 kDa inner membrane insertion protein [Xanthobacter autotrophicus
           Py2]
          Length = 616

 Score =  467 bits (1202), Expect = e-129,   Method: Composition-based stats.
 Identities = 238/617 (38%), Positives = 348/617 (56%), Gaps = 38/617 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEM---------------------NNERKN 39
           M  N N F+AI LS+ I+  WQ F+  P+ E                             
Sbjct: 1   MSDNRNMFIAIGLSLAILIGWQFFFGIPQAERQRQAAEQQRIAQQAQQPAPGATPGATPG 60

Query: 40  IQTVKQPNQVDNSYAAVLIDD--------RAQALSMSPRVELKNPSLIGSINLKGAQFDD 91
                 P     S                R +AL+++PR  ++   L GSI LKG + DD
Sbjct: 61  TTAGAAPGATPGSAGVPQAGSPVPARPLTREEALALTPRAAIETQRLKGSIALKGGRVDD 120

Query: 92  LNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILT 151
           L L  YH  V   SP + LLSPS   N ++AE  + + A    +          +   LT
Sbjct: 121 LLLTEYHETVDPKSPNIVLLSPSGAPNPFYAEFGWTAAAGTG-VKVPGPDTVWTTSGTLT 179

Query: 152 PTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTAT 211
             TP+ L + N   ++F RT ++D+HY+F + D V N +   +   P   + RH      
Sbjct: 180 EKTPLTLSWDNGAGLIFHRTYTIDDHYMFAVKDEVENKTGAAVTLYPYALVSRHGIPHVA 239

Query: 212 NTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSF 271
             + + EG I VLGD  L E  Y+ ++K     F  +  WLGI+DKYWA+  IP +    
Sbjct: 240 GFYILHEGLIGVLGDSGLQEITYAKMDKEKPHTFAATGGWLGITDKYWAATVIPDQSVKV 299

Query: 272 HSQFKYLS-DGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRF 330
            ++F   +  G   +QA + A  +T+ PG ++     LFAGAK    +  Y+    I RF
Sbjct: 300 DAKFSTSTFAGTQTFQADYLAAPLTVEPGATVAAKGQLFAGAKVVQVVDGYKTKYGIDRF 359

Query: 331 EMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMK 390
           ++LIDWGWFYFI KP+F+ + + Y LVGNFG+AI++ TV +K LFFPLA K Y S A MK
Sbjct: 360 DLLIDWGWFYFITKPLFLAIDWLYRLVGNFGVAILIITVALKGLFFPLANKSYASMAKMK 419

Query: 391 NIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISIS 450
            +QP++  +RE++     +  Q+A+++LYK   INP+AGC PI++QIPVFFA+YKV+ ++
Sbjct: 420 AVQPEVTAIRERYADDKVK-QQQALMELYKKEKINPVAGCLPIVIQIPVFFALYKVLFVT 478

Query: 451 LEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPG------FMHVGIWPIIMSLSMFIQ 504
           +EMRHAPF+GWI+DL+A DPT IF LFG++P+          ++ +G WPIIM ++M++Q
Sbjct: 479 IEMRHAPFFGWIRDLSAPDPTTIFNLFGLIPWDPSSVPVLGGYLMLGAWPIIMGITMWVQ 538

Query: 505 MKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEI 564
           MK++P P D  Q MI NWMP++F F L+ F AGL+IYW+W+N +S+ QQA+IMK +G +I
Sbjct: 539 MKLNPAPPDPTQQMIFNWMPIIFTFMLAHFAAGLVIYWAWNNTLSVSQQAMIMKRNGVKI 598

Query: 565 GLIDRLRSTFSKNYNSQ 581
            L D ++S F K   ++
Sbjct: 599 ELWDNIKSAFKKKQPAK 615


>gi|62317852|ref|YP_223705.1| putative inner membrane protein translocase component YidC
           [Brucella abortus bv. 1 str. 9-941]
 gi|83269831|ref|YP_419122.1| putative inner membrane protein translocase component YidC
           [Brucella melitensis biovar Abortus 2308]
 gi|163845137|ref|YP_001622792.1| putative inner membrane protein translocase component YidC
           [Brucella suis ATCC 23445]
 gi|189023102|ref|YP_001932843.1| putative inner membrane protein translocase component YidC
           [Brucella abortus S19]
 gi|225629472|ref|ZP_03787505.1| Inner membrane protein oxaA [Brucella ceti str. Cudo]
 gi|237817392|ref|ZP_04596384.1| Inner membrane protein oxaA [Brucella abortus str. 2308 A]
 gi|254690662|ref|ZP_05153916.1| putative inner membrane protein translocase component YidC
           [Brucella abortus bv. 6 str. 870]
 gi|254696033|ref|ZP_05157861.1| putative inner membrane protein translocase component YidC
           [Brucella abortus bv. 3 str. Tulya]
 gi|254699142|ref|ZP_05160970.1| putative inner membrane protein translocase component YidC
           [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700218|ref|ZP_05162046.1| putative inner membrane protein translocase component YidC
           [Brucella suis bv. 5 str. 513]
 gi|254705520|ref|ZP_05167348.1| putative inner membrane protein translocase component YidC
           [Brucella pinnipedialis M163/99/10]
 gi|254710751|ref|ZP_05172562.1| putative inner membrane protein translocase component YidC
           [Brucella pinnipedialis B2/94]
 gi|254732586|ref|ZP_05191164.1| putative inner membrane protein translocase component YidC
           [Brucella abortus bv. 4 str. 292]
 gi|256015782|ref|YP_003105791.1| putative inner membrane protein translocase component YidC
           [Brucella microti CCM 4915]
 gi|256029134|ref|ZP_05442748.1| putative inner membrane protein translocase component YidC
           [Brucella pinnipedialis M292/94/1]
 gi|256058817|ref|ZP_05449033.1| putative inner membrane protein translocase component YidC
           [Brucella neotomae 5K33]
 gi|256111044|ref|ZP_05452106.1| putative inner membrane protein translocase component YidC
           [Brucella melitensis bv. 3 str. Ether]
 gi|256157326|ref|ZP_05455244.1| putative inner membrane protein translocase component YidC
           [Brucella ceti M490/95/1]
 gi|256253696|ref|ZP_05459232.1| putative inner membrane protein translocase component YidC
           [Brucella ceti B1/94]
 gi|256255844|ref|ZP_05461380.1| putative inner membrane protein translocase component YidC
           [Brucella abortus bv. 9 str. C68]
 gi|260167774|ref|ZP_05754585.1| putative inner membrane protein translocase component YidC
           [Brucella sp. F5/99]
 gi|260545087|ref|ZP_05820908.1| inner membrane protein [Brucella abortus NCTC 8038]
 gi|260756233|ref|ZP_05868581.1| inner membrane protein oxaA [Brucella abortus bv. 6 str. 870]
 gi|260760398|ref|ZP_05872746.1| inner membrane protein oxaA [Brucella abortus bv. 4 str. 292]
 gi|260763638|ref|ZP_05875970.1| inner membrane protein oxaA [Brucella abortus bv. 2 str. 86/8/59]
 gi|260882057|ref|ZP_05893671.1| inner membrane protein oxaA [Brucella abortus bv. 9 str. C68]
 gi|261216465|ref|ZP_05930746.1| inner membrane protein oxaA [Brucella abortus bv. 3 str. Tulya]
 gi|261220833|ref|ZP_05935114.1| inner membrane protein oxaA [Brucella ceti B1/94]
 gi|261312924|ref|ZP_05952121.1| inner membrane protein oxaA [Brucella pinnipedialis M163/99/10]
 gi|261318319|ref|ZP_05957516.1| inner membrane protein oxaA [Brucella pinnipedialis B2/94]
 gi|261322754|ref|ZP_05961951.1| inner membrane protein oxaA [Brucella neotomae 5K33]
 gi|261750713|ref|ZP_05994422.1| inner membrane protein oxaA [Brucella suis bv. 5 str. 513]
 gi|261757211|ref|ZP_06000920.1| inner membrane protein [Brucella sp. F5/99]
 gi|265986117|ref|ZP_06098674.1| inner membrane protein oxaA [Brucella pinnipedialis M292/94/1]
 gi|265992579|ref|ZP_06105136.1| inner membrane protein oxaA [Brucella melitensis bv. 3 str. Ether]
 gi|265995811|ref|ZP_06108368.1| inner membrane protein oxaA [Brucella ceti M490/95/1]
 gi|297249212|ref|ZP_06932913.1| preprotein translocase YidC subunit [Brucella abortus bv. 5 str.
           B3196]
 gi|62198045|gb|AAX76344.1| inner-membrane protein, 60 kDa [Brucella abortus bv. 1 str. 9-941]
 gi|82940105|emb|CAJ13152.1| 60 kDa inner membrane protein [Brucella melitensis biovar Abortus
           2308]
 gi|163675860|gb|ABY39970.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|189021676|gb|ACD74397.1| 60 kDa inner membrane protein [Brucella abortus S19]
 gi|225615968|gb|EEH13017.1| Inner membrane protein oxaA [Brucella ceti str. Cudo]
 gi|237788205|gb|EEP62421.1| Inner membrane protein oxaA [Brucella abortus str. 2308 A]
 gi|255998442|gb|ACU50129.1| putative inner membrane protein translocase component YidC
           [Brucella microti CCM 4915]
 gi|260098358|gb|EEW82232.1| inner membrane protein [Brucella abortus NCTC 8038]
 gi|260670716|gb|EEX57656.1| inner membrane protein oxaA [Brucella abortus bv. 4 str. 292]
 gi|260674059|gb|EEX60880.1| inner membrane protein oxaA [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676341|gb|EEX63162.1| inner membrane protein oxaA [Brucella abortus bv. 6 str. 870]
 gi|260871585|gb|EEX78654.1| inner membrane protein oxaA [Brucella abortus bv. 9 str. C68]
 gi|260918072|gb|EEX84933.1| inner membrane protein oxaA [Brucella abortus bv. 3 str. Tulya]
 gi|260919417|gb|EEX86070.1| inner membrane protein oxaA [Brucella ceti B1/94]
 gi|261297542|gb|EEY01039.1| inner membrane protein oxaA [Brucella pinnipedialis B2/94]
 gi|261298734|gb|EEY02231.1| inner membrane protein oxaA [Brucella neotomae 5K33]
 gi|261301950|gb|EEY05447.1| inner membrane protein oxaA [Brucella pinnipedialis M163/99/10]
 gi|261737195|gb|EEY25191.1| inner membrane protein [Brucella sp. F5/99]
 gi|261740466|gb|EEY28392.1| inner membrane protein oxaA [Brucella suis bv. 5 str. 513]
 gi|262550108|gb|EEZ06269.1| inner membrane protein oxaA [Brucella ceti M490/95/1]
 gi|262763449|gb|EEZ09481.1| inner membrane protein oxaA [Brucella melitensis bv. 3 str. Ether]
 gi|264658314|gb|EEZ28575.1| inner membrane protein oxaA [Brucella pinnipedialis M292/94/1]
 gi|297173081|gb|EFH32445.1| preprotein translocase YidC subunit [Brucella abortus bv. 5 str.
           B3196]
          Length = 610

 Score =  467 bits (1202), Expect = e-129,   Method: Composition-based stats.
 Identities = 267/607 (43%), Positives = 379/607 (62%), Gaps = 29/607 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQ------------------- 41
           ME   N+F+ IALS++I+  WQ FY+ P+ E    + +  +                   
Sbjct: 1   MENKRNFFITIALSILILALWQVFYLGPKTEAQREQARIEEQQRQAQQAAQNRQASSSTG 60

Query: 42  -------TVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNL 94
                           ++ AA     R  A++ SPR+E+  PSL GSINL GA+ DDL L
Sbjct: 61  DTPQMPANPDSIPGQGDTKAAGAPLTRDAAIAQSPRIEIDTPSLRGSINLTGARLDDLYL 120

Query: 95  RGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTT 154
           + YH  VS  SP + LL+PS+ K  YF EL +        +P  NTVW +     LTP+T
Sbjct: 121 KKYHETVSDKSPEIELLAPSSLKQGYFVELGFTGNDATGAVPGPNTVWVVEGNNKLTPST 180

Query: 155 PIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIM-RHKPQTATNT 213
           P+ L + N  N+ F+R IS+D+ Y+F + DT+ NN    +  +  GR+   ++P+ A+ T
Sbjct: 181 PVTLTYTNDKNLTFKRVISVDDAYMFTVDDTIINNGGSTVSLASYGRVTRFNQPEHASAT 240

Query: 214 FGVQEGFIAVLGDKSLVEQKYSD-IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFH 272
           + + EG I V+G   L E KY+   +   IS       W+GI+DKYWA+  IP ++  F 
Sbjct: 241 YVLHEGLIGVMGQDGLQEIKYAKIEDNKDISFKDVIGGWVGITDKYWAATLIPPQDEKFT 300

Query: 273 SQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEM 332
            +F + ++   RYQ+   +  +T+ PG+S    N +FAGAK   TI +YE    I +F++
Sbjct: 301 GRFSHFTNDRPRYQSDLLSAPLTVAPGQSQKIQNRVFAGAKVVNTIQNYETKYHIKQFDL 360

Query: 333 LIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNI 392
           LIDWGWFYFI KPMF L+ + Y   GNFG+AI++ TV +K LFFPLA K Y S A MK +
Sbjct: 361 LIDWGWFYFITKPMFYLIDWIYKFTGNFGVAILVVTVLLKALFFPLANKSYKSMARMKLM 420

Query: 393 QPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLE 452
           QPK+ E+REK+     +  Q+AM++LYK   INPLAGCWP+L+QIPVFFA+YKV+ +++E
Sbjct: 421 QPKMTEIREKYADDKMK-QQQAMMELYKREKINPLAGCWPVLVQIPVFFALYKVLYVTIE 479

Query: 453 MRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPA 512
           MRHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G+WPIIM ++MF+QM+M+P P 
Sbjct: 480 MRHAPFFGWIQDLAAPDPTSIFNLFGLLPYTVPHFLMIGVWPIIMGITMFLQMRMNPTPP 539

Query: 513 DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRS 572
           D  QA I  WMP++F F L+SFPAGL+IYW+W+N +SI+QQ+VIMK  G +I L D L+ 
Sbjct: 540 DPTQAAIFTWMPIIFTFMLASFPAGLVIYWAWNNTLSIIQQSVIMKRQGVKIELFDNLKG 599

Query: 573 TFSKNYN 579
            F +   
Sbjct: 600 LFRRKPK 606


>gi|148558174|ref|YP_001257934.1| putative inner membrane protein translocase component YidC
           [Brucella ovis ATCC 25840]
 gi|148369459|gb|ABQ62331.1| inner-membrane protein, 60 kDa [Brucella ovis ATCC 25840]
          Length = 610

 Score =  467 bits (1202), Expect = e-129,   Method: Composition-based stats.
 Identities = 266/607 (43%), Positives = 379/607 (62%), Gaps = 29/607 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQ------------------- 41
           ME   N+F+ IALS++I+  WQ FY+ P+ E    + +  +                   
Sbjct: 1   MENKRNFFITIALSILILALWQVFYLGPKTEAQREQARIEEQQRQAQQAAQNRQASSSTG 60

Query: 42  -------TVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNL 94
                           ++ AA     R  A++ SPR+E+  PSL GSINL GA+ DDL L
Sbjct: 61  DTPQMPANPDSIPGQGDTKAAGAPLTRDAAIAQSPRIEIDTPSLRGSINLTGARLDDLYL 120

Query: 95  RGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTT 154
           + YH  VS  SP + LL+PS+ K  YF EL +        +P  NTVW +     LTP+T
Sbjct: 121 KKYHETVSDKSPEIELLAPSSLKQGYFVELGFAGNDATGAVPGPNTVWVVEGNNKLTPST 180

Query: 155 PIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIM-RHKPQTATNT 213
           P+ L + N  ++ F+R IS+D+ Y+F + DT+ NN    +  +  GR+   ++P+ A+ T
Sbjct: 181 PVTLTYTNDKSLTFKRVISVDDAYMFTVDDTIINNGGSTVSLASYGRVTRFNQPEHASAT 240

Query: 214 FGVQEGFIAVLGDKSLVEQKYSD-IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFH 272
           + + EG I V+G   L E KY+   +   IS       W+GI+DKYWA+  IP ++  F 
Sbjct: 241 YVLHEGLIGVMGQDGLQEIKYAKIEDNKDISFKDVIGGWVGITDKYWAATLIPPQDEKFT 300

Query: 273 SQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEM 332
            +F + ++   RYQ+   +  +T+ PG+S    N +FAGAK   TI +YE    I +F++
Sbjct: 301 GRFSHFTNDRPRYQSDLLSAPLTVAPGQSQKIQNRVFAGAKVVNTIQNYETKYHIKQFDL 360

Query: 333 LIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNI 392
           LIDWGWFYFI KPMF L+ + Y   GNFG+AI++ TV +K LFFPLA K Y S A MK +
Sbjct: 361 LIDWGWFYFITKPMFYLIDWIYKFTGNFGVAILVVTVLLKALFFPLANKSYKSMARMKLM 420

Query: 393 QPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLE 452
           QPK+ E+REK+     +  Q+AM++LYK   INPLAGCWP+L+QIPVFFA+YKV+ +++E
Sbjct: 421 QPKMTEIREKYADDKMK-QQQAMMELYKREKINPLAGCWPVLVQIPVFFALYKVLYVTIE 479

Query: 453 MRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPA 512
           MRHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G+WPIIM ++MF+QM+M+P P 
Sbjct: 480 MRHAPFFGWIQDLAAPDPTSIFNLFGLLPYTVPHFLMIGVWPIIMGITMFLQMRMNPTPP 539

Query: 513 DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRS 572
           D  QA I  WMP++F F L+SFPAGL+IYW+W+N +SI+QQ+VIMK  G +I L D L+ 
Sbjct: 540 DPTQAAIFTWMPIIFTFMLASFPAGLVIYWAWNNTLSIIQQSVIMKRQGVKIELFDNLKG 599

Query: 573 TFSKNYN 579
            F +   
Sbjct: 600 LFRRKPK 606


>gi|294853976|ref|ZP_06794648.1| preprotein translocase YidC subunit [Brucella sp. NVSL 07-0026]
 gi|294819631|gb|EFG36631.1| preprotein translocase YidC subunit [Brucella sp. NVSL 07-0026]
          Length = 610

 Score =  467 bits (1202), Expect = e-129,   Method: Composition-based stats.
 Identities = 268/607 (44%), Positives = 379/607 (62%), Gaps = 29/607 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQ------------------- 41
           ME   N+F+ IALS++I+  WQ FY+ P+ E    + +  +                   
Sbjct: 1   MENKRNFFITIALSILILALWQVFYLGPKTEAQREQARIEEQQRQAQQAAQNRQASSSTG 60

Query: 42  -------TVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNL 94
                           ++ AA     R  A++ SPR+E+  PSL GSINL GA+ DDL L
Sbjct: 61  DTPQMPANPDSIPGQGDTKAAGAPLTRDAAIAQSPRIEIDTPSLRGSINLTGARLDDLYL 120

Query: 95  RGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTT 154
           + YH  VS  SP + LL+PS+ K  YF EL +        +P  NTVW +     LTP+T
Sbjct: 121 KKYHETVSDKSPEIELLAPSSLKQGYFVELGFTGNDATGAVPGPNTVWVVEGNNKLTPST 180

Query: 155 PIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIM-RHKPQTATNT 213
           P+ L + N  N+ F+R IS+D+ Y+F + DT+ NN    +  +  GR+   ++P+ A+ T
Sbjct: 181 PVTLTYTNDKNLTFKRVISVDDAYMFTVDDTIINNGGSTVSLASYGRVTRFNQPEHASAT 240

Query: 214 FGVQEGFIAVLGDKSLVEQKYSD-IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFH 272
           + + EG I V+G   L E KYS   +   IS       W+GI+DKYWA+  IP ++  F 
Sbjct: 241 YVLHEGLIGVMGQDGLQEIKYSKIEDNKDISFKDVIGGWVGITDKYWAATLIPPQDEKFT 300

Query: 273 SQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEM 332
            +F + ++   RYQ+   +  +T+ PG+S    N +FAGAK   TI +YE    I +F++
Sbjct: 301 GRFSHFTNDRPRYQSDLLSAPLTVAPGQSQKIQNRVFAGAKVVNTIQNYETKYHIKQFDL 360

Query: 333 LIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNI 392
           LIDWGWFYFI KPMF L+ + Y   GNFG+AI++ TV +K LFFPLA K Y S A MK +
Sbjct: 361 LIDWGWFYFITKPMFYLIDWIYKFTGNFGVAILVVTVLLKALFFPLANKSYKSMARMKLM 420

Query: 393 QPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLE 452
           QPK+ E+REK+     +  Q+AM++LYK   INPLAGCWP+L+QIPVFFA+YKV+ +++E
Sbjct: 421 QPKMTEIREKYADDKMK-QQQAMMELYKREKINPLAGCWPVLVQIPVFFALYKVLYVTIE 479

Query: 453 MRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPA 512
           MRHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G+WPIIM ++MF+QM+M+P P 
Sbjct: 480 MRHAPFFGWIQDLAAPDPTSIFNLFGLLPYTVPHFLMIGVWPIIMGITMFLQMRMNPTPP 539

Query: 513 DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRS 572
           D  QA I  WMP++F F L+SFPAGL+IYW+W+N +SI+QQ+VIMK  G +I L D L+ 
Sbjct: 540 DPTQAAIFTWMPIIFTFMLASFPAGLVIYWAWNNTLSIIQQSVIMKRQGVKIELFDNLKG 599

Query: 573 TFSKNYN 579
            F +   
Sbjct: 600 LFRRKPK 606


>gi|144899247|emb|CAM76111.1| 60 kDa inner membrane insertion protein [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 575

 Score =  467 bits (1202), Expect = e-129,   Method: Composition-based stats.
 Identities = 218/577 (37%), Positives = 332/577 (57%), Gaps = 15/577 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVD--------NS 52
           M    N F+AIALSV+I++ +Q  +        +                         +
Sbjct: 1   MNEQRNLFLAIALSVLILFGFQWLFPSKTPAPESAPATTAAGTPPVPTSGDAVVPAPVQT 60

Query: 53  YAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLS 112
            A + +  R  AL+ + R+ +  P+L GS+++ GA+ DDL L GYH      S  + LLS
Sbjct: 61  AAQMAVKSRTDALATAKRIRINTPTLHGSLSVTGARLDDLTLAGYHETADPTSKEIELLS 120

Query: 113 PSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTI 172
           P+   + Y AE  +V     ++ P  +TVW++  G  L+P + + L + N + + F RT+
Sbjct: 121 PTGAAHPYHAEFGWVPVDAGVKTPGPDTVWSVAQGNELSPGSTVVLNWDNGDGLRFVRTV 180

Query: 173 SLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ 232
           S+DE+Y+F+I   V N     +   P G I R         + + EG + V    +L E 
Sbjct: 181 SVDENYMFQIAQRVENYGTKPVTLHPFGLISRTGTPKTEGMYILHEGPLGVFD-GTLKEH 239

Query: 233 KYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLS-DGHARYQAKFSA 291
           KY D++K S      +  W+GI+DKYW +  +P ++     +F +   D   RYQ  F+ 
Sbjct: 240 KYDDLKKLSTERNKTTGGWIGITDKYWLTALVPDQKEELTGRFVHQRADNADRYQVDFTG 299

Query: 292 NEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMS 351
               + PG +  TT  LFAGAK    + HY +   + RF++ ID+GWFYF+ KP F L+ 
Sbjct: 300 AAKVVAPGAAAETTFHLFAGAKLVSLLDHYTEKFGVERFDLAIDFGWFYFLTKPFFYLLK 359

Query: 352 YFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVL 411
              + +GN G+AI+  TV +K + FPLA K Y S + MK +QP++  L+E+F       L
Sbjct: 360 MMNSGLGNMGLAILALTVLIKGIMFPLANKSYASMSKMKLLQPQVKALQERFGDDKV-RL 418

Query: 412 QKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPT 471
           Q+ M+ LYK   +NP++GC PIL+QIPVFFA+YKV+ +++EMRHAPF+GWIKDL+A DPT
Sbjct: 419 QQEMMALYKKEKVNPVSGCLPILIQIPVFFALYKVLFVAIEMRHAPFYGWIKDLSAQDPT 478

Query: 472 NIFTLFGILPFYL----PGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVF 527
            I  LFG++P+      P F+H+G+WP+IM  +M++Q K++P P D  QA ++ ++PVVF
Sbjct: 479 TIMNLFGLIPWDPALYLPAFLHIGVWPLIMGATMWLQQKLNPQPLDPVQAKMMMFLPVVF 538

Query: 528 VFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEI 564
            F L  F AGL+IYW+WSN++SI QQ VIM+ +G + 
Sbjct: 539 TFMLGQFAAGLVIYWAWSNILSIAQQWVIMRKYGVKP 575


>gi|23500746|ref|NP_700186.1| putative inner membrane protein translocase component YidC
           [Brucella suis 1330]
 gi|38503028|sp|Q8FV29|OXAA_BRUSU RecName: Full=Inner membrane protein oxaA
 gi|23464400|gb|AAN34191.1| inner-membrane protein, 60 kDa [Brucella suis 1330]
          Length = 610

 Score =  467 bits (1202), Expect = e-129,   Method: Composition-based stats.
 Identities = 267/607 (43%), Positives = 379/607 (62%), Gaps = 29/607 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQ------------------- 41
           ME   N+F+ IALS++I+  WQ FY+ P+ E    + +  +                   
Sbjct: 1   MENKRNFFITIALSILILALWQVFYLGPKTEAQREQARIEEQQRQAQQAAQNRQASSSTG 60

Query: 42  -------TVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNL 94
                           ++ AA     R  A++ SPR+E+  PSL GSINL GA+ DDL L
Sbjct: 61  DTPQMPANPDSIPGQGDTKAAGAPLTRDAAIAQSPRIEIDTPSLRGSINLTGARLDDLYL 120

Query: 95  RGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTT 154
           + YH  VS  SP + LL+PS+ K  YF EL +        +P  NTVW +     LTP+T
Sbjct: 121 KKYHETVSDKSPEIELLAPSSLKQGYFVELGFTGNDATGAVPGPNTVWVVEGNNKLTPST 180

Query: 155 PIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIM-RHKPQTATNT 213
           P+ L + N  N+ F+R IS+D+ Y+F + DT+ NN    +  +  GR+   ++P+ A+ T
Sbjct: 181 PVTLTYTNDKNLTFKRVISVDDAYMFTVDDTIINNGGSTVSLASYGRVTRFNQPEHASAT 240

Query: 214 FGVQEGFIAVLGDKSLVEQKYSD-IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFH 272
           + + EG I V+G   L E KY+   +   IS       W+GI+DKYWA+  IP ++  F 
Sbjct: 241 YVLHEGLIGVMGQDGLQEIKYAKIKDNKDISFKDVIGGWVGITDKYWAATLIPPQDEKFT 300

Query: 273 SQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEM 332
            +F + ++   RYQ+   +  +T+ PG+S    N +FAGAK   TI +YE    I +F++
Sbjct: 301 GRFSHFTNDRPRYQSDLLSAPLTVAPGQSQKIQNRVFAGAKVVNTIQNYETKYHIKQFDL 360

Query: 333 LIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNI 392
           LIDWGWFYFI KPMF L+ + Y   GNFG+AI++ TV +K LFFPLA K Y S A MK +
Sbjct: 361 LIDWGWFYFITKPMFYLIDWIYKFTGNFGVAILVVTVLLKALFFPLANKSYKSMARMKLM 420

Query: 393 QPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLE 452
           QPK+ E+REK+     +  Q+AM++LYK   INPLAGCWP+L+QIPVFFA+YKV+ +++E
Sbjct: 421 QPKMTEIREKYADDKMK-QQQAMMELYKREKINPLAGCWPVLVQIPVFFALYKVLYVTIE 479

Query: 453 MRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPA 512
           MRHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G+WPIIM ++MF+QM+M+P P 
Sbjct: 480 MRHAPFFGWIQDLAAPDPTSIFNLFGLLPYTVPHFLMIGVWPIIMGITMFLQMRMNPTPP 539

Query: 513 DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRS 572
           D  QA I  WMP++F F L+SFPAGL+IYW+W+N +SI+QQ+VIMK  G +I L D L+ 
Sbjct: 540 DPTQAAIFTWMPIIFTFMLASFPAGLVIYWAWNNTLSIIQQSVIMKRQGVKIELFDNLKG 599

Query: 573 TFSKNYN 579
            F +   
Sbjct: 600 LFRRKPK 606


>gi|306846225|ref|ZP_07478787.1| inner membrane protein translocase component YidC [Brucella sp.
           BO1]
 gi|306273476|gb|EFM55337.1| inner membrane protein translocase component YidC [Brucella sp.
           BO1]
          Length = 610

 Score =  467 bits (1200), Expect = e-129,   Method: Composition-based stats.
 Identities = 267/607 (43%), Positives = 380/607 (62%), Gaps = 29/607 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQ------------------- 41
           ME   N+F+ IALS++I+  WQ FY+ P+ E    + +  +                   
Sbjct: 1   MENKRNFFITIALSILILTLWQVFYLGPKTEAQREQARIEEQQRQAQQAAQNRQASSSTG 60

Query: 42  -------TVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNL 94
                           ++ AA     R  A++ SPR+E+  PSL GSINL GA+ DDL L
Sbjct: 61  DTPQMPANPDSIPGQGDTKAAGAPLTRDAAIAQSPRIEIDTPSLRGSINLTGARLDDLYL 120

Query: 95  RGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTT 154
           + YH  VS  SP + LL+PS+ K  YF EL +        +P  NTVW +   K LTP+T
Sbjct: 121 KKYHETVSDKSPEIELLAPSSLKQGYFVELGFTGNDATGTVPGPNTVWVVEGNKKLTPST 180

Query: 155 PIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIM-RHKPQTATNT 213
           P+ L + N  N+ F+R IS+D+ Y+F + DT+ N+    +  +  GR+   ++P+ A+ T
Sbjct: 181 PVTLTYTNDKNLTFKRVISVDDAYMFTVDDTIINDGGSTVSLASYGRVTRFNQPEHASAT 240

Query: 214 FGVQEGFIAVLGDKSLVEQKYSD-IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFH 272
           + + EG I V+G   L E KY+   +   IS       W+GI+DKYWA+  IP ++  F 
Sbjct: 241 YVLHEGLIGVMGQDGLQEIKYAKIEDNKDISFKDVIGGWVGITDKYWAATLIPPQDEKFT 300

Query: 273 SQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEM 332
            +F + ++   RYQ+   +  +T+ PG+S    N +FAGAK   TI +YE    I +F++
Sbjct: 301 GRFSHFTNDRPRYQSDLLSAPLTVAPGQSQKIQNRVFAGAKVVNTIQNYETKYHIKQFDL 360

Query: 333 LIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNI 392
           LIDWGWFYFI KPMF L+ + Y   GNFG+AI++ TV +K LFFPLA K Y S A MK +
Sbjct: 361 LIDWGWFYFITKPMFYLIDWIYKFTGNFGVAILVVTVLLKALFFPLANKSYKSMARMKLM 420

Query: 393 QPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLE 452
           QPK+ E+REK+     +  Q+AM++LYK   INPLAGCWP+L+QIPVFFA+YKV+ +++E
Sbjct: 421 QPKMTEIREKYADDKMK-QQQAMMELYKREKINPLAGCWPVLVQIPVFFALYKVLYVTIE 479

Query: 453 MRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPA 512
           MRHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G+WPIIM ++MF+QM+M+P P 
Sbjct: 480 MRHAPFFGWIQDLAAPDPTSIFNLFGLLPYTVPHFLMIGVWPIIMGITMFLQMRMNPTPP 539

Query: 513 DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRS 572
           D  QA I  WMP++F F L+SFPAGL+IYW+W+N +SI+QQ+VIMK  G +I L D L+ 
Sbjct: 540 DPTQAAIFTWMPIIFTFMLASFPAGLVIYWAWNNTLSIIQQSVIMKRQGVKIELFDNLKG 599

Query: 573 TFSKNYN 579
            F +   
Sbjct: 600 LFRRKPK 606


>gi|254720149|ref|ZP_05181960.1| putative inner membrane protein translocase component YidC
           [Brucella sp. 83/13]
 gi|265985155|ref|ZP_06097890.1| inner membrane protein oxaA [Brucella sp. 83/13]
 gi|306839545|ref|ZP_07472352.1| inner membrane protein translocase component YidC [Brucella sp. NF
           2653]
 gi|264663747|gb|EEZ34008.1| inner membrane protein oxaA [Brucella sp. 83/13]
 gi|306405377|gb|EFM61649.1| inner membrane protein translocase component YidC [Brucella sp. NF
           2653]
          Length = 610

 Score =  467 bits (1200), Expect = e-129,   Method: Composition-based stats.
 Identities = 266/607 (43%), Positives = 379/607 (62%), Gaps = 29/607 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQ------------------- 41
           ME   N+F+ IALS++I+  WQ FY+ P+ E    + +  +                   
Sbjct: 1   MENKRNFFITIALSILILALWQVFYLGPKTEAQREQARIEEQQRQAQQAAQNRQASSSTG 60

Query: 42  -------TVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNL 94
                           ++ AA     R  A++ SPR+E+  PSL GSINL GA+ DDL L
Sbjct: 61  DTPQMPANPDSIPGQGDTKAAGAPLTRDAAIAQSPRIEIDTPSLRGSINLTGARLDDLYL 120

Query: 95  RGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTT 154
           + YH  VS  SP + LL+PS+ K  YF EL +        +P  NTVW +     LTP+T
Sbjct: 121 KKYHETVSDKSPEIELLAPSSLKQGYFVELGFTGNDATGTVPGPNTVWVVEGNNKLTPST 180

Query: 155 PIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIM-RHKPQTATNT 213
           P+ L + N  N+ F+R IS+D+ Y+F + DT+ N+    +  +  GR+   ++P+ A+ T
Sbjct: 181 PVTLTYTNDKNLTFKRVISVDDAYMFTVDDTIINDGGSTVSLASYGRVTRFNQPEHASAT 240

Query: 214 FGVQEGFIAVLGDKSLVEQKYSD-IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFH 272
           + + EG I V+G   L E KY+   +   IS       W+GI+DKYWA+  IP ++  F 
Sbjct: 241 YVLHEGLIGVMGQDGLQEIKYAKIEDNKDISFKDVIGGWVGITDKYWAATLIPPQDEKFT 300

Query: 273 SQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEM 332
            +F + ++   RYQ+   +  +T+ PG+S    N +FAGAK   TI +YE    I +F++
Sbjct: 301 GRFSHFTNDRPRYQSDLLSAPLTVAPGQSQKIQNRVFAGAKVVNTIQNYETKYHIKQFDL 360

Query: 333 LIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNI 392
           LIDWGWFYFI KPMF L+ + Y   GNFG+AI++ TV +K LFFPLA K Y S A MK +
Sbjct: 361 LIDWGWFYFITKPMFYLIDWIYKFTGNFGVAILVVTVLLKALFFPLANKSYKSMARMKLM 420

Query: 393 QPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLE 452
           QPK+ E+REK+     +  Q+AM++LYK   INPLAGCWP+L+QIPVFFA+YKV+ +++E
Sbjct: 421 QPKMTEIREKYADDKMK-QQQAMMELYKREKINPLAGCWPVLVQIPVFFALYKVLYVTIE 479

Query: 453 MRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPA 512
           MRHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G+WPIIM ++MF+QM+M+P P 
Sbjct: 480 MRHAPFFGWIQDLAAPDPTSIFNLFGLLPYTVPHFLMIGVWPIIMGITMFLQMRMNPTPP 539

Query: 513 DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRS 572
           D  QA I  WMP++F F L+SFPAGL+IYW+W+N +SI+QQ+VIMK  G +I L D L+ 
Sbjct: 540 DPTQAAIFTWMPIIFTFMLASFPAGLVIYWAWNNTLSIIQQSVIMKRQGVKIELFDNLKG 599

Query: 573 TFSKNYN 579
            F +   
Sbjct: 600 LFRRKPK 606


>gi|90422337|ref|YP_530707.1| putative inner membrane protein translocase component YidC
           [Rhodopseudomonas palustris BisB18]
 gi|90104351|gb|ABD86388.1| protein translocase subunit yidC [Rhodopseudomonas palustris
           BisB18]
          Length = 632

 Score =  467 bits (1200), Expect = e-129,   Method: Composition-based stats.
 Identities = 245/629 (38%), Positives = 359/629 (57%), Gaps = 50/629 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDN--------- 51
           M  N N  +A+ LS +++  WQ F+  P++E+        ++                  
Sbjct: 1   MTDNRNTILAVILSGLVLLGWQYFFNIPQMEKQRAAELASKSQAVNPAQPQGAQPATPAA 60

Query: 52  -----------------------SYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQ 88
                                    A   +  R  AL+ SPRV++  P L GSI LKGA+
Sbjct: 61  PGAAIPQPNAATAPAGSAPNAIQPQANTPVVSREAALAASPRVKIDTPRLSGSIALKGAR 120

Query: 89  FDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNI-ELPNSNTVWNLISG 147
            DD+ L  +   V   SP + L SPS + N Y+AE  +V+ A    ++P+ NT W     
Sbjct: 121 IDDIALVQFRETVDPKSPAIELFSPSGSANPYYAEFGWVAAAGTSVKIPDQNTQWEQDGT 180

Query: 148 KILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKP 207
             LTP  P+ L + N   + F RTI++DE YLF + D VTN     +   P   I RH  
Sbjct: 181 GSLTPNHPVTLKYDNGEGLTFRRTITIDERYLFTMKDEVTNVGNAPVTLYPFALISRHGT 240

Query: 208 QTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSK 267
                 + + EG +  LG++ L E  YS I+++   NF  +N WLGI+DKYWA+  +P  
Sbjct: 241 PHVAGYYILHEGLVGYLGEQGLQEYGYSKIDEAKAVNFKVTNGWLGITDKYWAAALLPDT 300

Query: 268 ETSFHSQFKYL-SDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPT--------- 317
                ++F    ++    YQ  +  +  TI  G + T    LFAGAKE  T         
Sbjct: 301 SAQLQARFSSNLANNVRTYQTDYLQDAQTIAIGGTGTANARLFAGAKEAGTVGINFPALG 360

Query: 318 IHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFP 377
           +  Y KDL +  F++LIDWGWFYFI KPMF+ + +F++LVGNFGIAI+L TV +KLLF P
Sbjct: 361 LGGYNKDLGLNHFDLLIDWGWFYFITKPMFVALDFFFHLVGNFGIAILLVTVIIKLLFLP 420

Query: 378 LAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQI 437
           LA K Y S A MK IQP++  L+E+      +  Q+ M+++Y+   INP+AGC P+LLQI
Sbjct: 421 LANKSYASMAKMKAIQPQLAALKERHPDDKAK-QQQEMMEIYRKEKINPVAGCLPVLLQI 479

Query: 438 PVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPG------FMHVG 491
           PVFF++YKV+ +++EMRHAPF+GWI DL+A DPTN+F LFG+L F          ++ +G
Sbjct: 480 PVFFSLYKVLFVTIEMRHAPFYGWIHDLSAPDPTNLFNLFGLLAFDPTHVPVIGHYLVLG 539

Query: 492 IWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIV 551
            WPI+M ++M++QMK++P P D  Q MI  WMP++F F L+SFPAGL+IYW+W+N++S+V
Sbjct: 540 AWPIVMGITMWVQMKLNPTPPDPTQQMIFAWMPLIFTFMLASFPAGLVIYWAWNNLLSVV 599

Query: 552 QQAVIMKMHGAEIGLIDRLRSTFSKNYNS 580
           QQ  IM+ +G ++ L D L+++F++   +
Sbjct: 600 QQGYIMRRNGVKVELFDNLKASFARKKKN 628


>gi|161621071|ref|YP_001594957.1| putative inner membrane protein translocase component YidC
           [Brucella canis ATCC 23365]
 gi|254703339|ref|ZP_05165167.1| putative inner membrane protein translocase component YidC
           [Brucella suis bv. 3 str. 686]
 gi|260567731|ref|ZP_05838200.1| inner membrane protein oxaA [Brucella suis bv. 4 str. 40]
 gi|261753969|ref|ZP_05997678.1| inner membrane protein oxaA [Brucella suis bv. 3 str. 686]
 gi|161337882|gb|ABX64186.1| Inner membrane protein oxaA [Brucella canis ATCC 23365]
 gi|260154396|gb|EEW89477.1| inner membrane protein oxaA [Brucella suis bv. 4 str. 40]
 gi|261743722|gb|EEY31648.1| inner membrane protein oxaA [Brucella suis bv. 3 str. 686]
          Length = 610

 Score =  467 bits (1200), Expect = e-129,   Method: Composition-based stats.
 Identities = 267/607 (43%), Positives = 379/607 (62%), Gaps = 29/607 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQ------------------- 41
           ME   N+F+ IALS++I+  WQ FY+ P+ E    + +  +                   
Sbjct: 1   MENKRNFFITIALSILILALWQVFYLGPKTEVQREQARIEEQQRQAQQAAQNRQASSSTG 60

Query: 42  -------TVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNL 94
                           ++ AA     R  A++ SPR+E+  PSL GSINL GA+ DDL L
Sbjct: 61  DTPQMPANPDSIPGQGDTKAAGAPLTRDAAIAQSPRIEIDTPSLRGSINLTGARLDDLYL 120

Query: 95  RGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTT 154
           + YH  VS  SP + LL+PS+ K  YF EL +        +P  NTVW +     LTP+T
Sbjct: 121 KKYHETVSDKSPEIELLAPSSLKQGYFVELGFTGNDATGAVPGPNTVWVVEGNNKLTPST 180

Query: 155 PIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIM-RHKPQTATNT 213
           P+ L + N  N+ F+R IS+D+ Y+F + DT+ NN    +  +  GR+   ++P+ A+ T
Sbjct: 181 PVTLTYTNDKNLTFKRVISVDDAYMFTVDDTIINNGGSTVSLASYGRVTRFNQPEHASAT 240

Query: 214 FGVQEGFIAVLGDKSLVEQKYSD-IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFH 272
           + + EG I V+G   L E KY+   +   IS       W+GI+DKYWA+  IP ++  F 
Sbjct: 241 YVLHEGLIGVMGQDGLQEIKYAKIKDNKDISFKDVIGGWVGITDKYWAATLIPPQDEKFT 300

Query: 273 SQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEM 332
            +F + ++   RYQ+   +  +T+ PG+S    N +FAGAK   TI +YE    I +F++
Sbjct: 301 GRFSHFTNDRPRYQSDLLSAPLTVAPGQSQKIQNRVFAGAKVVNTIQNYETKYHIKQFDL 360

Query: 333 LIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNI 392
           LIDWGWFYFI KPMF L+ + Y   GNFG+AI++ TV +K LFFPLA K Y S A MK +
Sbjct: 361 LIDWGWFYFITKPMFYLIDWIYKFTGNFGVAILVVTVLLKALFFPLANKSYKSMARMKLM 420

Query: 393 QPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLE 452
           QPK+ E+REK+     +  Q+AM++LYK   INPLAGCWP+L+QIPVFFA+YKV+ +++E
Sbjct: 421 QPKMTEIREKYADDKMK-QQQAMMELYKREKINPLAGCWPVLVQIPVFFALYKVLYVTIE 479

Query: 453 MRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPA 512
           MRHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G+WPIIM ++MF+QM+M+P P 
Sbjct: 480 MRHAPFFGWIQDLAAPDPTSIFNLFGLLPYTVPHFLMIGVWPIIMGITMFLQMRMNPTPP 539

Query: 513 DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRS 572
           D  QA I  WMP++F F L+SFPAGL+IYW+W+N +SI+QQ+VIMK  G +I L D L+ 
Sbjct: 540 DPTQAAIFTWMPIIFTFMLASFPAGLVIYWAWNNTLSIIQQSVIMKRQGVKIELFDNLKG 599

Query: 573 TFSKNYN 579
            F +   
Sbjct: 600 LFRRKPK 606


>gi|114765427|ref|ZP_01444542.1| putative inner membrane protein translocase component YidC
           [Pelagibaca bermudensis HTCC2601]
 gi|114542270|gb|EAU45300.1| putative inner membrane protein translocase component YidC
           [Roseovarius sp. HTCC2601]
          Length = 611

 Score =  466 bits (1199), Expect = e-129,   Method: Composition-based stats.
 Identities = 206/606 (33%), Positives = 326/606 (53%), Gaps = 29/606 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNI------QTVKQPNQVDNSYAA 55
           ++N N  +A  LS +++  W   +  P  +  +    N        T   P+   ++   
Sbjct: 3   DQNKNLLIATGLSFVVILVWFLLFPPPEEQLQDQAGPNAVETVEGDTATTPSAAPSATTG 62

Query: 56  VLIDDRAQALSM---SPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLS 112
                 A A +    +PRV +    L GSI+L G + D+L L+ Y + +  +SP V +L 
Sbjct: 63  GGDTAAAPAQAETVDAPRVAIDTDRLGGSISLTGGRIDELILKDYTVTLDEDSPNVQILE 122

Query: 113 PSNTKNAYFAELDYVSTANN--IELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFER 170
           P    N Y+A   +   +     ++P +NT W L SG  L+  +P+ L + +   ++F R
Sbjct: 123 PVGGGNPYYALYGWAPGSGLGLDDVPGANTAWELESGDSLSVDSPVTLRWDSPAGLVFRR 182

Query: 171 TISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLV 230
           TIS+DE ++F +  +V N     +  +P G I RH        F V    +  + D  L 
Sbjct: 183 TISIDEDFMFSVTQSVENAGEGTVSAAPYGIIARHGEPADLKNFFVLHEGVVAIADGKLS 242

Query: 231 EQKYSDIEKSSISN---------FHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDG 281
           E  YSD+    ++              N W+G +D YW +  IP +   F    KY  + 
Sbjct: 243 EIGYSDMPDMDVNQSEGARAEVTQVTENGWIGFTDHYWMTTLIPQQGAPFKQAAKY-DER 301

Query: 282 HARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYF 341
              YQ +     +T+ PG++   T  LFAGAKE+ TI  Y +D  + RF   IDWGWF+F
Sbjct: 302 RDIYQTEAVLPTMTLAPGETQEVTTQLFAGAKEYETIRDY-EDAGVVRFIDSIDWGWFFF 360

Query: 342 IAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELRE 401
           + KP+F ++   + L+GN G +I+  T+ +K + FPLA K YVS A MK +QP++++L+E
Sbjct: 361 LTKPIFWMLHQIHLLIGNMGWSIIGLTLIIKAILFPLAYKSYVSMAKMKELQPEMEKLKE 420

Query: 402 KFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGW 461
           K      Q LQ+ M+ LYK   +NP +GC PILLQIP+FF++YKVI ++ E+RHAP++G 
Sbjct: 421 KAGD-DRQKLQQEMMALYKKEKVNPASGCLPILLQIPIFFSLYKVIFVAFELRHAPWFGP 479

Query: 462 IKDLAAADPTNIFTLFGILPFYLPG------FMHVGIWPIIMSLSMFIQMKMSPPPADKG 515
            +DL+  DPT++F LFG+LP+  P        + +GI P+++ +SM++Q K++P PAD  
Sbjct: 480 FQDLSTPDPTSLFNLFGLLPWAAPAPGTTLALVFIGILPLLLGISMWLQQKLNPAPADPT 539

Query: 516 QAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFS 575
           Q MI  WMP VF+F L  F +GL++YW  +N I+  QQ +IM+  G +  +   + S F 
Sbjct: 540 QKMIFAWMPWVFMFMLGGFASGLVVYWITNNTITFTQQYLIMRSQGYKPDVFGNIVSGFK 599

Query: 576 KNYNSQ 581
           +   + 
Sbjct: 600 RKPKAD 605


>gi|304392412|ref|ZP_07374353.1| inner membrane protein OxaA [Ahrensia sp. R2A130]
 gi|303295516|gb|EFL89875.1| inner membrane protein OxaA [Ahrensia sp. R2A130]
          Length = 612

 Score =  466 bits (1198), Expect = e-129,   Method: Composition-based stats.
 Identities = 257/612 (41%), Positives = 368/612 (60%), Gaps = 32/612 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N+ +A  LS+ +V+AWQ   + PR+E      +  Q V++    +          
Sbjct: 1   MDNQRNFILAAVLSLGVVFAWQALVINPRMEAERAAIEAQQKVEEARTAEAESVPGATTA 60

Query: 61  RAQALSMSP----------------------------RVELKNPSLIGSINLKGAQFDDL 92
                                                RV L +P L GS+NL+G + DDL
Sbjct: 61  PQTGAEAGAGVPAGQATSGDGAVPGAAPAASAQSSAGRVPLASPRLEGSVNLQGGRIDDL 120

Query: 93  NLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTP 152
            L  Y   V   SP + LL+P+   +AYFAE  Y       +LP  +T+W L +G+ LTP
Sbjct: 121 RLLDYRETVDDTSPNIQLLTPAGNPDAYFAEFGYSPNEAAGQLPGPSTIWQLAAGERLTP 180

Query: 153 TTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN 212
            T I L + N   + F RTI++D+ Y+F I   V N S   +   P GRI R+       
Sbjct: 181 ETSISLQYVNDKGLTFTRTIAMDDDYMFTIEQRVKNESGTDVSLRPYGRIARYGKPETAG 240

Query: 213 TFGVQEGFIAVLGDKSLVEQKYSDIEKSS-ISNFHESNSWLGISDKYWASVFIPS--KET 269
            + + EG I  +G++ L E  Y DIE    I+    S+ WLGI+DKYWA+  IP      
Sbjct: 241 IYVLHEGLIGSVGEQGLDEVDYGDIEDDKRITKEPASSGWLGITDKYWATALIPQTKDGG 300

Query: 270 SFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPR 329
           +F + + Y S G   YQ+ + A+ ++I  G+    T   FAGAK+   I  Y ++L IP 
Sbjct: 301 TFTAHYNYYSAGTPFYQSDYLASALSIPNGQEQGVTTRFFAGAKKVDIIDAYAENLEIPL 360

Query: 330 FEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANM 389
           F+ +IDWGWFY++ KP+F+LM++ Y+L+GNFG+AI++ TV VK +FFPLA K Y S ANM
Sbjct: 361 FDKIIDWGWFYWLTKPLFLLMNWVYHLIGNFGVAILVVTVLVKAVFFPLANKSYASMANM 420

Query: 390 KNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISI 449
           K +QP++  +RE+ K    +  Q AM++LYK   INP AGCWP+L+QIPVFFAIYKVI +
Sbjct: 421 KKVQPQMTAIREQHKD-DAKAQQAAMMKLYKEEKINPAAGCWPVLIQIPVFFAIYKVIYV 479

Query: 450 SLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSP 509
           ++EMRHAPF+GWI+DL+A DPT+IF LFG+LPF +P F+ +G+WP++M ++MF+QM+M+P
Sbjct: 480 TIEMRHAPFFGWIQDLSAPDPTSIFNLFGLLPFEVPLFLMIGVWPLLMGITMFVQMQMNP 539

Query: 510 PPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDR 569
            P D  QAMI  W+PVVF F L++FPAGL+IYW+W+N +SI+QQ +IMK  GA+I L D 
Sbjct: 540 APPDPTQAMIFKWLPVVFTFMLATFPAGLVIYWAWNNFLSIIQQGLIMKRQGAKIELWDN 599

Query: 570 LRSTFSKNYNSQ 581
           L+  FSK  +++
Sbjct: 600 LKGIFSKKTDAE 611


>gi|161511178|ref|NP_541252.2| putative inner membrane protein translocase component YidC
           [Brucella melitensis bv. 1 str. 16M]
 gi|256043891|ref|ZP_05446811.1| putative inner membrane protein translocase component YidC
           [Brucella melitensis bv. 1 str. Rev.1]
 gi|260565068|ref|ZP_05835553.1| inner membrane protein oxaA [Brucella melitensis bv. 1 str. 16M]
 gi|265990314|ref|ZP_06102871.1| inner membrane protein oxaA [Brucella melitensis bv. 1 str. Rev.1]
 gi|38503114|sp|Q8YDA3|OXAA_BRUME RecName: Full=Inner membrane protein oxaA
 gi|260152711|gb|EEW87804.1| inner membrane protein oxaA [Brucella melitensis bv. 1 str. 16M]
 gi|263000983|gb|EEZ13673.1| inner membrane protein oxaA [Brucella melitensis bv. 1 str. Rev.1]
          Length = 610

 Score =  464 bits (1194), Expect = e-128,   Method: Composition-based stats.
 Identities = 267/607 (43%), Positives = 378/607 (62%), Gaps = 29/607 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQ------------------- 41
           ME   N+F+ IALS++I+  WQ FY+ P+ E    + +  +                   
Sbjct: 1   MENKRNFFITIALSILILALWQVFYLGPKTEAQREQARIEEQQRQAQQAAQNRQASSSTG 60

Query: 42  -------TVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNL 94
                           ++ AA     R  A++ SPR+E+  PSL GSINL GA+ DDL L
Sbjct: 61  DTPQMPANPDSIPGQGDTKAAGAPLTRDAAIAQSPRIEIDTPSLRGSINLTGARLDDLYL 120

Query: 95  RGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTT 154
           + YH  VS  SP + LL+PS+ K  YF EL +        +P  NTVW +     LTP+T
Sbjct: 121 KKYHETVSDKSPEIELLAPSSLKQGYFVELGFTGNDATGAVPGPNTVWVVEGNNKLTPST 180

Query: 155 PIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIM-RHKPQTATNT 213
           P+ L + N  N+ F+R IS+D+ Y+F + DT+ NN    +  +  GR+   ++P+ A+ T
Sbjct: 181 PVTLTYTNDKNLTFKRVISVDDAYMFTVDDTIINNGGSTVSLASYGRVTRFNQPEHASAT 240

Query: 214 FGVQEGFIAVLGDKSLVEQKYSD-IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFH 272
           + + EG I V+G   L E KY+   +   IS       W+GI+DKYWA+  IP ++  F 
Sbjct: 241 YVLHEGLIGVMGQDGLQEIKYAKIEDNKDISFKDVIGGWVGITDKYWAATLIPPQDEKFT 300

Query: 273 SQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEM 332
            +F + ++   RYQ+   +  +T+ PG+S    N +FAGAK   TI +YE    I +F++
Sbjct: 301 GRFSHFTNDRPRYQSDLLSAPLTVAPGQSQKIQNRVFAGAKVVNTIQNYETKYHIKQFDL 360

Query: 333 LIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNI 392
           LIDWGWFYFI KPMF L+ + Y   GNFG+AI++ TV +K LFFPLA K Y S A MK +
Sbjct: 361 LIDWGWFYFITKPMFYLIDWIYKFTGNFGVAILVVTVLLKALFFPLANKSYKSMARMKLM 420

Query: 393 QPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLE 452
           QPK+ E+REK+     +  Q+AM++LYK   INPLAGCWP+L+QIPVFFA+YKV+ +++E
Sbjct: 421 QPKMTEIREKYADDKMK-QQQAMMELYKREKINPLAGCWPVLVQIPVFFALYKVLYVTIE 479

Query: 453 MRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPA 512
           MRHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G+WPIIM + MF+QM+M+P P 
Sbjct: 480 MRHAPFFGWIQDLAAPDPTSIFNLFGLLPYTVPHFLMIGVWPIIMGIIMFLQMRMNPTPP 539

Query: 513 DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRS 572
           D  QA I  WMP++F F L+SFPAGL+IYW+W+N +SI+QQ+VIMK  G +I L D L+ 
Sbjct: 540 DPTQAAIFTWMPIIFTFMLASFPAGLVIYWAWNNTLSIIQQSVIMKRQGVKIELFDNLKG 599

Query: 573 TFSKNYN 579
            F +   
Sbjct: 600 LFRRKPK 606


>gi|159042884|ref|YP_001531678.1| putative inner membrane protein translocase component YidC
           [Dinoroseobacter shibae DFL 12]
 gi|189036349|sp|A8LMA0|OXAA_DINSH RecName: Full=Inner membrane protein oxaA
 gi|157910644|gb|ABV92077.1| preprotein translocase subunit [Dinoroseobacter shibae DFL 12]
          Length = 606

 Score =  464 bits (1194), Expect = e-128,   Method: Composition-based stats.
 Identities = 227/605 (37%), Positives = 340/605 (56%), Gaps = 28/605 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTV--------KQPNQVDNSY 53
           ++N N  +A ALS +++  W   +         N    I             P  V  + 
Sbjct: 3   DQNKNLILATALSFLVILVWFLLFPPEEPVTDPNAPTQITQSGETADVALTPPAAVTEAA 62

Query: 54  AAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSP 113
                   A     +PRV++  P+L GSI+L G + DDL+LR Y+  +  +SPIV LLSP
Sbjct: 63  PGAAPQTAATPTENAPRVQIDTPALEGSISLLGGRIDDLSLRNYNETLEPDSPIVRLLSP 122

Query: 114 SNTKNAYFAELDYVSTA--NNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERT 171
            +   AY+A   +      +  ++P +NT+W + SG  LT  TP+ L ++N N ++F RT
Sbjct: 123 VDAPGAYYALYGWAPAGTLSFDDVPGANTLWTVESGDTLTVDTPVVLRWENGNGLIFRRT 182

Query: 172 ISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVE 231
           +++D+ ++F +  +V N +    R  P G I RH      N F + EG +A+    SL+E
Sbjct: 183 LAVDDDFMFTVTQSVENTTETDKRMQPYGIIARHGEPDTINFFVLHEGVVAMAD-GSLIE 241

Query: 232 QKYSDIEKSSISNF---------HESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGH 282
             Y D+                  E N W+G +DK W +  IP+    F S  KY+    
Sbjct: 242 SDYDDMLDYDFVEREGARAEVEQIEQNGWIGFTDKNWMTTLIPTPGQPFTSVAKYV-GNA 300

Query: 283 ARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFI 342
             YQ +      T+  G+++T    LFAGAKE+  I  YE++L I  F   IDWGWFYF+
Sbjct: 301 DIYQTETRLPTQTVPGGQTVTVETRLFAGAKEWEAIRGYERELGIEGFIDSIDWGWFYFL 360

Query: 343 AKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREK 402
            KP+F ++     L+GN G+AI++ T+ +K L  PLA K YVS A MK +QP++++L+EK
Sbjct: 361 TKPIFFVLHELNLLIGNMGVAIIVLTLLIKALLLPLAWKSYVSMARMKELQPEMEKLKEK 420

Query: 403 FKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWI 462
                 Q LQ AM++LYK   +NP AGC PILLQIP+FF++YKVI +++E+RHAPF+G  
Sbjct: 421 AGD-DRQKLQVAMMELYKKEKVNPAAGCLPILLQIPIFFSLYKVIFVTIELRHAPFFGPF 479

Query: 463 KDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQ 516
           +DL+A DPT+I  LFG+LPF  P        + +GI P+++ +SM++Q K++P P D  Q
Sbjct: 480 QDLSAPDPTSIMNLFGLLPFASPEPGSILALIFIGILPLLLGISMWLQQKLNPAPTDPTQ 539

Query: 517 AMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSK 576
           AMI  W+P VF+F L +F +GLI+YW  +NVI+  QQ  IM+ HG +  L   + ++F K
Sbjct: 540 AMIFAWLPWVFMFMLGTFASGLIVYWIANNVITFAQQYFIMRRHGYKPDLFGNIVASFKK 599

Query: 577 NYNSQ 581
              S+
Sbjct: 600 KKPSE 604


>gi|158425677|ref|YP_001526969.1| putative inner membrane protein translocase component YidC
           [Azorhizobium caulinodans ORS 571]
 gi|158332566|dbj|BAF90051.1| 60 kDa inner membrane protein [Azorhizobium caulinodans ORS 571]
          Length = 607

 Score =  464 bits (1194), Expect = e-128,   Method: Composition-based stats.
 Identities = 245/607 (40%), Positives = 365/607 (60%), Gaps = 27/607 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSY------- 53
           M  N N F+AI LS++I+  WQ F   P+ E+    +   Q  +       S        
Sbjct: 1   MTDNRNMFIAIGLSLVILIGWQYFIALPQAEKQRQIQAQQQAAQATQTPSPSAEAAQGGG 60

Query: 54  -----------AAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVS 102
                      A   +  RAQAL+ +PRV ++ PSL GSI+L+GA+ DDL L  +   V 
Sbjct: 61  AAPTAPGSTGVAGSRVMTRAQALAATPRVAIETPSLRGSISLRGARADDLTLSQFRETVD 120

Query: 103 SNSPIVTLLSPSNTKNAYFAELDYV-STANNIELPNSNTVWNLISGKILTPTTPIKLVFK 161
             SP + LLSPS +   ++AE  +  +   N+ +P  +T+W   +G  LTP TP+ L + 
Sbjct: 121 PKSPNIVLLSPSGSPEPFYAEFGWTVAPGANLPVPGPDTLWTAEAGAKLTPATPLVLTWD 180

Query: 162 NANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFI 221
           N   +LF RT ++D+ Y+F + D V N           G + RH        + + EG I
Sbjct: 181 NGQGLLFRRTFTVDDRYMFTVKDEVENKGAAAATLYSYGLVSRHGMPHTQGYYILHEGLI 240

Query: 222 AVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLS-D 280
            V+GD  L E  Y+ ++ +       +  WLGI+DKYWA+  IP ++    S+F   +  
Sbjct: 241 GVMGDHGLQEVTYAKMDDAKPLAMKATGGWLGITDKYWAATVIPDQKAQVDSRFSSSTVA 300

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
           G   +QA +  +  +I PG SI + + LFAGAKE   +  YE+   I RF++LIDWGWFY
Sbjct: 301 GTRTFQADYLGSAQSIAPGASIASQSRLFAGAKEVAVVDGYERQYGIDRFDLLIDWGWFY 360

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           FI KP+F+++ + Y LVGNFG+AI++ TV +K +FFPLA K Y S A MK +QP++  +R
Sbjct: 361 FITKPLFLVIDWIYKLVGNFGVAILIVTVLLKGIFFPLANKSYASMAKMKALQPEMMAIR 420

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E++     +  Q+A ++LYK   INP+AGC PIL+QIPVFFA+YKV+ +++EMR APF+G
Sbjct: 421 ERYADDKVK-QQQATMELYKKEKINPVAGCLPILIQIPVFFALYKVLFVTIEMRQAPFFG 479

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPG------FMHVGIWPIIMSLSMFIQMKMSPPPADK 514
           WI DL+A DPT +F LFG++P+          ++ +G WP+IM ++M++QMK++P P D 
Sbjct: 480 WIHDLSAPDPTTVFNLFGLIPWDPSVVPVLGPYLMLGAWPLIMGVTMWVQMKLNPAPPDP 539

Query: 515 GQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTF 574
            QAMI N+MP++F F L+ F AGL+IYW+W+N +S++QQAVIM+ +G +I L D +  TF
Sbjct: 540 TQAMIFNYMPIIFTFMLAHFAAGLVIYWAWNNTLSVLQQAVIMRRNGVKIELWDNITRTF 599

Query: 575 SKNYNSQ 581
           SK   ++
Sbjct: 600 SKKKTAK 606


>gi|319780382|ref|YP_004139858.1| membrane protein insertase, YidC/Oxa1 family domain containing
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317166270|gb|ADV09808.1| membrane protein insertase, YidC/Oxa1 family domain containing
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 603

 Score =  464 bits (1194), Expect = e-128,   Method: Composition-based stats.
 Identities = 273/600 (45%), Positives = 376/600 (62%), Gaps = 23/600 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQ------------------- 41
           ME N N+F+ IALSV+I+  WQ FYV PR E      +  Q                   
Sbjct: 1   MENNRNFFITIALSVLILAVWQYFYVLPRSEAQREAARVEQQRVEEQKKAAGTNPGTDTG 60

Query: 42  TVKQPNQVDNSY--AAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHL 99
           T   P  + N+    AV    R QAL+ + R ++  PSL GSINL GA+ DDL L+ Y  
Sbjct: 61  TPAAPGAIPNAPGTDAVTPAGREQALATTTRAKIDTPSLEGSINLTGARLDDLKLKHYTE 120

Query: 100 DVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLV 159
            V  NSP ++LL+P+   N Y+AE+ +V       +P   TVW +     LTPTTP+ L 
Sbjct: 121 TVDKNSPEISLLNPAALPNGYYAEIGFVGNDKTGAVPGPETVWAVDGNATLTPTTPVTLT 180

Query: 160 FKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEG 219
           + N   + F+RT S+D +Y+F + DTV N     +  S  GR+ R       +T+ + EG
Sbjct: 181 YSNDKGLTFKRTFSVDTNYMFTVSDTVQNAGTAAVSLSNYGRVTRFDKPLVASTYVLHEG 240

Query: 220 FIAVLGDKSLVEQKYSDIEKSS-ISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYL 278
            I   G + L E KY+ IEK    +    ++ WLGI+DKYWA   +P+++  F  ++ Y 
Sbjct: 241 LIGFTGTEGLQEHKYASIEKDKQFTPGKSTDGWLGITDKYWAVTLVPTEKQPFQPRYAYF 300

Query: 279 SDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGW 338
            DG  RYQ+ F  + IT+  G+S T  + +FAGAKE   I+ Y +D  I RF++LIDWGW
Sbjct: 301 EDGRHRYQSDFLTDPITVDAGQSATVESEIFAGAKEVGKINAYAEDRHIKRFDLLIDWGW 360

Query: 339 FYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDE 398
           F+FI KPMF L+   Y   GNFG+AI+ TTV VK +F+PLA K Y S ANMK +QPK+ E
Sbjct: 361 FHFITKPMFWLIDTLYKFFGNFGLAILATTVIVKAIFYPLANKSYASMANMKKVQPKMLE 420

Query: 399 LREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF 458
           +REK+     +  Q+AM++LYKT  INPLAGCWP+ LQIPVFF++YKV+ I++EMRHAPF
Sbjct: 421 IREKYADDKMK-QQQAMMELYKTEKINPLAGCWPVALQIPVFFSLYKVLYITIEMRHAPF 479

Query: 459 WGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAM 518
           +GWI+DLAA DPT++F LFG++P  LP  + +G+WP+IM ++MF+QM+M+P P D  QA 
Sbjct: 480 FGWIQDLAAPDPTSLFNLFGLIPVTLPHMLMIGVWPLIMGVTMFLQMRMNPTPPDPTQAA 539

Query: 519 ILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNY 578
           I  WMPV+F F ++ FPAGL+IYW+W+N +SI+QQ +IMK  GA+I L D L + F K  
Sbjct: 540 IFTWMPVIFTFMMAGFPAGLVIYWAWNNTLSILQQGIIMKRQGAKIELWDNLVALFRKKP 599


>gi|146278901|ref|YP_001169060.1| putative inner membrane protein translocase component YidC
           [Rhodobacter sphaeroides ATCC 17025]
 gi|145557142|gb|ABP71755.1| protein translocase subunit yidC [Rhodobacter sphaeroides ATCC
           17025]
          Length = 628

 Score =  464 bits (1193), Expect = e-128,   Method: Composition-based stats.
 Identities = 218/606 (35%), Positives = 329/606 (54%), Gaps = 28/606 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
           ++N N  +A  LS +++  W   +  P     +                   A +     
Sbjct: 6   DQNKNLILATGLSFLVIMVWFFLFPPPEAVTQDEPATVATQETALAPSATPDAPMTAVPP 65

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
              L  +PRV +  P L GSI++ G + DDL+L+ YH  +   S IV LLSP    NAY+
Sbjct: 66  DAELPETPRVAIDTPRLQGSISMLGGRIDDLSLKSYHETLDPGSQIVRLLSPVGEPNAYY 125

Query: 122 AELDYVSTA--NNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYL 179
           A   +      +  ++P +NT W  + G  L    P+ L + N   ++F RTIS+D+HY+
Sbjct: 126 ALYGWTPAGALDYEDVPGANTTWTQVGGATLGVDQPVTLEWDNGQGLVFTRTISVDDHYM 185

Query: 180 FKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEK 239
           F I  TV N + + +R +P G + RH        F V         D  L E  Y DI +
Sbjct: 186 FTISQTVENRTGEAVRLAPYGIVARHGKPLNLQNFFVLHEGAVGRADGELTETNYDDIAE 245

Query: 240 SSISNFH---------ESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFS 290
                           + + W+G +DKYW +  IP +   F S  KY+  G   YQA+  
Sbjct: 246 LPQVAREGALAEVVEAQQDGWIGFTDKYWMTTLIPQQGQPFSSVTKYVP-GADIYQAETR 304

Query: 291 ANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAI---------PRFEMLIDWGWFYF 341
              +T+ PG +   ++ LFAGAKE+  I  Y+ + AI         P F   IDWGWF+F
Sbjct: 305 EQLVTVAPGGTAEVSSRLFAGAKEWEAIRAYQNEGAIEPTEGAEPIPGFIDSIDWGWFFF 364

Query: 342 IAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELRE 401
           + KP+F ++ +   ++GN G+AI+  T  +K L  PLA K YVS A MK +QP+++ LRE
Sbjct: 365 LTKPIFAVLHWLNQMIGNMGLAIIALTFLLKALVLPLAYKSYVSMARMKELQPELEALRE 424

Query: 402 KFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGW 461
           +       ++Q+ M++LYK   +NP AGC PIL+QIP+FF++YKVI +++E+RHAPF+GW
Sbjct: 425 R-AGEDKMLMQREMMRLYKEKQVNPAAGCLPILIQIPIFFSLYKVIFVTIELRHAPFFGW 483

Query: 462 IKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKG 515
           + DL+A DP++IF  FG+ P+  P        + +GI PI++ +SM++Q K++P P DK 
Sbjct: 484 LTDLSAPDPSSIFNFFGLAPWAAPTPGSTMALIFIGILPILLGISMWLQQKLNPAPTDKA 543

Query: 516 QAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFS 575
           QAMI  WMP VF+F L  F +GL++YW  +NVI+  QQ VIM+ HG    L   +++ FS
Sbjct: 544 QAMIFAWMPWVFMFMLGHFASGLVLYWIVNNVITFSQQYVIMRSHGHHPDLFGNIKAGFS 603

Query: 576 KNYNSQ 581
           +   +Q
Sbjct: 604 RKSAAQ 609


>gi|170743186|ref|YP_001771841.1| 60 kDa inner membrane insertion protein [Methylobacterium sp. 4-46]
 gi|254773005|sp|B0UHI1|OXAA_METS4 RecName: Full=Inner membrane protein oxaA
 gi|168197460|gb|ACA19407.1| 60 kDa inner membrane insertion protein [Methylobacterium sp. 4-46]
          Length = 624

 Score =  464 bits (1192), Expect = e-128,   Method: Composition-based stats.
 Identities = 244/621 (39%), Positives = 363/621 (58%), Gaps = 44/621 (7%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIE-----------------------------E 32
               N  +AIALS+ ++  W  F   P++E                              
Sbjct: 3   NDKTNMIIAIALSLAVLLGWNYFVTAPQVERQRQQQAAQVNPSQGVNPSQGVDPSQGVNA 62

Query: 33  MNNERKNIQTVKQPNQVDNSY--AAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFD 90
             + ++   +   P  +  +   +      R +AL+ +PRV +   +L GS+ LKG + D
Sbjct: 63  SPSPKEGGPSAPVPGTLPGAAGGSPQAALARDEALARAPRVRIDTEALRGSVALKGGRID 122

Query: 91  DLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKIL 150
           D+ L+GYH  V   SP + LLSP+ + N Y+AE  +V       LP S+TVW    G +L
Sbjct: 123 DVALKGYHETVDPKSPEIVLLSPAGSANPYYAEFGWVGQNAGP-LPGSDTVWT-ADGDVL 180

Query: 151 TPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTA 210
           T   P+ L F N   ++F RT+S+D+ Y+F I D+V N   + +   P G + R      
Sbjct: 181 TAKKPLVLTFDNGAGLVFRRTLSVDDKYMFTIEDSVENKGPNPVTLYPYGLVSRWGKPHT 240

Query: 211 TNTFGVQEGFIAVLGDKSLVEQKYSDIEKSS---------ISNFHESNSWLGISDKYWAS 261
              + + EG I V+GDK L E  Y  + K +         +S    +  +LGI+DKYWA+
Sbjct: 241 QGYYVLHEGMIGVVGDKGLQEYTYDKMAKENPLGAPGTRGVSWPGATGGFLGITDKYWAA 300

Query: 262 VFIPSKETSFHSQFKYLSDGHAR-YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHH 320
             IP ++  +   F    +G  + YQA        + PG S+  +  LFAGAKE  T+  
Sbjct: 301 ATIPDQQAPYTGSFTERDEGATKVYQASSLGEARAVAPGASVQASQRLFAGAKEVSTVDA 360

Query: 321 YEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAK 380
           Y + L I +F++LIDWGWFYFI KPMF  +  FY L GNFG++I++ T+ +KL F P+A 
Sbjct: 361 YREKLNIKQFDLLIDWGWFYFITKPMFKALDLFYKLFGNFGVSILVVTLILKLFFLPIAN 420

Query: 381 KQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVF 440
           + YVS A MK +QP++  +RE++     +  Q+AM++LYK   INP+AGCWP+L+QIPVF
Sbjct: 421 RSYVSMAKMKAVQPEMTAIRERYADDKVK-QQQAMMELYKKEKINPVAGCWPVLIQIPVF 479

Query: 441 FAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLS 500
           F++YKV+ +++EMRHAPF+GWI+DLAA DPT+I  LFG+LPF  P  +H+G+WPI+M ++
Sbjct: 480 FSLYKVLFVTIEMRHAPFFGWIRDLAAPDPTSIVNLFGLLPFTPPDLLHLGVWPIVMGIT 539

Query: 501 MFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMH 560
           MF+QMKM+P P D  QA +  +MP++F F L SFPAGL+IYW+W+N++SI+QQ  IM+ +
Sbjct: 540 MFLQMKMNPAPPDPVQAQVFTFMPIIFTFMLGSFPAGLVIYWAWNNLLSILQQYWIMRRN 599

Query: 561 GAEIGLIDRLRSTFSKNYNSQ 581
           G ++ L D LRSTF +    +
Sbjct: 600 GVKVELWDNLRSTFQRRTQVK 620


>gi|39933709|ref|NP_945985.1| putative inner membrane protein translocase component YidC
           [Rhodopseudomonas palustris CGA009]
 gi|39647556|emb|CAE26076.1| 60 kDa inner membrane protein [Rhodopseudomonas palustris CGA009]
          Length = 622

 Score =  463 bits (1191), Expect = e-128,   Method: Composition-based stats.
 Identities = 245/621 (39%), Positives = 355/621 (57%), Gaps = 43/621 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNS-------- 52
           M  N N  +A+ LS +++  WQ F+  P++E+    ++  Q   +      +        
Sbjct: 1   MSDNRNTILAVVLSGLVLLGWQYFFNIPQMEKQRAAQQAQQQAAKQQAETQTPGAASPAA 60

Query: 53  -----------------YAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLR 95
                             AA     R  AL+  PR++++ P L GSI LKGA+ DDL L 
Sbjct: 61  APAAPGAPGSAPASPQQPAAAPTVSREAALAAGPRIKVETPRLSGSIALKGARIDDLALM 120

Query: 96  GYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWNLISGKILTPTT 154
            Y   V   SP + L SPS +   Y+AE  +V  A  +++LP+ NT+W       LTP  
Sbjct: 121 QYRETVDPKSPPIELFSPSGSARPYYAEFGWVGAAGASVKLPDHNTLWEQEGTGALTPAN 180

Query: 155 PIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTF 214
           P+ L + N   + F R I++D+ YLF + D VTN     +   P   I RH        +
Sbjct: 181 PVTLKWDNGEGLTFRRQITVDDRYLFTVKDDVTNTGGAPVTLYPFALISRHGTPHVEGYY 240

Query: 215 GVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQ 274
            + EG I  LGD+ L E  YS I+++    F  +N WLGI+DKYWAS  +P       ++
Sbjct: 241 ILHEGLIGYLGDQGLQEYSYSKIDEAKSVGFKATNGWLGITDKYWASALLPDTSAQLQAR 300

Query: 275 FKYLS-DGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPT---------IHHYEKD 324
           F          YQ  +  +  T+  G ++T    LFAGAKE            +  Y++ 
Sbjct: 301 FSANKVGNVTTYQTDYLEDARTVPIGGTVTANARLFAGAKEARVVGINFPFAGLGGYDRQ 360

Query: 325 LAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYV 384
           L +  F++LIDWGWFYFI KPMF+ + +F++LVGNFG+AI+L TV VKLLF PLA K Y 
Sbjct: 361 LGLNHFDLLIDWGWFYFITKPMFLALDFFFHLVGNFGVAILLVTVLVKLLFLPLANKSYA 420

Query: 385 STANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIY 444
           S A MK IQP++  L+E+      +  Q+ M+++Y+   INP+AGC PILLQIPVFF++Y
Sbjct: 421 SMAKMKAIQPQLAALKERHPDDKVK-QQQEMMEIYRKEKINPVAGCLPILLQIPVFFSLY 479

Query: 445 KVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPG------FMHVGIWPIIMS 498
           KV+ +++EMRHAPF+GWI DL+A DPTNIF LFG++P+          ++ +G WP++M 
Sbjct: 480 KVLFVTIEMRHAPFFGWIHDLSAPDPTNIFNLFGLIPYDPTAIPVLGHYLVLGAWPLVMG 539

Query: 499 LSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
            +M+ QMK++P P D  Q MI  WMPV+F F L+ FPAGL+IYW+W+N +S+ QQA IM+
Sbjct: 540 FTMWFQMKLNPQPPDPTQQMIFAWMPVIFTFMLAHFPAGLVIYWAWNNTLSVAQQAFIMQ 599

Query: 559 MHGAEIGLIDRLRSTFSKNYN 579
            +G ++ L D LR++F+K   
Sbjct: 600 RNGVKVELWDNLRTSFAKKKK 620


>gi|192289066|ref|YP_001989671.1| inner membrane protein translocase component YidC [Rhodopseudomonas
           palustris TIE-1]
 gi|192282815|gb|ACE99195.1| 60 kDa inner membrane insertion protein [Rhodopseudomonas palustris
           TIE-1]
          Length = 622

 Score =  463 bits (1190), Expect = e-128,   Method: Composition-based stats.
 Identities = 245/621 (39%), Positives = 355/621 (57%), Gaps = 43/621 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNS-------- 52
           M  N N  +A+ LS +++  WQ F+  P++E+    ++  Q   +      +        
Sbjct: 1   MSDNRNTILAVVLSGLVLLGWQYFFNIPQMEKQRAAQQAQQQAAKQQAETQTPGAASPAA 60

Query: 53  -----------------YAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLR 95
                             AA     R  AL+  PR++++ P L GSI LKGA+ DDL L 
Sbjct: 61  APAAPGAPGSAPASPQQQAAAPTVSREAALAAGPRIKVETPRLSGSIALKGARIDDLALM 120

Query: 96  GYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWNLISGKILTPTT 154
            Y   V   SP + L SPS +   Y+AE  +V  A  +++LP+ NT+W       LTP  
Sbjct: 121 QYRETVDPKSPPIELFSPSGSARPYYAEFGWVGAAGASVKLPDHNTLWEQEGTGALTPAN 180

Query: 155 PIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTF 214
           P+ L + N   + F R I++D+ YLF + D VTN     +   P   I RH        +
Sbjct: 181 PVTLKWDNGEGLTFRRQITVDDRYLFTVKDDVTNTGGAPVTLYPFALISRHGTPHVEGYY 240

Query: 215 GVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQ 274
            + EG I  LGD+ L E  YS I+++    F  +N WLGI+DKYWAS  +P       ++
Sbjct: 241 ILHEGLIGYLGDQGLQEYSYSKIDEAKSVGFKATNGWLGITDKYWASALLPDTSAQLQAR 300

Query: 275 FKYLS-DGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPT---------IHHYEKD 324
           F          YQ  +  +  T+  G ++T    LFAGAKE            +  Y++ 
Sbjct: 301 FSANKVGNVTTYQTDYLEDARTVPIGGTVTANARLFAGAKEARVVGINFPFAGLGGYDRQ 360

Query: 325 LAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYV 384
           L +  F++LIDWGWFYFI KPMF+ + +F++LVGNFG+AI+L TV VKLLF PLA K Y 
Sbjct: 361 LGLNHFDLLIDWGWFYFITKPMFLALDFFFHLVGNFGVAILLVTVLVKLLFLPLANKSYA 420

Query: 385 STANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIY 444
           S A MK IQP++  L+E+      +  Q+ M+++Y+   INP+AGC PILLQIPVFF++Y
Sbjct: 421 SMAKMKAIQPQLAALKERHPDDKVK-QQQEMMEIYRKEKINPVAGCLPILLQIPVFFSLY 479

Query: 445 KVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPG------FMHVGIWPIIMS 498
           KV+ +++EMRHAPF+GWI DL+A DPTNIF LFG++P+          ++ +G WP++M 
Sbjct: 480 KVLFVTIEMRHAPFFGWIHDLSAPDPTNIFNLFGLIPYDPTAIPVLGHYLVLGAWPLVMG 539

Query: 499 LSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
            +M+ QMK++P P D  Q MI  WMPV+F F L+ FPAGL+IYW+W+N +S+ QQA IM+
Sbjct: 540 FTMWFQMKLNPQPPDPTQQMIFAWMPVIFTFMLAHFPAGLVIYWAWNNTLSVAQQAFIMQ 599

Query: 559 MHGAEIGLIDRLRSTFSKNYN 579
            +G ++ L D LR++F+K   
Sbjct: 600 RNGVKVELWDNLRTSFAKKKK 620


>gi|260461161|ref|ZP_05809410.1| 60 kDa inner membrane insertion protein [Mesorhizobium
           opportunistum WSM2075]
 gi|259033195|gb|EEW34457.1| 60 kDa inner membrane insertion protein [Mesorhizobium
           opportunistum WSM2075]
          Length = 603

 Score =  463 bits (1190), Expect = e-128,   Method: Composition-based stats.
 Identities = 270/600 (45%), Positives = 372/600 (62%), Gaps = 23/600 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYA------ 54
           ME N N+F+ IALSV+I+  WQ FY+ PR+E+     K  Q   +  +            
Sbjct: 1   MENNRNFFITIALSVLILTLWQVFYMNPRVEQQREAAKIEQQRVEEQKKAAEATNPGAAT 60

Query: 55  ---------------AVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHL 99
                          AV    R QAL+ S RV++  PSL GSINL GA+ DDL L+ Y  
Sbjct: 61  PAPAPGTIPNAPGGDAVTAAGRDQALAASKRVKIDTPSLEGSINLTGARLDDLKLKHYTE 120

Query: 100 DVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLV 159
            V  NSP + LL+P      YFAE+ +V       +P S+TVW++     L+P+TP+ L 
Sbjct: 121 TVDKNSPEIELLNPQALPTGYFAEIGFVGNDKTGAVPGSDTVWSVEGNPTLSPSTPVTLT 180

Query: 160 FKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEG 219
           + N   + F+R  S+D +Y+F + DTV N+    +     GR+ R+      +T+ + EG
Sbjct: 181 YTNDKGLTFKRVFSVDANYMFTVTDTVQNSGASAVSLFNYGRVTRYDKPAVASTYVLHEG 240

Query: 220 FIAVLGDKSLVEQKYSDIEKSSISNF-HESNSWLGISDKYWASVFIPSKETSFHSQFKYL 278
            I V G + L E KY+ IE          ++ WLGI+DKYWA   +P+++  F  ++ + 
Sbjct: 241 LIGVTGTEGLAEYKYAKIESEKQVTPGKSTDGWLGITDKYWAVTLVPTEKQPFQPRYAFF 300

Query: 279 SDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGW 338
            DG  RYQ+ F  + I +  G+S T    +FAGAKE   I+ YE D  I +F ++IDWGW
Sbjct: 301 EDGRHRYQSDFLTDAINVDAGQSATVETEIFAGAKEVAKINAYEADRHIRQFNLVIDWGW 360

Query: 339 FYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDE 398
           FYFI KPMF L+   Y   GNFG+AI+ TTV VK LFFPLA K Y S ANMK +QPK+ E
Sbjct: 361 FYFITKPMFWLIDTLYKFFGNFGLAILATTVIVKALFFPLANKSYASMANMKKVQPKMLE 420

Query: 399 LREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF 458
           +REK+     +  Q+AM++LYKT  INPLAGCWP+ LQIPVFF++YKV+ I++EMRHAPF
Sbjct: 421 IREKYADDKMK-QQQAMMELYKTEKINPLAGCWPVALQIPVFFSLYKVLYITIEMRHAPF 479

Query: 459 WGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAM 518
           +GWI+DLAA DPT+IF LFG++P  LP  + +G+WP+IM ++MF+QM+M+P P D  QA 
Sbjct: 480 FGWIQDLAAPDPTSIFNLFGLVPVTLPHMLMIGVWPLIMGVTMFLQMRMNPTPPDPTQAA 539

Query: 519 ILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNY 578
           I  WMPV+F F ++ FPAGL+IYW+W+N +SI+QQ +IMK  GA+I L D L + F K  
Sbjct: 540 IFTWMPVIFTFMMAGFPAGLVIYWAWNNTLSILQQGLIMKRQGAKIELWDNLVALFRKKP 599


>gi|218530582|ref|YP_002421398.1| YidC translocase/secretase [Methylobacterium chloromethanicum CM4]
 gi|254773000|sp|B7L2I5|OXAA_METC4 RecName: Full=Inner membrane protein oxaA
 gi|218522885|gb|ACK83470.1| YidC translocase/secretase [Methylobacterium chloromethanicum CM4]
          Length = 616

 Score =  463 bits (1190), Expect = e-128,   Method: Composition-based stats.
 Identities = 247/613 (40%), Positives = 366/613 (59%), Gaps = 38/613 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIE----------------------EMNNERKN 39
               N FVAIALS++++  W  F   P  E                         + R+ 
Sbjct: 3   NDKTNMFVAIALSLVVLLGWHYFVTGPASERQRQAAQSQAAQTGAPQTADGIPSPSPREG 62

Query: 40  IQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHL 99
                 P  +  + A   +  R  AL+ S RV +  P+L GSI LKGA+ DD++L+ YH 
Sbjct: 63  SPNAPAPGTLPGAAAQGPV-SREDALARSARVRIDTPALYGSIGLKGARIDDVSLKNYHE 121

Query: 100 DVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLV 159
            VS  SP + LLSP+ + N Y+AE  +V       LPN++T+W    G +L P  P+ L 
Sbjct: 122 TVSDESPRIVLLSPTGSANPYYAEFGWVGANAGP-LPNADTLWK-ADGDLLAPGRPLTLT 179

Query: 160 FKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEG 219
           + N   ++F+R +++D+ ++F + D V N S + +   P   + R         + + EG
Sbjct: 180 WDNGQGLVFKRIVAVDDKFMFTVRDEVENTSANPVTLYPYSLVSRWGKPQTQGYYVLHEG 239

Query: 220 FIAVLGDKSLVEQKYSDIEKSS---------ISNFHESNSWLGISDKYWASVFIPSKETS 270
            I VLG   L E  Y  + K            +  + +  W+GI+DKYWA+  IP ++  
Sbjct: 240 LIGVLGGDGLQEYTYDKVGKEPAYGGAATQGKAWTNVTGGWVGITDKYWAAAAIPEQDKP 299

Query: 271 FHSQFKYLSDGHAR-YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPR 329
           F   F   +DG  + YQ     + +T+ P  S  TT  LFAGAKE   I+ YE++  I +
Sbjct: 300 FTGAFTERTDGATKIYQTSVRGDAVTLAPNASSVTTQRLFAGAKEVNRINAYEREFGIKQ 359

Query: 330 FEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANM 389
           F+++IDWGWF+F+ KPMF  + +F++L+GNFG++I+L T+ +KL F P+A + YVS A M
Sbjct: 360 FDLMIDWGWFWFLTKPMFRALDFFFHLLGNFGVSILLVTLILKLFFLPIANRSYVSMAKM 419

Query: 390 KNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISI 449
           K +QP++  +RE++K    +  Q+AM++LYK   INP+AGCWP+L+QIPVFFA+YKV+ I
Sbjct: 420 KAVQPEMTSIRERYKDDRVK-QQQAMMELYKKEKINPVAGCWPVLIQIPVFFALYKVLFI 478

Query: 450 SLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHV--GIWPIIMSLSMFIQMKM 507
           ++EMRHAPF+GWI+DLAA DPT+I  LFG+LPF  P ++ +  G+WPIIM ++MFIQMKM
Sbjct: 479 TIEMRHAPFFGWIQDLAAPDPTSIVNLFGLLPFTPPEYIPIHLGVWPIIMGITMFIQMKM 538

Query: 508 SPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLI 567
           +P P D  QA +  +MP+VF F L SFPAGL+IYW+W+N +S++QQ VIM+ +G ++ L 
Sbjct: 539 NPAPPDPVQAQVFAFMPIVFTFMLGSFPAGLVIYWAWNNTLSVIQQYVIMRRNGVKVELW 598

Query: 568 DRLRSTFSKNYNS 580
           D LR  F +   S
Sbjct: 599 DNLRGMFKRGNKS 611


>gi|312113264|ref|YP_004010860.1| membrane protein insertase, YidC/Oxa1 family [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311218393|gb|ADP69761.1| membrane protein insertase, YidC/Oxa1 family [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 711

 Score =  462 bits (1189), Expect = e-128,   Method: Composition-based stats.
 Identities = 240/609 (39%), Positives = 346/609 (56%), Gaps = 34/609 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQ--------------- 45
           M+ N N+ +AIALS+ ++  WQ  Y+ P  ++   +    Q                   
Sbjct: 1   MDNNRNFIIAIALSLSVLLGWQFLYMKPASDKARQQAIEAQQQTAGEQGTDPTVGGAAIP 60

Query: 46  --PNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSS 103
              + V           R  AL+ + R+     SL GSINLKG   DD+ L+ Y   V  
Sbjct: 61  PRASSVIPVPTTPKFASREAALAATQRIAFDTSSLTGSINLKGGSVDDVTLKEYRQTVDP 120

Query: 104 NSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNA 163
           NSP VTLLSP+ +   Y+A   + S   +I +P  +TVW       L P  P+ L + N 
Sbjct: 121 NSPPVTLLSPAGSPEPYYAYTGWYSDQADISVPGPDTVWKQQGTGALAPGKPVTLTWDNG 180

Query: 164 NNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR-HKPQTATNTFGVQEGFIA 222
             ++F+R I+LDEHY+F I DTV N +   +   PR  + R ++P        + EG I 
Sbjct: 181 KGLVFKRAITLDEHYMFTITDTVENKTGKPVTLRPRAEVARLYEPTNLFGYSVLHEGLIG 240

Query: 223 VLGDKSLVEQKYSDIEKS-----------SISNFHESNSWLGISDKYWASVFIPSKETSF 271
           +  D  L E  YS   K+           S     +   WLG +D+YWA+V +P +    
Sbjct: 241 LFKDAGLKELTYSSAIKNFDPAADNGKGVSKEIISDKGGWLGFTDQYWAAVLVPDQSKPL 300

Query: 272 HSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFE 331
            ++          +  +FS N +T+  G S T TN LFAGAK+   I  Y  D  I RF+
Sbjct: 301 TARLFGTPQKD--FFVEFSENPVTVATGASETFTNKLFAGAKKVVLIEQYMADDKIDRFD 358

Query: 332 MLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKN 391
            L+DWGWF F+ +P++ L+++ Y  VGNFGIAI+LTTV VK+LFFPLA K Y +   +K 
Sbjct: 359 KLVDWGWFPFLTQPLYFLLNWLYLHVGNFGIAILLTTVLVKVLFFPLANKSYSAMNKLKM 418

Query: 392 IQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISL 451
           +QP++ +++E+FK    Q  Q AM+ LYK   +NP AGC PIL+QIPVFFA+YKV+ +S+
Sbjct: 419 LQPEMKKIQERFKDDK-QRQQHAMMTLYKKEKVNPAAGCLPILVQIPVFFALYKVLLVSI 477

Query: 452 EMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP 511
           EMRHAPF+GWI DL+A DPTNIFTLFG++P+  P FM +G  P+IM  SM++QM+++P P
Sbjct: 478 EMRHAPFYGWIHDLSAPDPTNIFTLFGLIPWTPPHFMMLGALPLIMGCSMWLQMRLNPTP 537

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLR 571
            D  Q  I  WMPV+F F L+ F AGLI+YW+W+N+++  QQA+IMK     + L++++ 
Sbjct: 538 PDPIQQKIFAWMPVLFTFMLAPFQAGLILYWTWNNILTFAQQALIMKRQDKNMNLLEQI- 596

Query: 572 STFSKNYNS 580
               K+  +
Sbjct: 597 -GLKKSNGA 604


>gi|89068160|ref|ZP_01155577.1| putative inner membrane protein translocase component YidC
           [Oceanicola granulosus HTCC2516]
 gi|89046399|gb|EAR52456.1| putative inner membrane protein translocase component YidC
           [Oceanicola granulosus HTCC2516]
          Length = 597

 Score =  462 bits (1189), Expect = e-128,   Method: Composition-based stats.
 Identities = 211/596 (35%), Positives = 339/596 (56%), Gaps = 29/596 (4%)

Query: 1   MER-NWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQ----------V 49
           M+  N N  +A ALS I++  W   +  P         +     +              +
Sbjct: 1   MDDQNKNLILATALSFIVILIWFVLFPPPEQAPGLTNAEGEVVAQDDTALRDEMSPDGAI 60

Query: 50  DNSYAAVLIDDRAQ-ALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIV 108
           D + A   +    Q A   + RV ++ P L+GSIN  G + DDL L  YH  +  +SP+V
Sbjct: 61  DGTAAGTPVATLEQDAPVEAARVAIETPRLVGSINTAGGRIDDLKLTAYHETLDPDSPLV 120

Query: 109 TLLSPSNTKNAYFAELDYV--STANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNI 166
            LLSP   +  Y+A   ++  S A+  E+P  +TVW +  G+ LTP +P+ L ++N   +
Sbjct: 121 RLLSPGGEEAQYYALHGWIALSGASADEVPGDSTVWEIEEGETLTPDSPVVLRWENGAGL 180

Query: 167 LFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGD 226
           +F +TI++D++YLF +  +V N + D +   P G++ RH    +   F + EG + +   
Sbjct: 181 VFRKTIAVDDNYLFTVTQSVENTTGDAVELRPYGQVRRHGLPDSRQFFILHEGVVRMADG 240

Query: 227 KSLVEQKYSDIEK---SSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
             L E  Y D+              + W+G +DKYW +  +P+  T F S  + ++    
Sbjct: 241 -ELEEIDYDDLPDLTAEESRIEVAEDGWVGFTDKYWMTTLVPASGTPFRSVAREVNG--- 296

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
            Y  +     + +  G++++  + +FAGAKE+ TI  Y +   I RF   IDWGWF+F+ 
Sbjct: 297 IYLTESIYPPVAVAAGETVSAESHVFAGAKEWETIRAY-EAAGIDRFVDSIDWGWFFFLT 355

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           KP+F L+ +   ++GN G +I++ T+ +K + FPLA K Y S A MK +QP++++L+E+ 
Sbjct: 356 KPIFALLHWLNGVIGNMGWSIIVLTLIIKAVLFPLAYKSYASMAKMKELQPEMEKLKERA 415

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
                Q LQK M++LYKT+ +NP +GC PILLQIP+FF++YKVI ++LE+RHAP+ GWI+
Sbjct: 416 GD-DRQALQKGMMELYKTNKVNPASGCLPILLQIPIFFSLYKVIFVTLELRHAPWIGWIR 474

Query: 464 DLAAADPTNIFTLFGILPFYLPG------FMHVGIWPIIMSLSMFIQMKMSPPPADKGQA 517
           DL+A DP++I  LFG+LP+  P          +G+ PI++ +SM++Q K++P P D  Q 
Sbjct: 475 DLSAPDPSSILNLFGLLPWDTPDPGSIFFIFSLGVLPILLGISMWLQQKLNPAPPDPTQR 534

Query: 518 MILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRST 573
           MI  WMP VF+F L SF +GL+IYW  +N+I+  QQ +IM+ HG +  ++  +R  
Sbjct: 535 MIFAWMPWVFMFMLGSFASGLVIYWIANNMITFTQQYLIMRSHGYKPDILGNIRGK 590


>gi|92119160|ref|YP_578889.1| putative inner membrane protein translocase component YidC
           [Nitrobacter hamburgensis X14]
 gi|122416784|sp|Q1QH68|OXAA_NITHX RecName: Full=Inner membrane protein oxaA
 gi|91802054|gb|ABE64429.1| protein translocase subunit yidC [Nitrobacter hamburgensis X14]
          Length = 609

 Score =  461 bits (1186), Expect = e-127,   Method: Composition-based stats.
 Identities = 243/605 (40%), Positives = 365/605 (60%), Gaps = 25/605 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M  N N  +AI LS +I+ AWQ FY  P++E+    ++      +        +      
Sbjct: 2   MSENRNTIIAIVLSGLILIAWQYFYNIPQMEKDRAAQQAQSQTAKSPTEPTPNSPKPDHP 61

Query: 61  RAQ-------ALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSP 113
            A+       A++ +PRV++  P L GSI+LKGA+ DDL L  +   V   SP + L SP
Sbjct: 62  AAESVVARGVAIATTPRVKIDTPRLSGSISLKGARIDDLLLTKFRETVDPASPAIELFSP 121

Query: 114 SNTKNAYFAELDYVS-TANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTI 172
           S T   Y+AE  +V+ T +   +P+ NTVW       LT +TP+ L + N   + F RTI
Sbjct: 122 SGTTTPYYAEFGWVAATGSTARVPDQNTVWQQEGSGALTQSTPVTLKYDNGEGLTFRRTI 181

Query: 173 SLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ 232
           ++D+HYLF I D VTN     +   P   I RH     +  + + EG I  LGD+ L E 
Sbjct: 182 AVDDHYLFTIKDEVTNAGGAPVTLYPFALISRHGTPAVSGYYILHEGLIGYLGDQKLQEY 241

Query: 233 KYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR-YQAKFSA 291
            Y  I+++   +F  +N WLGI+DKYWA+  +P       ++F     G  + YQA +  
Sbjct: 242 SYKKIDEAKSVSFKVTNGWLGITDKYWAAALLPDTSAQLQARFSSNESGSVKTYQADYLE 301

Query: 292 NEITILPGKSITTTNFLFAGAKE---------FPTIHHYEKDLAIPRFEMLIDWGWFYFI 342
           +  TI  G + +    LFAGAKE         F  +  Y K L +  F++LIDWGWFYFI
Sbjct: 302 DAQTIPVGGTGSVNTRLFAGAKEAGVVGINFPFVELGGYNKQLGLNHFDLLIDWGWFYFI 361

Query: 343 AKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREK 402
            KPMF+ + +F+++ GNFGIAI+  TV +K +FFPLA + Y S A MK +QP+I  L+E+
Sbjct: 362 TKPMFLALDFFFHVFGNFGIAILFVTVLIKAIFFPLANRSYASMAKMKAVQPQIAALKER 421

Query: 403 FKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWI 462
           F     + LQ+ M+++YK   INP++GC P++LQIPVFF++YKV+ +++EMRHAPF+ WI
Sbjct: 422 FPDDKMK-LQQEMMEIYKKEKINPISGCLPMVLQIPVFFSLYKVLFVTIEMRHAPFFAWI 480

Query: 463 KDLAAADPTNIFTLFGILPFYLPG------FMHVGIWPIIMSLSMFIQMKMSPPPADKGQ 516
           KDL+A DPT+IF LFG+LP+          ++ +G WPIIM ++M+ QMK++P P D  Q
Sbjct: 481 KDLSAPDPTHIFNLFGLLPYDPSAVPLLGPYLAIGAWPIIMGITMWFQMKLNPTPPDPTQ 540

Query: 517 AMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSK 576
            +I +WMPV+F F L++FPAGL+IYW+W+N +S++QQ+ IM+ +G ++ L++ ++S F +
Sbjct: 541 KLIFDWMPVIFTFMLAAFPAGLVIYWAWNNTLSVIQQSYIMRRNGVKVELLNNVKSVFRR 600

Query: 577 NYNSQ 581
             + +
Sbjct: 601 KSSDK 605


>gi|84515675|ref|ZP_01003036.1| putative inner membrane protein translocase component YidC
           [Loktanella vestfoldensis SKA53]
 gi|84510117|gb|EAQ06573.1| putative inner membrane protein translocase component YidC
           [Loktanella vestfoldensis SKA53]
          Length = 605

 Score =  461 bits (1185), Expect = e-127,   Method: Composition-based stats.
 Identities = 205/597 (34%), Positives = 325/597 (54%), Gaps = 21/597 (3%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQ--PNQVDNSYAAVLID 59
           E+N N  +A  LS  ++  W   +    I      +   Q+V    P     +  A    
Sbjct: 3   EQNRNLILATLLSFAVIMTWTLLFPPEEIAVDPAAQVATQSVDPTVPLADPVTPDATSPA 62

Query: 60  DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNA 119
              Q      R+ ++ P L GSI++ G + DDL L  Y   +  ++PIV LL P    +A
Sbjct: 63  IVEQTAPDVARIAIETPELTGSISMLGGRIDDLALTDYRETLDEDAPIVRLLRPVGELDA 122

Query: 120 YFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEH 177
           YFA   + +T       +P  +T+W++ +G+ LTP+TP+ LV+ N    +F   IS+D+ 
Sbjct: 123 YFAAFGWTATDGIDPAAVPGPDTIWSVETGETLTPSTPVTLVWDNGAGQIFRTEISVDDL 182

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           ++F    ++ N   + +   P G + RH   +    F +    +  + D  L E  YS+I
Sbjct: 183 FMFSFAQSIQNVGTETVSARPYGLVRRHGEPSDAKRFFILHEGLVRMSDGELEETSYSNI 242

Query: 238 EKSSISNFH---------ESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAK 288
              +              + + W+G +D +W +  IP+  T F S  KY  +    YQ +
Sbjct: 243 TDHTFDERERTLADRIDVQQSGWIGYTDHFWMTTLIPATGTPFRSTSKYF-EARDLYQVE 301

Query: 289 FSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFM 348
                  +  G++ T T  LFAGAKE+  I HYE +  + RF   IDWGWF+F+ KP+F 
Sbjct: 302 AVMPPSVVPAGETATVTIRLFAGAKEWEAITHYENETGVDRFIDSIDWGWFFFLTKPIFW 361

Query: 349 LMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPP 408
           L+     ++GN G +I+  T+ +K L  PLA K YVS A MK +QP++++L+E+      
Sbjct: 362 LLHNLNIIIGNMGWSILALTLILKALVLPLAYKSYVSMARMKELQPEMEKLKERAGD-DR 420

Query: 409 QVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAA 468
           Q +Q+ M++LYK + +NP AGC PILLQIP+FF++YKVI +++E+RHAP+ GWI DL+A 
Sbjct: 421 QAMQQGMMKLYKENTVNPAAGCLPILLQIPIFFSLYKVIFVTIELRHAPWIGWIDDLSAP 480

Query: 469 DPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNW 522
           DP+++  LFG+LP+  P        + +G+ PI++ +SM++Q K++P P D  Q MI  W
Sbjct: 481 DPSSLINLFGLLPYAAPDPGSILSLIFIGLLPILLGISMWMQQKLNPAPTDPTQQMIFAW 540

Query: 523 MPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYN 579
           MP VF+F L  F +GL++YW  +N I+ VQQ  IM+ HGA+  +   ++S   +   
Sbjct: 541 MPWVFMFMLGGFASGLVLYWIANNCITFVQQYAIMRSHGAKPDVFGNIKSGLKRKKP 597


>gi|332559538|ref|ZP_08413860.1| membrane protein insertase [Rhodobacter sphaeroides WS8N]
 gi|332277250|gb|EGJ22565.1| membrane protein insertase [Rhodobacter sphaeroides WS8N]
          Length = 623

 Score =  460 bits (1184), Expect = e-127,   Method: Composition-based stats.
 Identities = 215/606 (35%), Positives = 331/606 (54%), Gaps = 29/606 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
           ++N N  +A  LS +++  W   +  P            Q                +   
Sbjct: 3   DQNKNLILATGLSFLVIMVWFFLFPPPEAVTEGEPTVATQQTAVAPSATPDAPTTAVPPD 62

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
           A+ L  + RV +  P L GSI++ G + DDL+L+ YH  +   S IV LLSP    NAY+
Sbjct: 63  AE-LPETQRVVIDTPRLQGSISMLGGRLDDLSLKSYHETLDPQSQIVRLLSPVGQPNAYY 121

Query: 122 AELDYVSTA--NNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYL 179
           A   +         ++P +NT W  +    L    P+ L + N   ++F RTIS+D+HY+
Sbjct: 122 ALYGWTPAGALGYEDVPGANTTWTQVGSGALGVDQPVTLQWDNGKGLVFTRTISVDDHYM 181

Query: 180 FKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEK 239
           F +  TV NNS   ++ +P G + RH        F V    +    D  L E KY  + +
Sbjct: 182 FSVAQTVENNSGQAVQLAPYGIVARHGKPLNLQNFFVLHEGVVGRADGKLTETKYDKVAE 241

Query: 240 SSISNFH---------ESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFS 290
                           + + W+G +DKYW +  IP +   F S  KY+  G   YQA+  
Sbjct: 242 LPQVAREGAQAEVIDAQQDGWIGFTDKYWMTTLIPQQGQPFTSVTKYVP-GADIYQAETR 300

Query: 291 ANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLA---------IPRFEMLIDWGWFYF 341
              +T+ PG +   ++ LFAGAKE+ TI  Y+ + A         IP F   IDWGWF+F
Sbjct: 301 EQLVTVAPGATAEVSSRLFAGAKEWETIRAYQNEGATEPTEGAEPIPGFIDSIDWGWFFF 360

Query: 342 IAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELRE 401
           + KP+F ++ +  +++GN G+AI+  T  +K L  PLA K YVS A MK +QP+++ LRE
Sbjct: 361 LTKPIFTVLHWLNHMIGNMGLAIIALTFLLKALVLPLAYKSYVSMARMKELQPELEALRE 420

Query: 402 KFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGW 461
           +       ++Q+ M++LYK   +NP AGC PIL+QIP+FF++YKVI +++E+RHAPF+GW
Sbjct: 421 RAGDDK-MLMQREMMRLYKEKQVNPAAGCLPILIQIPIFFSLYKVIFVTIELRHAPFFGW 479

Query: 462 IKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKG 515
           +KDL+A DP++IF  FG+ P+  P        + +G  PI++ +SM++Q K++P P DK 
Sbjct: 480 LKDLSAPDPSSIFNFFGLAPWAAPTPGTTMALIFIGALPILLGVSMWLQQKLNPAPGDKA 539

Query: 516 QAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFS 575
           QAMI  WMP VF+F L  F +GL++YW  +N+I+  QQ VIM+ HG    +   ++++FS
Sbjct: 540 QAMIFAWMPWVFMFMLGHFASGLVLYWIVNNLITFTQQYVIMRSHGHHPDIFGNIKASFS 599

Query: 576 KNYNSQ 581
           +   +Q
Sbjct: 600 RKPAAQ 605


>gi|126463485|ref|YP_001044599.1| putative inner membrane protein translocase component YidC
           [Rhodobacter sphaeroides ATCC 17029]
 gi|166977405|sp|A3PNB1|OXAA_RHOS1 RecName: Full=Inner membrane protein oxaA
 gi|126105149|gb|ABN77827.1| protein translocase subunit yidC [Rhodobacter sphaeroides ATCC
           17029]
          Length = 623

 Score =  460 bits (1183), Expect = e-127,   Method: Composition-based stats.
 Identities = 215/606 (35%), Positives = 331/606 (54%), Gaps = 29/606 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
           ++N N  +A  LS +++  W   +  P            Q                +   
Sbjct: 3   DQNKNLILATGLSFLVIMVWFFLFPPPEAVTEGETTVATQQTAVAPSATPDAPTTAVPPD 62

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
           A+ L  + RV +  P L GSI++ G + DDL+L+ YH  +   S IV LLSP    NAY+
Sbjct: 63  AE-LPETQRVVIDTPRLQGSISMLGGRLDDLSLKSYHETLDPQSQIVRLLSPVGQPNAYY 121

Query: 122 AELDYVSTA--NNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYL 179
           A   +         ++P +NT W  +    L    P+ L + N   ++F RTIS+D+HY+
Sbjct: 122 ALYGWTPAGALGYEDVPGANTTWTQVGSGALGVDQPVTLQWDNGKGLVFTRTISVDDHYM 181

Query: 180 FKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEK 239
           F +  TV NNS   ++ +P G + RH        F V    +    D  L E KY  + +
Sbjct: 182 FSVAQTVENNSGQAVQLAPYGIVARHGKPLNLQNFFVLHEGVVGRADGKLTETKYDKVAE 241

Query: 240 SSISNFH---------ESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFS 290
                           + + W+G +DKYW +  IP +   F S  KY+  G   YQA+  
Sbjct: 242 LPQVAREGAQAEVIDAQQDGWIGFTDKYWMTTLIPQQGQPFTSVTKYVP-GADIYQAETR 300

Query: 291 ANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLA---------IPRFEMLIDWGWFYF 341
              +T+ PG +   ++ LFAGAKE+ TI  Y+ + A         IP F   IDWGWF+F
Sbjct: 301 EQLVTVAPGATAEVSSRLFAGAKEWETIRAYQNEGATEPTEGAEPIPGFIDSIDWGWFFF 360

Query: 342 IAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELRE 401
           + KP+F ++ +  +++GN G+AI+  T  +K L  PLA K YVS A MK +QP+++ LRE
Sbjct: 361 LTKPIFTVLHWLNHMIGNMGLAIIALTFLLKALVLPLAYKSYVSMARMKELQPELEALRE 420

Query: 402 KFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGW 461
           +       ++Q+ M++LYK   +NP AGC PIL+QIP+FF++YKVI +++E+RHAPF+GW
Sbjct: 421 RAGDDK-MLMQREMMRLYKEKQVNPAAGCLPILIQIPIFFSLYKVIFVTIELRHAPFFGW 479

Query: 462 IKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKG 515
           +KDL+A DP++IF  FG+ P+  P        + +G  PI++ +SM++Q K++P P DK 
Sbjct: 480 LKDLSAPDPSSIFNFFGLAPWAAPTPGTTMALIFIGALPILLGVSMWLQQKLNPAPGDKA 539

Query: 516 QAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFS 575
           QAMI  WMP VF+F L  F +GL++YW  +N+I+  QQ VIM+ HG    +   ++++FS
Sbjct: 540 QAMIFAWMPWVFMFMLGHFASGLVLYWIVNNLITFTQQYVIMRSHGHHPDIFGNIKASFS 599

Query: 576 KNYNSQ 581
           +   +Q
Sbjct: 600 RKPAAQ 605


>gi|221640557|ref|YP_002526819.1| putative inner membrane protein translocase component YidC
           [Rhodobacter sphaeroides KD131]
 gi|254773018|sp|B9KNZ6|OXAA_RHOSK RecName: Full=Inner membrane protein oxaA
 gi|221161338|gb|ACM02318.1| Inner membrane protein oxaA [Rhodobacter sphaeroides KD131]
          Length = 623

 Score =  460 bits (1183), Expect = e-127,   Method: Composition-based stats.
 Identities = 215/606 (35%), Positives = 330/606 (54%), Gaps = 29/606 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
           ++N N  +A  LS +++  W   +  P            Q                +   
Sbjct: 3   DQNKNLILATGLSFLVIMVWFFLFPPPEAVTEGEPTVATQQTAVAPSATPDAPTTAVPPD 62

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
           A  L  + RV +  P L GSI++ G + DDL+L+ YH  +   S IV LLSP    NAY+
Sbjct: 63  AD-LPETRRVAIDTPRLQGSISMLGGRLDDLSLKSYHETLDPQSQIVRLLSPVGQPNAYY 121

Query: 122 AELDYVSTA--NNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYL 179
           A   +         ++P +NT W  +    L    P+ L + N   ++F RTIS+D+HY+
Sbjct: 122 ALYGWTPAGALGYEDVPGANTTWTQVGSGALGVDQPVTLQWDNGKGLVFTRTISVDDHYM 181

Query: 180 FKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEK 239
           F +  TV NNS   ++ +P G + RH        F V    +    D  L E KY  + +
Sbjct: 182 FSVAQTVENNSGQAVQLAPYGIVARHGKPLNLQNFFVLHEGVVGRADGKLTETKYDKVAE 241

Query: 240 SSISNFH---------ESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFS 290
                           + + W+G +DKYW +  IP +   F S  KY+  G   YQA+  
Sbjct: 242 LPQVAREGAQAEVIDAQQDGWIGFTDKYWMTTLIPQQGQPFTSVTKYVP-GADIYQAETR 300

Query: 291 ANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLA---------IPRFEMLIDWGWFYF 341
              +T+ PG +   ++ LFAGAKE+ TI  Y+ + A         IP F   IDWGWF+F
Sbjct: 301 EQLVTVAPGATAEVSSRLFAGAKEWETIRAYQNEGATEPTEGAEPIPGFIDSIDWGWFFF 360

Query: 342 IAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELRE 401
           + KP+F ++ +  +++GN G+AI+  T  +K L  PLA K YVS A MK +QP+++ LRE
Sbjct: 361 LTKPIFTVLHWLNHMIGNMGLAIIALTFLLKALVLPLAYKSYVSMARMKELQPELEALRE 420

Query: 402 KFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGW 461
           +       ++Q+ M++LYK   +NP AGC PIL+QIP+FF++YKVI +++E+RHAPF+GW
Sbjct: 421 RAGDDK-MLMQREMMRLYKEKQVNPAAGCLPILIQIPIFFSLYKVIFVTIELRHAPFFGW 479

Query: 462 IKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKG 515
           +KDL+A DP++IF  FG+ P+  P        + +G  PI++ +SM++Q K++P P DK 
Sbjct: 480 LKDLSAPDPSSIFNFFGLAPWAAPTPGTTMALIFIGALPILLGVSMWLQQKLNPAPGDKA 539

Query: 516 QAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFS 575
           QAMI  WMP VF+F L  F +GL++YW  +N+I+  QQ VIM+ HG    +   ++++FS
Sbjct: 540 QAMIFAWMPWVFMFMLGHFASGLVLYWIVNNLITFTQQYVIMRSHGHHPDIFGNIKASFS 599

Query: 576 KNYNSQ 581
           +   +Q
Sbjct: 600 RKPAAQ 605


>gi|77464645|ref|YP_354149.1| putative inner membrane protein translocase component YidC
           [Rhodobacter sphaeroides 2.4.1]
 gi|123590899|sp|Q3IYY6|OXAA_RHOS4 RecName: Full=Inner membrane protein oxaA
 gi|77389063|gb|ABA80248.1| protein translocase subunit yidC [Rhodobacter sphaeroides 2.4.1]
          Length = 623

 Score =  460 bits (1183), Expect = e-127,   Method: Composition-based stats.
 Identities = 215/606 (35%), Positives = 330/606 (54%), Gaps = 29/606 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
           ++N N  +A  LS +++  W   +  P            Q                +   
Sbjct: 3   DQNKNLILATGLSFLVIMVWFFLFPPPEAVTEGEPTVATQQTAVAPSATPDAPTTAVPPD 62

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
           A  L  + RV +  P L GSI++ G + DDL+L+ YH  +   S IV LLSP    NAY+
Sbjct: 63  AD-LPETQRVVIDTPRLQGSISMLGGRLDDLSLKSYHETLDPQSQIVRLLSPVGQPNAYY 121

Query: 122 AELDYVSTA--NNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYL 179
           A   +         ++P +NT W  +    L    P+ L + N   ++F RTIS+D+HY+
Sbjct: 122 ALYGWTPAGALGYEDVPGANTTWTQVGSGALGVDQPVTLQWDNGKGLVFTRTISVDDHYM 181

Query: 180 FKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEK 239
           F +  TV NNS   ++ +P G + RH        F V    +    D  L E KY  + +
Sbjct: 182 FSVAQTVENNSGQAVQLAPYGIVARHGKPLNLQNFFVLHEGVVGRADGKLTETKYDKVAE 241

Query: 240 SSISNFH---------ESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFS 290
                           + + W+G +DKYW +  IP +   F S  KY+  G   YQA+  
Sbjct: 242 LPQVAREGAQAEVIDAQQDGWIGFTDKYWMTTLIPQQGQPFTSVTKYVP-GADIYQAETR 300

Query: 291 ANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLA---------IPRFEMLIDWGWFYF 341
              +T+ PG +   ++ LFAGAKE+ TI  Y+ + A         IP F   IDWGWF+F
Sbjct: 301 EQLVTVAPGATAEVSSRLFAGAKEWETIRAYQNEGATEPTEGAEPIPGFIDSIDWGWFFF 360

Query: 342 IAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELRE 401
           + KP+F ++ +  +++GN G+AI+  T  +K L  PLA K YVS A MK +QP+++ LRE
Sbjct: 361 LTKPIFTVLHWLNHMIGNMGLAIIALTFLLKALVLPLAYKSYVSMARMKELQPELEALRE 420

Query: 402 KFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGW 461
           +       ++Q+ M++LYK   +NP AGC PIL+QIP+FF++YKVI +++E+RHAPF+GW
Sbjct: 421 RAGDDK-MLMQREMMRLYKEKQVNPAAGCLPILIQIPIFFSLYKVIFVTIELRHAPFFGW 479

Query: 462 IKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKG 515
           +KDL+A DP++IF  FG+ P+  P        + +G  PI++ +SM++Q K++P P DK 
Sbjct: 480 LKDLSAPDPSSIFNFFGLAPWAAPTPGTTMALIFIGALPILLGVSMWLQQKLNPAPGDKA 539

Query: 516 QAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFS 575
           QAMI  WMP VF+F L  F +GL++YW  +N+I+  QQ VIM+ HG    +   ++++FS
Sbjct: 540 QAMIFAWMPWVFMFMLGHFASGLVLYWIVNNLITFTQQYVIMRSHGHHPDIFGNIKASFS 599

Query: 576 KNYNSQ 581
           +   +Q
Sbjct: 600 RKPAAQ 605


>gi|84499797|ref|ZP_00998085.1| putative inner membrane protein translocase component YidC
           [Oceanicola batsensis HTCC2597]
 gi|84392941|gb|EAQ05152.1| putative inner membrane protein translocase component YidC
           [Oceanicola batsensis HTCC2597]
          Length = 608

 Score =  460 bits (1182), Expect = e-127,   Method: Composition-based stats.
 Identities = 203/608 (33%), Positives = 332/608 (54%), Gaps = 32/608 (5%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDN---------- 51
           ++N N  +A  LS I++  W   +  P   +  N     +T +                 
Sbjct: 3   DQNKNLILATVLSFIVIVVWFLLFPPPERVDDPNAPATGETAQSQADGTAPMTPGADTRE 62

Query: 52  -SYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTL 110
            +         +     +PR+ +  P L GSINL+G + DDL L+ Y   + +++  VT+
Sbjct: 63  GASVPSDAAPASADTEEAPRLGIDTPRLAGSINLRGGRIDDLKLKDYLTSLDADATRVTV 122

Query: 111 LSPSNTKNAYFAELDYV--STANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILF 168
           L P + ++ ++A   ++  S A+   +P  +TVW++     LTP TP+ + ++N   ++F
Sbjct: 123 LRPEDQRDPFYALYGWIPVSGADAGAMPAEDTVWSVEGTPTLTPETPVTMTWENDAGLIF 182

Query: 169 ERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKS 228
            RT+ +D  Y+F +  TV N   + +   P   + RH   +    F V    +  + D  
Sbjct: 183 RRTVGIDTDYMFTVRQTVENTGENPVALRPYSVLRRHGIPSDLKKFFVLHEGLIRMSDGE 242

Query: 229 LVEQKYSDIEKSSISNFH---------ESNSWLGISDKYWASVFIPSKETSFHSQFKYLS 279
           L E+ Y ++E   +             + + W G +D YW S  IP   T+F S  KY  
Sbjct: 243 LQEESYGNLEDFDVDGREGVPAERIEVQESGWTGFTDHYWMSTIIPD--TAFRSTAKYFP 300

Query: 280 DGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWF 339
            G + +Q       + I PG S +    LFAGAKE+ TI  Y+ D  + RF   IDWGWF
Sbjct: 301 -GRSIFQTDAVLPAVEIAPGASASVDTRLFAGAKEWETIKEYQNDHGVTRFLDAIDWGWF 359

Query: 340 YFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDEL 399
           +F+ KP+F ++ +  + +GN G +I+  TV +K++ FPLA K Y S A M+ +QP+++++
Sbjct: 360 FFLTKPIFAVLHWLNSHIGNMGWSIIALTVLLKMVLFPLAYKSYASMAKMRELQPEMEKI 419

Query: 400 REKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFW 459
           +E+      Q LQK M++LYK   +NP +GC PILLQIP+FF++YKVI ++LE+RHAP+ 
Sbjct: 420 KERAGD-DRQKLQKEMMELYKKEKVNPASGCLPILLQIPIFFSLYKVIFVTLELRHAPWI 478

Query: 460 GWIKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPAD 513
           GWI DL+A DP++I  LFG+LP   P        + +G+ PI++ +SM++Q K++P P D
Sbjct: 479 GWIHDLSAPDPSSILNLFGLLPIATPDPDSFLAIISLGVLPILLGVSMWLQQKLNPAPTD 538

Query: 514 KGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRST 573
             Q MI  WMP VF+F L +F +GL++YW  +NVI+ +QQ  IM+ HG +  +   +R +
Sbjct: 539 PTQQMIFAWMPWVFMFMLGTFASGLVLYWITNNVITFMQQYAIMRSHGFKPDVFGNIRKS 598

Query: 574 FSKNYNSQ 581
            ++   ++
Sbjct: 599 LTRKKKAE 606


>gi|299132593|ref|ZP_07025788.1| membrane protein insertase [Afipia sp. 1NLS2]
 gi|298592730|gb|EFI52930.1| membrane protein insertase [Afipia sp. 1NLS2]
          Length = 611

 Score =  459 bits (1181), Expect = e-127,   Method: Composition-based stats.
 Identities = 264/610 (43%), Positives = 364/610 (59%), Gaps = 32/610 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEE-----------------------MNNER 37
           M  N N  +A+ LS +I+ AWQ FY  P++E+                            
Sbjct: 1   MTDNRNTIIAVVLSGLILLAWQYFYNMPQMEKQRAAQQTQMQAANPANSSAPAATTQTPA 60

Query: 38  KNIQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGY 97
                    +       A  + DRA+ ++ SPRV++  PSLIGSI LKGA+ DD+    Y
Sbjct: 61  AGSAAPTPASPGAEQQQAAPVKDRAEVIASSPRVKIDTPSLIGSIALKGARIDDVAFVKY 120

Query: 98  HLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWNLISGKILTPTTPI 156
              V   SP   L SP+ TK  Y+AE  +V  A  + +LP  +TVW       LTPTTP+
Sbjct: 121 RETVDPKSPAEVLFSPTGTKAPYYAEFGFVPAAGASAKLPGLDTVWTQQGSNALTPTTPV 180

Query: 157 KLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGV 216
            L + N   ++F RT+S+DE Y+F I D V N+        P G I RH     +  + +
Sbjct: 181 VLTYDNGEGLVFTRTLSVDEKYVFTIKDEVANSGTAPATLYPFGLISRHGLPETSGYYIL 240

Query: 217 QEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFK 276
            EG I VLGDK L E  Y  ++++  S F  SN+WLGI+DKYWA+  +P    S  ++F 
Sbjct: 241 HEGPIGVLGDKGLQEYTYKKMDETKASEFKVSNAWLGITDKYWAATLLPDPAASLTARFS 300

Query: 277 YLSDGHAR-YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLID 335
               G  R YQ  +  + +T+  G   TTT  LFAGAKE  T+  Y+K L + RFE+LID
Sbjct: 301 SKLSGTTRVYQTDYLLDPVTVQAGGHATTTTRLFAGAKEVATVDAYDKQLKLNRFELLID 360

Query: 336 WGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPK 395
           WGWFYFI KPMF  + + Y L GNFG+AI+L TV VK +FFPLA K Y S A MK +QP+
Sbjct: 361 WGWFYFITKPMFWTIDHLYRLFGNFGVAILLVTVIVKAIFFPLANKSYASMAKMKAVQPQ 420

Query: 396 IDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRH 455
           +  L+EK+     +  Q+ M+ +YK   INP+AGC PI +QIPVFFA+YKV+ I++EMRH
Sbjct: 421 LAALKEKYPDDKVK-QQQEMMDIYKKEKINPIAGCLPIAIQIPVFFALYKVLFITIEMRH 479

Query: 456 APFWGWIKDLAAADPTNIFTLFGILPFYLPG------FMHVGIWPIIMSLSMFIQMKMSP 509
           APF+GWI DL+A DPT++F LFG+LP+          ++ +G WP+IM ++M+ QMK++P
Sbjct: 480 APFFGWIHDLSAPDPTHVFNLFGLLPYDPSAVPIIGHYLAIGAWPLIMGVTMWFQMKLNP 539

Query: 510 PPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDR 569
            P D  Q MI +WMPV+F F L+SFPAGL+IYW+W+N +S++QQ+ IMK +G +I L D 
Sbjct: 540 APPDATQKMIFDWMPVIFTFMLASFPAGLVIYWAWNNTLSVIQQSAIMKKNGVKIELFDN 599

Query: 570 LRSTFSKNYN 579
           L+STF+    
Sbjct: 600 LKSTFAGGKK 609


>gi|27383209|ref|NP_774738.1| inner membrane protein translocase component YidC [Bradyrhizobium
           japonicum USDA 110]
 gi|38502983|sp|Q89BQ0|OXAA_BRAJA RecName: Full=Inner membrane protein oxaA
 gi|27356383|dbj|BAC53363.1| blr8098 [Bradyrhizobium japonicum USDA 110]
          Length = 616

 Score =  459 bits (1180), Expect = e-127,   Method: Composition-based stats.
 Identities = 245/616 (39%), Positives = 356/616 (57%), Gaps = 42/616 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEE-----------MNNERKNIQTVK----- 44
           M  N N  +A+ LS +++ AWQ FY  P +E+                +   +       
Sbjct: 2   MTDNRNTILAVILSGLVLIAWQYFYNVPAMEKQRAQQQAQAELQKTTPQPTASATPGATP 61

Query: 45  ------QPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYH 98
                 QP+       A  +  R  A++ SPRV++  P + GSI+LKG + DD+ L  Y 
Sbjct: 62  QSGGAAQPSTPAAGQQAQPVVARDAAIAASPRVKIDTPRIAGSISLKGGRIDDVALVQYR 121

Query: 99  LDVSSNSPIVTLLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWNLISGKILTPTTPIK 157
             V   SP + L SPS T   Y+AE  +V       +LP++ T+W       LTPTTP  
Sbjct: 122 ETVDPKSPPIVLYSPSGTAEPYYAEFGWVPATGVTAKLPDAQTLWQQDGSGSLTPTTPAV 181

Query: 158 LVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQ 217
           L + N   + F RTIS+D+HYLF I D V+N     +   P   I RH     +  + + 
Sbjct: 182 LKWDNGEGLTFRRTISVDDHYLFTIKDEVSNVGNAPVTLYPFALISRHGTPQVSGYYILH 241

Query: 218 EGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKY 277
           EG I  L    L E  Y  I+++   NF  +N WLG++DKYWAS  +P       ++F  
Sbjct: 242 EGLIGYLD--GLQEYAYKKIDEAKSVNFKATNGWLGMTDKYWASALLPDTSAQLQARFSS 299

Query: 278 LS-DGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIH---------HYEKDLAI 327
                   YQ  +  + +T+  G S T    LFAGAKE   +           Y K+L +
Sbjct: 300 NPVGNVHTYQTDYLLDPVTVAIGGSATANARLFAGAKEAGVVGINFPLAGHGGYNKELNL 359

Query: 328 PRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTA 387
             F++LIDWGWFYFI KPMF+ + +FY   GNFGI+I+L TV VKLLFFPLA K Y S A
Sbjct: 360 NHFDLLIDWGWFYFITKPMFLGLDFFYRFFGNFGISILLVTVIVKLLFFPLANKSYASMA 419

Query: 388 NMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVI 447
            MK+IQP++  L+E++     +  Q+ M+++Y+   INP+AGC P+++QIPVFF++YKV+
Sbjct: 420 KMKSIQPQLQALKERYPDDKVK-QQQEMMEIYRKEKINPVAGCLPVVIQIPVFFSLYKVL 478

Query: 448 SISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPG------FMHVGIWPIIMSLSM 501
            +++EMR APF+GWIKDL+A DPTN+F LFG++P           ++ +GIWPIIM ++M
Sbjct: 479 FVTIEMRQAPFYGWIKDLSAPDPTNLFNLFGLIPLDPTTIPVFGHYLALGIWPIIMGITM 538

Query: 502 FIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHG 561
           + QMK++P P D  Q MI NWMP++F F L+ FPAGL+IYW+W+N +S++QQ+ IM+ +G
Sbjct: 539 WFQMKLNPTPPDPTQQMIFNWMPLIFTFMLAGFPAGLVIYWAWNNTLSVLQQSFIMRRNG 598

Query: 562 AEIGLIDRLRSTFSKN 577
            ++ L D L++TF++ 
Sbjct: 599 VKVELFDNLKATFARK 614


>gi|209886640|ref|YP_002290497.1| inner membrane protein OxaA [Oligotropha carboxidovorans OM5]
 gi|209874836|gb|ACI94632.1| inner membrane protein OxaA [Oligotropha carboxidovorans OM5]
          Length = 610

 Score =  459 bits (1180), Expect = e-127,   Method: Composition-based stats.
 Identities = 257/610 (42%), Positives = 361/610 (59%), Gaps = 32/610 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIE-----------------------EMNNER 37
           M  N N  +A+ LS +++  WQ FY  P +                              
Sbjct: 1   MTDNRNTILAVLLSGVVLLGWQYFYNEPEMARQRAAQQAQTQAANPANSAAPNATTQTPA 60

Query: 38  KNIQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGY 97
                    +          + DRA+ ++ SPR++++ P+LIGSI LKGA+FDD++L  Y
Sbjct: 61  AGSTAPTPGSPTIQQQQGAQVKDRAEVIAASPRIKIETPNLIGSIALKGARFDDVSLVKY 120

Query: 98  HLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWNLISGKILTPTTPI 156
              V   SP   L SPS TK  Y+AE  +V  A   I++P  +TVW       LT TTP+
Sbjct: 121 RETVDPKSPAEVLFSPSGTKAPYYAEFGFVPAAGATIKMPTLDTVWTQEGSNALTSTTPV 180

Query: 157 KLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGV 216
            L + N   + F RTIS+D+ Y+F + D V N+        P G I RH     +  + +
Sbjct: 181 VLKYDNGEGLTFTRTISVDDKYVFTVKDDVANSGTAPTTVYPFGLISRHGVPETSGYYIL 240

Query: 217 QEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFK 276
            EG I VLGD+ L E  Y ++++   S F  +N WLGI+DKYWA+  +P    +  ++F 
Sbjct: 241 HEGPIGVLGDQGLQEFSYKNMDEKKTSEFKVTNGWLGITDKYWAATLLPDPAAALTARFS 300

Query: 277 YLSDGHAR-YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLID 335
               G  R YQ  +  + + +  G S TTT  LFAGAKE  T+  Y+K L + RFE+LID
Sbjct: 301 SNLVGPTRIYQTDYLLDPVAVPAGGSATTTTRLFAGAKEVATVDAYDKQLKLNRFELLID 360

Query: 336 WGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPK 395
           WGWFYFI KPMF  +   Y L GNFG+AI+L TV +K +FFPLA K Y S A MK +QP+
Sbjct: 361 WGWFYFITKPMFWAIDQLYRLFGNFGVAILLVTVAIKAVFFPLANKSYASMAKMKAVQPQ 420

Query: 396 IDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRH 455
           +  L+EK+     +  Q+ M+++YK   INP+AGC PI +QIPVFFA+YKV+ I++EMRH
Sbjct: 421 LTALKEKYPDDRVK-QQQEMMEIYKKEKINPIAGCLPIAIQIPVFFALYKVLFITIEMRH 479

Query: 456 APFWGWIKDLAAADPTNIFTLFGILPFYLPG------FMHVGIWPIIMSLSMFIQMKMSP 509
           APF+GWI+DL+A DPT+IF LFG+LPF          ++ +G WP+IM ++M+ QMK++P
Sbjct: 480 APFFGWIRDLSAPDPTHIFNLFGLLPFDPSAVPLIGTYLAIGAWPVIMGITMWFQMKLNP 539

Query: 510 PPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDR 569
            P D  Q MI +WMPVVF F L+SFPAGL+IYW+W+N++S++QQ+ IMK +G +I L D 
Sbjct: 540 QPPDPTQKMIFDWMPVVFTFMLASFPAGLVIYWAWNNLLSVLQQSAIMKKNGVKIELFDN 599

Query: 570 LRSTFSKNYN 579
           L+S F+    
Sbjct: 600 LKSMFASKKA 609


>gi|254780483|ref|YP_003064896.1| putative inner membrane protein translocase component YidC
           [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040160|gb|ACT56956.1| putative inner membrane protein translocase component YidC
           [Candidatus Liberibacter asiaticus str. psy62]
          Length = 581

 Score =  458 bits (1178), Expect = e-126,   Method: Composition-based stats.
 Identities = 581/581 (100%), Positives = 581/581 (100%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD
Sbjct: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY
Sbjct: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF 180
           FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF
Sbjct: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF 180

Query: 181 KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS 240
           KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS
Sbjct: 181 KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS 240

Query: 241 SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGK 300
           SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGK
Sbjct: 241 SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGK 300

Query: 301 SITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF 360
           SITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF
Sbjct: 301 SITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF 360

Query: 361 GIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYK 420
           GIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYK
Sbjct: 361 GIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYK 420

Query: 421 THNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL 480
           THNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL
Sbjct: 421 THNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL 480

Query: 481 PFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLII 540
           PFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLII
Sbjct: 481 PFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLII 540

Query: 541 YWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ 581
           YWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ
Sbjct: 541 YWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ 581


>gi|126724910|ref|ZP_01740753.1| putative inner membrane protein translocase component YidC
           [Rhodobacterales bacterium HTCC2150]
 gi|126706074|gb|EBA05164.1| putative inner membrane protein translocase component YidC
           [Rhodobacterales bacterium HTCC2150]
          Length = 620

 Score =  457 bits (1176), Expect = e-126,   Method: Composition-based stats.
 Identities = 216/604 (35%), Positives = 331/604 (54%), Gaps = 26/604 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDN-------SYA 54
           + N N  +A+ALSV+++ AW  F+  P  E         Q+       D        S  
Sbjct: 3   DENKNLLLAMALSVMVIIAWSIFFPAPVDETPVAATSGEQSTTAGVSADAGSDVAAVSNV 62

Query: 55  AVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPS 114
               + R  ALS + R ++  P L GSI+  G + DDL+L+ Y +++   S IVTLL+P 
Sbjct: 63  PTSAEVRTAALSSATRADIDTPRLSGSISTLGGRIDDLSLKDYRIELDEASDIVTLLTPE 122

Query: 115 NTKNAYFAELDYVSTANN--IELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTI 172
            T++AY+A   +    +    ++P   T W +   + LTP TP+ LV++N   + F + I
Sbjct: 123 GTQDAYYALYGWAPGGDLGWDDVPGPETQWAIEGNEKLTPETPVTLVWENTTGMTFRQII 182

Query: 173 SLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ 232
           S+D  +LF +   V+NN     R +P  +I RH   T    F +          +S  E 
Sbjct: 183 SVDADFLFSVQQEVSNNGSTAARLAPYSQIRRHGEPTDMKGFFILHEGAIRQSGESQKEY 242

Query: 233 KYSDIEKSSISNFH---------ESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
            YSD+      +            SN WLG +D YW +  IP     F S  +Y      
Sbjct: 243 DYSDLADFDRDDQWGDRSDVVDVASNGWLGFTDHYWMTALIPESAQPFKSVLQY-KAQQD 301

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
            Y ++     +T+  G++ T T   FAGAKE+  I  YE +  I RF   IDWGWFYF+ 
Sbjct: 302 VYLSETRLPTLTVEAGQTNTVTTHFFAGAKEWAVIREYEANNGIYRFIDSIDWGWFYFLT 361

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           KP+F ++     ++GN G +I+  T+ +K L FPLA K YVS A MK +QP++ E++EK 
Sbjct: 362 KPIFWVLHSLNGIIGNMGWSIIGLTLLIKALLFPLAYKSYVSMAKMKELQPQMAEIKEKA 421

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
                + +QK +++LYK   +NP +GC PILLQIP+FF++YKVI +++++RHAP+ GWIK
Sbjct: 422 GDDKSK-VQKEIMELYKKEKVNPASGCLPILLQIPIFFSLYKVIFVTIDLRHAPWVGWIK 480

Query: 464 DLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQA 517
           DL+A D +++F LFGILP+  P        + +G+ P+++ +SM++Q K++P P D  QA
Sbjct: 481 DLSAPDTSSLFNLFGILPWDSPEPGSIMALIFIGVLPLLLGISMWLQQKLNPAPTDATQA 540

Query: 518 MILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           MI  WMP VF+F L SF +GL++YW  +N I+  QQ +IM+  G +  +   + S+F K 
Sbjct: 541 MIFAWMPWVFMFMLGSFASGLVVYWIANNTITFTQQYLIMRSQGFKPDVFGNIMSSFKKK 600

Query: 578 YNSQ 581
              +
Sbjct: 601 EPVK 604


>gi|86747809|ref|YP_484305.1| putative inner membrane protein translocase component YidC
           [Rhodopseudomonas palustris HaA2]
 gi|86570837|gb|ABD05394.1| protein translocase subunit yidC [Rhodopseudomonas palustris HaA2]
          Length = 629

 Score =  457 bits (1176), Expect = e-126,   Method: Composition-based stats.
 Identities = 239/620 (38%), Positives = 356/620 (57%), Gaps = 50/620 (8%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEM---------------NNERKNIQTVKQ 45
           M  N N  +A+ LS +++  WQ F+  P++E+                  ++    T   
Sbjct: 1   MSDNRNTILAVILSGLVLLGWQYFFNIPQMEKQRAAQQAQQQQDAAKQPTQQAPAATTPG 60

Query: 46  PNQVDN-----------------SYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQ 88
                                        +  R  A++ SPR++++ P L G+I+LKGA+
Sbjct: 61  APNAPAASAAPGAPGAPGAPAARQSGNAPVVSREAAIAASPRIKVETPRLDGTISLKGAR 120

Query: 89  FDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVST-ANNIELPNSNTVWNLISG 147
            DDL+L      V   SP + L SPS   N Y+AE  +V    +N++LP+ NT+W     
Sbjct: 121 IDDLSLTQLRETVDPKSPPIHLFSPSGGANPYYAEFGWVGAAGSNVKLPDQNTMWQQQGS 180

Query: 148 KILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKP 207
             LTP++PI L + N   + F R I++D+ YLF + D VTN     +   P   I RH  
Sbjct: 181 GALTPSSPITLTWDNGEGLTFRRQIAVDDRYLFTVKDDVTNVGSSPVTLYPYALISRHGT 240

Query: 208 QTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSK 267
                 + + EG I  LG+  L E  Y+ I+++    F  +N+W+GI+DKYWAS  +P  
Sbjct: 241 PHVEGYYILHEGLIGYLGEHGLQEYGYAKIDEAKTVGFKATNAWMGITDKYWASALLPDT 300

Query: 268 ETSFHSQFKYLSDGHAR-YQAKFSANEITILPGKSITTTNFLFAGAKEFPT--------- 317
                ++F     G  R YQ  +  +  T+  G ++T    LFAGAKE            
Sbjct: 301 NAQLQARFSSNQVGATRTYQTDYLEDAKTVPIGGTVTANARLFAGAKEARVVGINFPFAG 360

Query: 318 IHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFP 377
           +  Y + L +  F++LIDWGWFYFI KPMF+ + +F++LVGNFG+AI+L TV +K+LF P
Sbjct: 361 LGGYNQQLGLNHFDLLIDWGWFYFITKPMFLALDFFFHLVGNFGVAILLVTVLIKVLFLP 420

Query: 378 LAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQI 437
           LA K Y S A MK IQP++  L+E+      +  Q+ M+++Y+   INP+AGC P+LLQI
Sbjct: 421 LANKSYASMAKMKAIQPQLLALKERHPDDKAK-QQQEMMEIYRKEKINPVAGCLPVLLQI 479

Query: 438 PVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPG------FMHVG 491
           PVFF++YKV+ +++EMRHAPF+GWI DL+AADPTN+F LFG+LPF          ++ +G
Sbjct: 480 PVFFSLYKVLFVTIEMRHAPFFGWIHDLSAADPTNLFNLFGLLPFDPTAIPVLGHYLVLG 539

Query: 492 IWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIV 551
           +WP++M  +M+ QMK++P P D  Q MI  WMPV+F F L+ FPAGL+IYW+W+N++S++
Sbjct: 540 VWPLVMGFTMWFQMKLNPQPPDPTQQMIFAWMPVIFTFMLAHFPAGLVIYWAWNNLLSVI 599

Query: 552 QQAVIMKMHGAEIGLIDRLR 571
           QQA IM+ +G ++ L D LR
Sbjct: 600 QQAYIMRRNGVKVELFDNLR 619


>gi|222147367|ref|YP_002548324.1| putative inner membrane protein translocase component YidC
           [Agrobacterium vitis S4]
 gi|254772742|sp|B9JZK8|OXAA_AGRVS RecName: Full=Inner membrane protein oxaA
 gi|221734357|gb|ACM35320.1| inner membrane insertion protein [Agrobacterium vitis S4]
          Length = 620

 Score =  457 bits (1175), Expect = e-126,   Method: Composition-based stats.
 Identities = 290/618 (46%), Positives = 392/618 (63%), Gaps = 39/618 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEE-------------MNNERKNIQTVKQPN 47
           ME N NY +AIALSV++V  WQ FY+ PRIE                   +         
Sbjct: 2   MENNRNYLIAIALSVMVVLGWQFFYMNPRIEAQRQAEQAQQAQQAKTPATQATPGAAVNG 61

Query: 48  QVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPI 107
            +     A     R  A++ S RVE+   +L GSINL GA+ DDL L+GYH  V   SPI
Sbjct: 62  ALPGQTQASATTSREDAVAKSARVEINTEALSGSINLTGARLDDLRLKGYHETVDKTSPI 121

Query: 108 VTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNIL 167
           +TLL+P++TK+ YFAE+ ++    +  +P  +TVW +  G+ LT TTP+ L + N   + 
Sbjct: 122 ITLLNPADTKDGYFAEIGFIGGEKSGSVPGPSTVWTVKDGQTLTETTPVTLTYTNETGLT 181

Query: 168 FERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDK 227
           F R IS+D+HY+F I DTV N     I  +P GR+ R+      +T+ + EGFI V+G  
Sbjct: 182 FSRKISVDKHYMFTIEDTVANAGGADISLAPYGRVTRYNKPAVASTYVLHEGFIGVMGSG 241

Query: 228 SLV----EQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
                  E KY+ IEK + +N   +  WLGI+DKYWA+  +P +  ++ S+F + +DG A
Sbjct: 242 DGKFASVEAKYAAIEKENETNAKATGGWLGITDKYWAATLVPPQSLAYDSRFSHFTDGQA 301

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYE--------------------- 322
           R+QA +  + +TI PG+S T    LFAGAKE P +  Y                      
Sbjct: 302 RFQADYKNDPVTIAPGQSTTLKTLLFAGAKEVPVVDGYALDKSWFGQAFTNLFAGAKDTV 361

Query: 323 KDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQ 382
           +   IPRF++LIDWGWFYF+ KPMF LM +F+  VGNFG+AI+LTT+ VKLLFFPLA KQ
Sbjct: 362 QQYDIPRFDLLIDWGWFYFLTKPMFKLMDFFFRQVGNFGVAILLTTIAVKLLFFPLASKQ 421

Query: 383 YVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFA 442
           Y S ANMK +QPK++EL+ K        LQ+AM++LYKT  INP+AGCWP+LLQIPVFFA
Sbjct: 422 YASMANMKRMQPKMEELKAKHGD-DRMALQQAMMELYKTEKINPVAGCWPLLLQIPVFFA 480

Query: 443 IYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMF 502
           +YKVI I++EMRHAPF+GWI DL+A DPT+   LFG+LPF  P  +H+GIWPIIM ++MF
Sbjct: 481 LYKVIYITIEMRHAPFFGWIHDLSAPDPTSFVNLFGLLPFESPAMLHLGIWPIIMGITMF 540

Query: 503 IQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           +QM+M+P P D  QAM+ NWMP+VF F L SFPAGL+IYW+W+N +S++QQ++IMK HG 
Sbjct: 541 VQMRMNPTPPDPTQAMLFNWMPLVFTFMLGSFPAGLVIYWAWNNTLSVLQQSIIMKRHGV 600

Query: 563 EIGLIDRLRSTFSKNYNS 580
           +I L D L+  F +    
Sbjct: 601 KIELFDNLKGLFQRKSAK 618


>gi|217977385|ref|YP_002361532.1| 60 kDa inner membrane insertion protein [Methylocella silvestris
           BL2]
 gi|254773006|sp|B8EPG5|OXAA_METSB RecName: Full=Inner membrane protein oxaA
 gi|217502761|gb|ACK50170.1| 60 kDa inner membrane insertion protein [Methylocella silvestris
           BL2]
          Length = 600

 Score =  457 bits (1174), Expect = e-126,   Method: Composition-based stats.
 Identities = 242/598 (40%), Positives = 347/598 (58%), Gaps = 22/598 (3%)

Query: 1   ME-RNWNYFVAIALSVIIVYAWQNFYVYPRI-----EEMNNERKNIQTVKQPNQVDNSYA 54
           M   + N ++AI LS +++  W   +   +       +  ++     T  Q        A
Sbjct: 1   MNKDSRNLYLAIGLSCLVIVGWSYIFAPKQADRARLAQTQSQNAPAGTQPQSAATPQDAA 60

Query: 55  A-----VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVT 109
                  L   RA+AL+ SPR+++  P++ GS++LKGA+ DD++L+GY   V  NSP + 
Sbjct: 61  NFSPLDALPKTRAEALAASPRLKIDTPAIFGSLSLKGARLDDVSLKGYRETVDPNSPNIV 120

Query: 110 LLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFE 169
           LLSP    +AY+AE  +V           +          LTP  P+ L + N   ++F 
Sbjct: 121 LLSPQGAPDAYYAEAGFVPAPGEAVAVPRSDTVWTADRDALTPEAPVTLTYDNGQGLVFH 180

Query: 170 RTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSL 229
           R I++D+ ++F I D+V N S   +  +    + RH      N   + EGF+ V+GD  +
Sbjct: 181 RQIAVDDRFMFTIKDSVENKSAKPVTLASYALVARHGLPKTVNYAVLHEGFVGVIGDAGV 240

Query: 230 VEQKYSDIEKSS--ISNFHESNSWLGISDKYWASVFIPSKETSFHSQFK--YLSDGHARY 285
            E  Y  IEK       F  +  WLG +DKYWA+  IP +     ++F       G   Y
Sbjct: 241 QEFHYDKIEKEDHGYKTFSGAGGWLGFTDKYWAATVIPDQAAPIEARFSANSTPSGIKTY 300

Query: 286 QAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKP 345
           +A F     TI PG +    + +FAGAKE  T+  Y+ DL I +FE+LIDWGWFYFI +P
Sbjct: 301 RADFVGPVQTIAPGATTEAMSRVFAGAKEVHTLDAYQADLGIKKFELLIDWGWFYFITRP 360

Query: 346 MFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQ 405
           MF L+ + Y+L GNFG+AI+L TV VK LFFPLA K Y+S A MK + P+I  LREK+ +
Sbjct: 361 MFRLLHFLYSLTGNFGVAILLATVIVKGLFFPLANKSYLSMAKMKAVAPEIAALREKYPE 420

Query: 406 SPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDL 465
              +  Q+  + LYK   INP++GC P+L+QIPVFFA+YKV+ +++EMRHAPF+GWI DL
Sbjct: 421 DKMK-QQQETMALYKREKINPVSGCLPMLIQIPVFFALYKVLFVTIEMRHAPFFGWIHDL 479

Query: 466 AAADPTNIFTLFGILPFYLPG------FMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMI 519
           +A DPTN+F LFG+LPF          F+ +G+WP++M +SMF+QMK +P PAD  Q  I
Sbjct: 480 SAPDPTNLFNLFGLLPFDPTQLPLIGHFLAIGVWPLLMGVSMFVQMKANPEPADPMQKQI 539

Query: 520 LNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
             WMPV+F F L  FP GL+IYW+W+N++S+ QQ +IMK  G ++ L D L S F K 
Sbjct: 540 FTWMPVIFTFTLGGFPVGLVIYWTWNNILSVSQQTLIMKRAGVKVELFDNLASLFRKK 597


>gi|148258511|ref|YP_001243096.1| putative inner membrane protein translocase component YidC
           [Bradyrhizobium sp. BTAi1]
 gi|146410684|gb|ABQ39190.1| protein translocase subunit yidC [Bradyrhizobium sp. BTAi1]
          Length = 621

 Score =  456 bits (1173), Expect = e-126,   Method: Composition-based stats.
 Identities = 256/620 (41%), Positives = 367/620 (59%), Gaps = 44/620 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERK-----------NIQTVKQPNQV 49
           M  N N  +A+ LS +++  WQ FY  P++E+   + +            +Q    P+  
Sbjct: 1   MTDNRNTILAVILSGLVLILWQVFYNGPQMEKQRAQAQMQAELAKKQAPAVQPEATPSAT 60

Query: 50  DNSYAAVL---------------IDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNL 94
               AA                 +  R  A++ +PRV++  P L GSI+LKGA+ DDL  
Sbjct: 61  PQPNAAASGSPSAPGGAATTATGVVARDAAIAATPRVKIDTPRLSGSISLKGARIDDLAF 120

Query: 95  RGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVS-TANNIELPNSNTVWNLISGKILTPT 153
             Y   V   SP + L SPSNT   Y+AE  +V      +++P+ NTVW       LTPT
Sbjct: 121 VQYRETVDPKSPAIVLFSPSNTAEPYYAEFGWVGAPGAKVQVPDQNTVWQQDGTNALTPT 180

Query: 154 TPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNT 213
           TP+KL   NA+ + F+RTIS+DEHYLF I D VTN     +   P G I RH     +  
Sbjct: 181 TPVKLSTTNADGLTFKRTISVDEHYLFTIKDEVTNAGSAPVTLYPFGLISRHGTPHVSGY 240

Query: 214 FGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHS 273
           + + EG I  LG+K L E  Y  ++    + F  +N WLGI+DKYWA+  +P  +    +
Sbjct: 241 YILHEGLIGYLGEKGLQEYTYKKMDDDKAAKFDVTNGWLGITDKYWATALLPMTDARLTA 300

Query: 274 QFKYL-SDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPT---------IHHYEK 323
            +     D   RYQ  +     T+  G + + +  LFAGAKE            +  Y +
Sbjct: 301 NYSSKLVDNQHRYQTDYVETPQTVPAGGAASVSTRLFAGAKEAGVVGINFPIGGLGGYNQ 360

Query: 324 DLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQY 383
            L +  F++LIDWGWFYF+ KPMF+ + +F+   GNFGI+I+L TV VKLLFFPLA K Y
Sbjct: 361 QLGLNHFDLLIDWGWFYFLTKPMFLALDFFFRFFGNFGISILLVTVLVKLLFFPLANKSY 420

Query: 384 VSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAI 443
            S A MK IQP++  L+E++     +  Q+ M+++YK   INP+AGC P++LQIPVFF++
Sbjct: 421 ASMAKMKAIQPQLQALKERYPDDRMK-QQQEMMEIYKKEKINPVAGCLPVVLQIPVFFSL 479

Query: 444 YKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPG------FMHVGIWPIIM 497
           YKV+ +++EMRHAPF+GWIKDL+A DPTN+FTLFG++PF          ++ +GIWPIIM
Sbjct: 480 YKVLFVTIEMRHAPFYGWIKDLSAPDPTNLFTLFGLIPFDPTQLPLFGHYLALGIWPIIM 539

Query: 498 SLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIM 557
            ++M++QMK++P P D  QAMI NWMP++F F L+ FPAGL+IYW+W+N +S++QQ  IM
Sbjct: 540 GITMWVQMKLNPAPPDPTQAMIFNWMPIIFTFMLAGFPAGLVIYWAWNNTLSVLQQGFIM 599

Query: 558 KMHGAEIGLIDRLRSTFSKN 577
           + +G ++ L D +R TF K 
Sbjct: 600 RRNGVKVELFDNIRGTFKKK 619


>gi|325291817|ref|YP_004277681.1| inner membrane protein translocase component YidC [Agrobacterium
           sp. H13-3]
 gi|325059670|gb|ADY63361.1| putative inner membrane protein translocase component YidC
           [Agrobacterium sp. H13-3]
          Length = 600

 Score =  455 bits (1171), Expect = e-126,   Method: Composition-based stats.
 Identities = 285/596 (47%), Positives = 398/596 (66%), Gaps = 19/596 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           ME+N NYF+AIALSV+IV AWQ  Y+ PRIE+     +  Q  +Q  Q   +  A     
Sbjct: 2   MEKNRNYFIAIALSVVIVLAWQFLYMNPRIEQQRRAEEARQAQQQTTQQQPAPGAAPGVT 61

Query: 61  RAQA-----------------LSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSS 103
              A                 ++ S RV +   ++ GSINL GA+FDD+ L+GYH  V  
Sbjct: 62  ADGAPPASSTQAAATATREEAIAKSQRVAIDTNAIAGSINLTGARFDDIRLKGYHETVDD 121

Query: 104 NSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNA 163
           +SPI+TL SPS+TK+ YF EL YV  A+   +P   TVW L SG  LT TTP+ L + N 
Sbjct: 122 SSPIITLFSPSDTKDGYFTELGYVGGADAGSVPGPATVWTLASGDKLTETTPVTLKYTNQ 181

Query: 164 NNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAV 223
           N ++F RT+S+D+HY+  + D V N     + F+  GR+ R+        F + EGF+ V
Sbjct: 182 NGVVFSRTVSIDQHYMITVNDKVENPGQAPVSFATYGRVTRNNKPAIPPVFVIHEGFLGV 241

Query: 224 LGDK-SLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGH 282
            G   SL E+KY D+E++ ++    +  WLGI+DKYWA+  +P + T F +++ ++    
Sbjct: 242 SGKDGSLTEEKYKDVEETPVTIAKATGGWLGITDKYWAAAIVPPQMTPFETRYSHIKGNQ 301

Query: 283 ARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFI 342
             YQA F ++ +T+ PG+SI   + +FAGAKE P +  YE + +IP+F++LIDWGWFYFI
Sbjct: 302 PSYQADFKSDTMTVEPGQSIELKSLVFAGAKEVPLVDRYETEYSIPKFDLLIDWGWFYFI 361

Query: 343 AKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREK 402
            KPMF +M +F+   GNFG+AI+LTT+ VK LFFPLA KQY S ANMK +QPK++EL+ K
Sbjct: 362 TKPMFKMMDFFFRYFGNFGVAILLTTIVVKALFFPLASKQYASMANMKRMQPKMEELKAK 421

Query: 403 FKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWI 462
                   +Q+AM+QLYK   INP+AGCWP+LLQIPVFFA+YKVI +++EMRHAPF+GWI
Sbjct: 422 HGD-DRMAMQQAMMQLYKEEKINPVAGCWPMLLQIPVFFALYKVIYVTIEMRHAPFFGWI 480

Query: 463 KDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNW 522
            DL+A DPT++F LFG+LP+ +P F+ +G+WP++M ++MF+QM+M+P P D  QAMI  W
Sbjct: 481 HDLSAPDPTSLFNLFGLLPYDVPHFLMIGVWPLVMGITMFLQMRMNPTPPDPTQAMIFTW 540

Query: 523 MPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNY 578
           MP++F F L+SFPAGL+IYW+W+N +SI QQA+IMK HGA+I L D L+  F +  
Sbjct: 541 MPLIFTFMLASFPAGLVIYWAWNNTLSISQQALIMKRHGAKIELFDNLKGLFKRKP 596


>gi|91974551|ref|YP_567210.1| putative inner membrane protein translocase component YidC
           [Rhodopseudomonas palustris BisB5]
 gi|91681007|gb|ABE37309.1| protein translocase subunit yidC [Rhodopseudomonas palustris BisB5]
          Length = 621

 Score =  455 bits (1169), Expect = e-125,   Method: Composition-based stats.
 Identities = 242/621 (38%), Positives = 362/621 (58%), Gaps = 42/621 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL--- 57
           M  N N  +A+ LS +++  WQ F+  P++E+    ++  Q  +   Q     A      
Sbjct: 1   MTDNRNTILAVILSGLVLLGWQYFFNIPQMEKQRAAQQAQQQQEAAKQQTPPAATTPGAP 60

Query: 58  ---------------------IDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRG 96
                                +  R  A++ SPR++++ P L G+++LKGA+ DDL+L  
Sbjct: 61  NAPAAPGAPGAPANQPAANAPVVSRDAAIAASPRIKVETPRLDGTLSLKGARIDDLSLSQ 120

Query: 97  YHLDVSSNSPIVTLLSPSNTKNAYFAELDYVST-ANNIELPNSNTVWNLISGKILTPTTP 155
           YH  V   S  + L SPS + N Y+AE  +V    +N++LP+ NT+W       LTP  P
Sbjct: 121 YHETVDPKSAPIHLFSPSGSANPYYAEFGWVGAAGSNVKLPDQNTLWEQEGSGALTPANP 180

Query: 156 IKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFG 215
           + L + N   + F R I++D+ YLF I D VTN     +   P   I RH        + 
Sbjct: 181 VTLKWDNGEGLTFRRQIAVDDRYLFTIKDDVTNVGGGPVTLYPFALISRHGTPHVEGFYI 240

Query: 216 VQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQF 275
           + EG I  LG++ L E  Y+ I+++    F  +N+W+GI+DKYWAS  +P       ++F
Sbjct: 241 LHEGLIGYLGEQGLQEYGYAKIDEAKTVGFKATNAWMGITDKYWASALLPDTNAQLQARF 300

Query: 276 KYLSDGHAR-YQAKFSANEITILPGKSITTTNFLFAGAKEFPT---------IHHYEKDL 325
                G  R YQ  +  +  T+  G + T T  LFAGAKE            +  Y + L
Sbjct: 301 SSNQVGATRTYQTDYLEDAKTVPIGGTATATARLFAGAKEARVVGINFPFAGLGGYNQQL 360

Query: 326 AIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVS 385
            +  F++LIDWGWFYFI KPMF+ + +F++LVGNFG+AI+L TV VKL+F PLA K Y S
Sbjct: 361 GLNHFDLLIDWGWFYFITKPMFLALDFFFHLVGNFGVAILLVTVLVKLIFLPLANKSYAS 420

Query: 386 TANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYK 445
            A MK IQP++  L+E+      +  Q+ M+++Y+   INP+AGC P+LLQIPVFF++YK
Sbjct: 421 MAKMKAIQPQLLALKERHPDDKAK-QQQEMMEIYRKEKINPVAGCLPVLLQIPVFFSLYK 479

Query: 446 VISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSL 499
           V+ +++EMRHAPF+GWI DL+AADPTN+F LFG++P+          ++ +G+WP++M  
Sbjct: 480 VLFVTIEMRHAPFFGWIHDLSAADPTNLFNLFGLIPYDPSTLPVIGSYLVLGVWPLVMGF 539

Query: 500 SMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKM 559
           +M+ QMK++P P D  Q MI  WMPV+F F L+ FPAGL+IYW+W+N +S++QQA IM+ 
Sbjct: 540 TMWFQMKLNPQPPDPTQQMIFAWMPVIFTFMLAHFPAGLVIYWAWNNTLSVIQQAYIMRR 599

Query: 560 HGAEIGLIDRLRSTFSKNYNS 580
           +G ++ L D L+S   K   +
Sbjct: 600 NGVKVELWDNLKSAVVKPKKT 620


>gi|260432492|ref|ZP_05786463.1| inner membrane protein OxaA [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416320|gb|EEX09579.1| inner membrane protein OxaA [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 609

 Score =  454 bits (1167), Expect = e-125,   Method: Composition-based stats.
 Identities = 217/609 (35%), Positives = 336/609 (55%), Gaps = 33/609 (5%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAA------ 55
           ++N N  +A ALS +++  W   +  P    + ++     T     Q  N+         
Sbjct: 3   DQNKNLILATALSFLVILVWFVLFPPPEPTTLQDQTAISATEGDEIQTPNAAEPSVVGDA 62

Query: 56  VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSN 115
                 AQ +S  PRVE+  P L GS++L G + D+L L+ Y + +  ++PIV LLSP  
Sbjct: 63  ATEATEAQPVSDVPRVEIDTPRLTGSLSLSGGRVDELYLKDYKVSLEDDAPIVELLSPVG 122

Query: 116 TKNAYFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTIS 173
           + +AY+A   +   A     ++P  NT+WN+ SG+ L   +P+ L + N N + F RTI+
Sbjct: 123 SDSAYYALYGWAPGAGLSGADVPGPNTLWNIESGETLGVDSPVTLKWDNGNGLTFRRTIA 182

Query: 174 LDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKP------QTATNTFGVQEGFIAVLGDK 227
           +DE Y+F +  +V N +  +I  +P G + RH            N F + EG I +    
Sbjct: 183 VDEDYMFTVTQSVENATQAEIGMAPYGILARHGMGEDGDLPGLKNFFILHEGVIGMAD-G 241

Query: 228 SLVEQKYSDIEKSSISNFHE---------SNSWLGISDKYWASVFIPSKETSFHSQFKYL 278
           +L E KY D+    I               N W+G +D YW +  IP   + F +  KY 
Sbjct: 242 TLTEVKYDDVRDFDIDPNERAQAEVYQVKENGWIGFTDHYWMTTLIPEPGSPFKAAAKY- 300

Query: 279 SDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGW 338
                 YQ +     +T+ PG++      LFAGAKE+ TI  Y+    + +F   IDWGW
Sbjct: 301 DSRRKIYQTETVLPTLTVAPGETAQVKTRLFAGAKEWETIREYQAQ-GVQKFIDSIDWGW 359

Query: 339 FYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDE 398
           F+F+ KP+F L+     L+GN G +I+  T+ +K + FPLA K YVS A MK +QP+++ 
Sbjct: 360 FFFLTKPIFWLLHNINALIGNMGWSIIGLTLIIKAILFPLAFKSYVSMAKMKELQPQMEA 419

Query: 399 LREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF 458
           L+E       Q +Q+ M++LYK   +NP AGC PILLQIP+FF++YKVI +++E+RHAP+
Sbjct: 420 LKEAAGD-DRQKMQQGMMELYKKEKVNPAAGCLPILLQIPIFFSLYKVIFVTIELRHAPW 478

Query: 459 WGWIKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPA 512
           +G  +DL+A DPT+I  LFG+LP+  P        + +GI P+++ +SM++Q K++P P 
Sbjct: 479 FGPFRDLSAPDPTSIMNLFGLLPWAGPEPGTLMATIFIGILPLLLGISMWLQQKLNPAPT 538

Query: 513 DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRS 572
           D  QAMI  WMP VF+F L SF +GL+IYW  +N I+  QQ +IM+  G +  +   + S
Sbjct: 539 DPTQAMIFAWMPWVFMFMLGSFASGLVIYWIANNTITFTQQYLIMRSQGYKPDVFGNIMS 598

Query: 573 TFSKNYNSQ 581
           +F +   + 
Sbjct: 599 SFKRTPKTD 607


>gi|159184283|ref|NP_353415.2| putative inner membrane protein translocase component YidC
           [Agrobacterium tumefaciens str. C58]
 gi|38503098|sp|Q8UIB3|OXAA_AGRT5 RecName: Full=Inner membrane protein oxaA
 gi|159139609|gb|AAK86200.2| preprotein translocase 60 kD membrane subunit [Agrobacterium
           tumefaciens str. C58]
          Length = 599

 Score =  454 bits (1166), Expect = e-125,   Method: Composition-based stats.
 Identities = 281/596 (47%), Positives = 396/596 (66%), Gaps = 19/596 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           ME+N NYF+AIALSV+IV AWQ  Y+ PRIE+     +  Q  +Q  Q   +  A     
Sbjct: 1   MEKNRNYFIAIALSVVIVLAWQFLYMNPRIEQQRRAEEARQAQQQTTQQQPAPGAAPGAT 60

Query: 61  RAQA-----------------LSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSS 103
              A                 ++ + RV +   ++ GSINL GA+FDD+ L+GYH  V  
Sbjct: 61  VEGAPPASSTQAAATATREEAIARTQRVAIDTNAIAGSINLTGARFDDIRLKGYHETVDD 120

Query: 104 NSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNA 163
           +SPI+TL SP++TK+ YF EL YV+      +P   TVW L SG  LT TTP+ L + N+
Sbjct: 121 SSPIITLFSPADTKDGYFTELGYVAAQEVGGVPGPTTVWTLASGDKLTETTPVTLTYTNS 180

Query: 164 NNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAV 223
             ++F RT+S+DEHY+  I D V N     I F+  GR+ R+        F + EGF+ V
Sbjct: 181 KGVVFSRTVSIDEHYMLSIADKVENPGQAAISFATYGRVTRNNKPVIPPVFVIHEGFLGV 240

Query: 224 LGDK-SLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGH 282
            G   SL E+KY D+E+  ++    +  WLGI+DKYWA+  +P + T F +++ +++   
Sbjct: 241 SGKDGSLTEKKYKDVEEEPVTVAKATGGWLGITDKYWAAAIVPPQTTPFETRYSHITGNQ 300

Query: 283 ARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFI 342
             YQA F ++ +T+  G+SI   + +FAGAKE P +  YE + ++P+F++LIDWGWFYFI
Sbjct: 301 PSYQADFKSDSMTVEAGQSIELKSLVFAGAKEVPLVDRYETEYSVPKFDLLIDWGWFYFI 360

Query: 343 AKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREK 402
            KPMF +M +F+   GNFG+AI+LTT+ VK LFFPLA KQY S ANMK +QPK++EL+ K
Sbjct: 361 TKPMFKMMDFFFRYFGNFGVAILLTTIVVKALFFPLASKQYASMANMKRMQPKMEELKAK 420

Query: 403 FKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWI 462
                   +Q+AM+QLYK   INP+AGCWP+LLQIPVFFA+YKVI +++EMRHAPF+GWI
Sbjct: 421 HGD-DRMAMQQAMMQLYKEEKINPVAGCWPMLLQIPVFFALYKVIYVTIEMRHAPFFGWI 479

Query: 463 KDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNW 522
            DL+A DPT++F LFG+LP+ +P F+ +G+WP++M ++MF+QM+M+P P D  QAMI  W
Sbjct: 480 HDLSAPDPTSLFNLFGLLPYDVPHFLMIGVWPLVMGITMFLQMRMNPTPPDPTQAMIFTW 539

Query: 523 MPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNY 578
           MP++F F L+SFPAGL+IYW+W+N +SI QQA+IMK HGA+I L D ++  F +  
Sbjct: 540 MPLIFTFMLASFPAGLVIYWAWNNTLSISQQALIMKRHGAKIELFDNIKGLFKRKP 595


>gi|115522671|ref|YP_779582.1| putative inner membrane protein translocase component YidC
           [Rhodopseudomonas palustris BisA53]
 gi|115516618|gb|ABJ04602.1| protein translocase subunit yidC [Rhodopseudomonas palustris
           BisA53]
          Length = 626

 Score =  454 bits (1166), Expect = e-125,   Method: Composition-based stats.
 Identities = 243/616 (39%), Positives = 362/616 (58%), Gaps = 47/616 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEM--------NNERKNIQTVKQPNQVDNS 52
           M  N N  +A+ LS +++  WQ F+  P++E+         +     +Q   QPN    +
Sbjct: 1   MTDNRNTILAVILSGLVLLGWQYFFNIPQMEKQRAAEMAARSQATSQVQPTAQPNAQPGA 60

Query: 53  YAAVL----------------------IDDRAQALSMSPRVELKNPSLIGSINLKGAQFD 90
             A                           R  AL+ SPRV+++ P L GSI+LKGA+ D
Sbjct: 61  SGAQPGVPAPQAGTPTPNAAAPAAVTPTVSRDAALAASPRVKIETPRLSGSISLKGARLD 120

Query: 91  DLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVST-ANNIELPNSNTVWNLISGKI 149
           D+ L  +   V   SP + L SPS +K+ Y+AE  +V+    N+++P+ NTVW       
Sbjct: 121 DIALVQFRETVDPKSPAIELFSPSGSKHPYYAESGWVAAVGTNVKVPDQNTVWTQEGSNS 180

Query: 150 LTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT 209
           LTPT+P+ L + N   + F RTI++DE YLF + D V+N     +   P   I RH    
Sbjct: 181 LTPTSPVVLRYDNGEGLTFRRTIAVDERYLFTMKDEVSNIGNAPVTLYPFALISRHGAPQ 240

Query: 210 ATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKET 269
               + + EG +  LG++ L E  Y+ I+++   NF  +N WLGI+DKYWAS  +P    
Sbjct: 241 VAGYYILHEGLVGYLGEQGLQEYGYAKIDEAKAVNFKVTNGWLGITDKYWASALLPDTTA 300

Query: 270 SFHSQFKYL-SDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIH--------H 320
              ++F    ++    YQ  +  +   +  G + +    LFAGAKE   +          
Sbjct: 301 QLQARFSSNLANNVRTYQTDYLLDPQVVPIGGTGSANTRLFAGAKEAGVVGIGFPLGFGG 360

Query: 321 YEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAK 380
           Y K L +  F++LIDWGWFYFI KPMF+ + +FY+LVGNFG++I+  TV +KLLF PLA 
Sbjct: 361 YNKQLDLNHFDLLIDWGWFYFITKPMFVALDFFYHLVGNFGLSILFVTVIIKLLFLPLAN 420

Query: 381 KQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVF 440
           K Y S A MK IQP++  L+++      +  Q+ M+++Y+   INP+AGC P+LLQIPVF
Sbjct: 421 KSYASMAKMKAIQPQLQALKDRHPDDKAK-QQQEMMEIYRKEKINPVAGCLPVLLQIPVF 479

Query: 441 FAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPG------FMHVGIWP 494
           F++YKV+ +++EMRHAPF+GWI DL+AADPTNIF LFG++P+          ++ +GIWP
Sbjct: 480 FSLYKVLFVTIEMRHAPFYGWIHDLSAADPTNIFNLFGLIPYDPTQIPVLGYYLVLGIWP 539

Query: 495 IIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQA 554
           IIM ++M++QMK++P P D  Q MI  WMP++F F L+SFPAGL+IYW+W+N++S++QQ 
Sbjct: 540 IIMGITMWVQMKLNPAPPDPTQQMIFAWMPLLFTFMLASFPAGLVIYWAWNNLLSVIQQG 599

Query: 555 VIMKMHGAEIGLIDRL 570
            IM+ +G ++ L D L
Sbjct: 600 YIMRKNGVKVELFDNL 615


>gi|126737055|ref|ZP_01752790.1| putative inner membrane protein translocase component YidC
           [Roseobacter sp. SK209-2-6]
 gi|126721640|gb|EBA18343.1| putative inner membrane protein translocase component YidC
           [Roseobacter sp. SK209-2-6]
          Length = 601

 Score =  452 bits (1163), Expect = e-125,   Method: Composition-based stats.
 Identities = 217/601 (36%), Positives = 330/601 (54%), Gaps = 24/601 (3%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPR----IEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           ++N N  +A  LS +++  W  F+  P     ++    E             D + A   
Sbjct: 3   DQNKNLILATVLSFLVILGWYTFFPPPEPEQPVDVAVTENAAESGTTLVPTADATDAVAN 62

Query: 58  IDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTK 117
                 +   +PR+ +  P + GSI L+G + DDL+L+ Y   ++  SPIV LL P    
Sbjct: 63  ATTEEASAPDAPRLAIDTPRVTGSIALQGGRIDDLSLKDYRETLADGSPIVKLLKPVGEA 122

Query: 118 NAYFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD 175
            AY+A   +   A   + ++P +N++W+  +G  L+P TP+ L + N N + F RTIS+D
Sbjct: 123 QAYYALYGWAPGAGLTSSDVPGANSIWSAPAGATLSPETPVTLTWDNGNGLTFARTISVD 182

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
           E Y+F +  +VTN +   I  +P G + RH        F +    +  + D  L E  YS
Sbjct: 183 EDYMFSVTQSVTNATDGTISLAPYGTLARHGEPEDLKNFFILHEGVVGMADGELSELDYS 242

Query: 236 DIEKSSISNFH---------ESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQ 286
           D+    I              +N W+G +D YW S  IP     F S  K+  +    YQ
Sbjct: 243 DVADFDIDPRDGSRSEVKQVTTNGWIGFTDHYWMSTLIPEPGQGFRSIAKF-DERRGIYQ 301

Query: 287 AKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPM 346
                  +++  G S   T  LFAGAKE+ +I  YEK   I  F   IDWGWF+F+ KPM
Sbjct: 302 TDIVLPTVSLAAGNSTEVTTMLFAGAKEWASIRSYEKS-GIAGFLDSIDWGWFFFLTKPM 360

Query: 347 FMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQS 406
           F ++ +   L+GN G AI+  TV +K++ FPLA K Y S A MK +QP++++L+E+    
Sbjct: 361 FAVLHWLNLLIGNMGWAIIGLTVLIKIIVFPLAYKSYASMAKMKELQPEMEKLKERTGD- 419

Query: 407 PPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLA 466
             Q +QK M++LYK   +NP AGC PIL+QIP+FF++YKVI ++LE+RHAPF+G  +DL+
Sbjct: 420 DRQKMQKEMMELYKKEKVNPAAGCLPILIQIPIFFSLYKVIFVTLELRHAPFFGPFQDLS 479

Query: 467 AADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMIL 520
           A DPT++  LFG+LPF  P        + +GI P+++ +SM++Q K++P P D  Q MI 
Sbjct: 480 APDPTSLMNLFGLLPFSGPEAGSILALVFIGILPLLLGISMWLQQKLNPAPTDPTQQMIF 539

Query: 521 NWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNS 580
            WMP VF+F L  F +GL++YW  +N I+  QQ +IM+ HG +  +   ++S F K   S
Sbjct: 540 AWMPWVFMFMLGGFASGLVVYWIANNTITFTQQYLIMRSHGYKPDVFGNIKSGFKKKPKS 599

Query: 581 Q 581
           +
Sbjct: 600 E 600


>gi|260427287|ref|ZP_05781266.1| inner membrane protein OxaA [Citreicella sp. SE45]
 gi|260421779|gb|EEX15030.1| inner membrane protein OxaA [Citreicella sp. SE45]
          Length = 607

 Score =  451 bits (1160), Expect = e-124,   Method: Composition-based stats.
 Identities = 202/604 (33%), Positives = 324/604 (53%), Gaps = 27/604 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQ-------PNQVDNSYA 54
           ++N N  +A  LS +++  W   +  P    ++ +        +                
Sbjct: 3   DQNKNLLIATGLSFVVILIWFLLFPPPEEPAVDQQEPVATAPVEGDAATTPSTATPTEGT 62

Query: 55  AVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPS 114
                      + +PR+ +    L GSI+L G + D+L L+ Y + +  +SP V +L P 
Sbjct: 63  EGTATAPQAETADAPRLPIDTARLGGSISLTGGRIDELILKDYTVTIDEDSPKVQILEPV 122

Query: 115 NTKNAYFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTI 172
            T +AY+A   +         ++P +NT W + SG  LT  +P+ L + +   + F RT+
Sbjct: 123 GTGHAYYALYGWAPGNGLEPADVPGANTEWQVESGSSLTVDSPVTLRWDSPAGLTFRRTV 182

Query: 173 SLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ 232
           ++D++++F +  +V N     +  +P G + RH        F V    +  + D  L E 
Sbjct: 183 AVDKNFMFTVTQSVENTGEASVSAAPYGIVARHGEPVGRKKFFVLHEGVVAMADGKLNEI 242

Query: 233 KYSDIEKSSIS---------NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
            YSD+    +               N W+G +D YW +  IPS+ T+F    KY  +G  
Sbjct: 243 DYSDMPDMDMVASEGARADVTQVAENGWIGFTDHYWMTTLIPSQGTAFKQVAKY-DEGRD 301

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
            YQ +     +T+ PG++   T  L+AGAKE+ TI  Y +D  + RF   IDWGWF+F+ 
Sbjct: 302 IYQTEAVLPTVTLAPGETQQVTTQLYAGAKEYETIRGY-EDAGVDRFIDSIDWGWFFFLT 360

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           KP+F L+ + + L+GN G +I+  T+ +K + FPLA K YVS A MK +QP++++L+E+ 
Sbjct: 361 KPIFWLLHHLHGLIGNMGWSIIALTITLKAILFPLAFKSYVSMAKMKELQPEMEKLKERA 420

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
                Q LQ+ M+QLYK   +NP +GC PILLQIP+FF++YKVI ++ E+R AP++G  +
Sbjct: 421 GD-DRQKLQQEMMQLYKKEKVNPASGCLPILLQIPIFFSLYKVIFVAFELRQAPWFGPFQ 479

Query: 464 DLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQA 517
           DL+  DPT+++ LFG+LP+  P        + VGI PI++ +SMF+Q K++P PAD  Q 
Sbjct: 480 DLSTPDPTSLYNLFGLLPWAAPEPGSTLALIFVGILPILLGISMFLQQKLNPAPADPTQK 539

Query: 518 MILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           MI  WMP VF+F L  F +GL++YW  +N I+  QQ +IM+  G    +   ++S F K 
Sbjct: 540 MIFAWMPWVFMFMLGGFASGLVVYWITNNTITFTQQYLIMRSQGYTPDVFGNIKSGFKKT 599

Query: 578 YNSQ 581
               
Sbjct: 600 PKDD 603


>gi|86135820|ref|ZP_01054399.1| putative inner membrane protein translocase component YidC
           [Roseobacter sp. MED193]
 gi|85826694|gb|EAQ46890.1| putative inner membrane protein translocase component YidC
           [Roseobacter sp. MED193]
          Length = 602

 Score =  451 bits (1160), Expect = e-124,   Method: Composition-based stats.
 Identities = 209/602 (34%), Positives = 329/602 (54%), Gaps = 26/602 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQ-----PNQVDNSYAAV 56
           ++N N  +AIALS +++  W  F+  P +                    P+    + AA 
Sbjct: 3   DQNKNLILAIALSSLVLLGWMYFFPPPEVTPAPEAVATETAPADGTASSPSAAVAADAAT 62

Query: 57  LIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNT 116
                  + S +PR+ +++  + GSI+L+G + DDL L+ Y +   +   IV  LSP   
Sbjct: 63  SQPSEEASASDAPRISIESDRITGSISLQGGRIDDLALKDYRITNDAPE-IVQFLSPVGQ 121

Query: 117 KNAYFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISL 174
           ++AY+A   +   +     ++P +NT+W   +   LTP + + L + N   + F RTI++
Sbjct: 122 QDAYYALYGWAPGSGLGAEDVPGANTLWTAPADAELTPDSSVTLTWDNGKGLTFNRTIAV 181

Query: 175 DEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKY 234
           DE Y+F I  +VTN S   +  +P G + RH        F +    +  + D  L E  Y
Sbjct: 182 DEDYMFAITQSVTNASGGAVSLAPYGTLARHGEPADMKNFFILHEGVVGMADGELAELDY 241

Query: 235 SDIEKSSISNFH---------ESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARY 285
           SD+    +              S+ W+G +D YW S  IP+   +F S  KY  +    Y
Sbjct: 242 SDVADFDVDPRDGSRSEVKQVASDGWIGFTDHYWMSTLIPAPGQAFRSSVKY-DERRDIY 300

Query: 286 QAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKP 345
           Q       +T+  G++   T  LF+GAKE+ TI  YEK   I  F   IDWGWF+F+ KP
Sbjct: 301 QTDVVLPTMTLADGETSEVTTQLFSGAKEWATIRAYEKG-GIAGFLDSIDWGWFFFLTKP 359

Query: 346 MFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQ 405
           +F ++ +   L+GN G AI+  TV +K++ FPLA K Y S A MK +QP++++L+E+   
Sbjct: 360 IFAVLHWLNALIGNMGWAIIALTVLIKIIVFPLAYKSYASMAKMKELQPEMEKLKERAGD 419

Query: 406 SPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDL 465
              Q  QK +++LYK   +NP AGC PIL+QIP+FF++YKVI ++LE+RHAPF+G  +DL
Sbjct: 420 -DRQKQQKEIMELYKREKVNPAAGCLPILIQIPIFFSLYKVIFVTLELRHAPFFGPFQDL 478

Query: 466 AAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMI 519
           +A DPT+I  LFG+LPF  P        + +GI P+++ +SM++Q K++P P D  Q MI
Sbjct: 479 SAPDPTSIMNLFGLLPFAGPTPDSIMALVFIGILPLLLGISMWLQQKLNPAPTDPTQQMI 538

Query: 520 LNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYN 579
             WMP VF+F L  F +GL++YW  +N I+  QQ +IM+ HG    +   ++++  +   
Sbjct: 539 FAWMPWVFMFMLGGFASGLVVYWIANNTITFTQQYLIMRSHGYTPDVFGNIKASVKRKPK 598

Query: 580 SQ 581
           + 
Sbjct: 599 TD 600


>gi|23015970|ref|ZP_00055732.1| COG0706: Preprotein translocase subunit YidC [Magnetospirillum
           magnetotacticum MS-1]
          Length = 578

 Score =  450 bits (1157), Expect = e-124,   Method: Composition-based stats.
 Identities = 214/580 (36%), Positives = 328/580 (56%), Gaps = 19/580 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIE----------------EMNNERKNIQTVK 44
           M    N FVAIA+SV I+  WQ F+   +                    N       +  
Sbjct: 1   MNDQRNLFVAIAISVAILIGWQYFFPTAKPPVEQAAQQQAAEVKASAPANVPSPATASSP 60

Query: 45  QPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
                  + AA     R +AL  S R+ ++ PS+ GSI L GA+ DD+ L  Y    +++
Sbjct: 61  AQVPGTPAAAAQTGASRNEALGKSRRIAIQTPSMHGSIALTGARIDDITLVKYRETPAAD 120

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           S  + L+SP+ +   Y+AE  +V+T  N+++P   +VW       LT  +P+ L + N  
Sbjct: 121 SAEIDLMSPAESPEPYWAEFGWVATDANVKVPGPESVWQAQGTGPLTQASPVVLTWDNGE 180

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVL 224
            + F RT ++DE+Y+F +   V N         P   + R         + + EG + V 
Sbjct: 181 GLRFVRTYTVDENYMFGVTQRVENYGTKAASLHPYALLARTGTPHVAGMYILHEGPLGVF 240

Query: 225 GDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLS-DGHA 283
              +L E KY D++K   + +  +  W GI+DKYW +  +P  +T    +F +       
Sbjct: 241 D-GTLKEMKYDDLKKEGSARYKTTGGWAGITDKYWLTALVPPAKTEITGRFVHQRLGNAD 299

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
           RYQ  + A    I  GK+      LF GAK+   +  Y +   I RF++ ID+GWFYF+ 
Sbjct: 300 RYQVDYLAPARVIEAGKTEEAGFHLFTGAKQVSLLDGYGEKFGIDRFDLAIDFGWFYFLT 359

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           KP F L+   ++ +GN G+AI+  TV +KL  FPLA K YV+   MK +QPK+ EL+ ++
Sbjct: 360 KPFFYLLQMLHSALGNMGLAILALTVILKLAMFPLANKSYVAMGKMKKLQPKVQELQARY 419

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
                  LQ+ M+ LYK   +NP++GC PI++QIPVFFA+YKV+ +++EMRHAPF+GWI 
Sbjct: 420 ADDK-MRLQQEMMALYKAEKVNPVSGCLPIMVQIPVFFALYKVLFVTIEMRHAPFYGWIS 478

Query: 464 DLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWM 523
           DL+A DPTNIFTLFG++P+  P  MH+G+WP+IM ++M++Q K++P P D  QA ++ ++
Sbjct: 479 DLSAQDPTNIFTLFGLIPWTPPHIMHLGVWPLIMGITMYLQQKLNPQPTDPVQAKMMQFL 538

Query: 524 PVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           P++F F L++F +GL+IYW+WSN +SI+QQ VIMK    +
Sbjct: 539 PLIFTFLLANFASGLVIYWAWSNTLSILQQWVIMKRAEEK 578


>gi|163745583|ref|ZP_02152943.1| putative inner membrane protein translocase component YidC
           [Oceanibulbus indolifex HEL-45]
 gi|161382401|gb|EDQ06810.1| putative inner membrane protein translocase component YidC
           [Oceanibulbus indolifex HEL-45]
          Length = 623

 Score =  450 bits (1156), Expect = e-124,   Method: Composition-based stats.
 Identities = 203/611 (33%), Positives = 326/611 (53%), Gaps = 33/611 (5%)

Query: 1   MER-NWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLID 59
           M+  N N  +A ALS  ++  W   +  P  +        +   +    V  S A     
Sbjct: 1   MDEQNKNLILATALSFAVILVWFLLFPPPEADPALENSVEMSQAEDGTSVPASPADTAAA 60

Query: 60  D------------RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPI 107
                        R  AL+ +PRV +    + GSI+L G + DDL L  Y   +  N+ +
Sbjct: 61  PGTDNGEGAAPQGRRAALADAPRVAIATDKVSGSISLMGGRIDDLKLNDYQTTLDENAEV 120

Query: 108 VTLLSPSNTKNAYFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANN 165
           VTLLSP  + +AY+A   + + +      +P  +T+W L  G+ L   +P+ L + N   
Sbjct: 121 VTLLSPEGSSDAYYALHGWAAGSGLAPDAVPGVDTLWTLSEGETLGVDSPVTLSWDNGAG 180

Query: 166 ILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLG 225
            +F RTIS+D  Y+F I  +VTNN    +  +P G I +H       +F +       + 
Sbjct: 181 QIFNRTISVDNEYMFDITQSVTNNGDAPVNLAPFGMIAQHGLPEDLKSFFILHEGAVSMA 240

Query: 226 DKSLVEQKYSDIEKSSISNFH---------ESNSWLGISDKYWASVFIPSKETSFHSQFK 276
           +  L E  + DI ++ +++            +  W+G +D YW +V IP    +F     
Sbjct: 241 NGELSEIDWDDIAEADVNSTWGRPAVVTEGVTEGWVGFTDHYWQAVLIPGAGEAFEQALT 300

Query: 277 YLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDW 336
           Y       Y+A       ++  G+S+++++  FAGAKE+ T+  Y+    + +F   IDW
Sbjct: 301 Y-DPRADTYRAFTRQPTRSVAAGESVSSSSKFFAGAKEWETLQDYQSA-GVAKFIDSIDW 358

Query: 337 GWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKI 396
           GWF+F+ KP+F L+     L+GN G+AI+  T+ +K L FPLA K YVS A MK +QP++
Sbjct: 359 GWFFFLTKPIFWLLHNLNQLIGNMGVAIIGLTLLIKALLFPLAYKSYVSMARMKELQPEM 418

Query: 397 DELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHA 456
           ++L+ K      Q +Q+ M++LYK + +NP AGC PIL+QIP+FF++YKVI +++E+RHA
Sbjct: 419 EKLK-KEAGDDRQKMQQGMMELYKKNKVNPAAGCLPILMQIPIFFSLYKVIFVTIELRHA 477

Query: 457 PFWGWIKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPP 510
           PF+G  +DL++ DPT+I  L+G+LP+  P        + +GI P+++ +SMF+Q K++P 
Sbjct: 478 PFFGPFQDLSSPDPTSIMNLWGLLPYAAPEPGSMLALVFIGILPLLLGISMFLQQKLNPA 537

Query: 511 PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL 570
           P D  Q MI  WMP VF+F L  F +GL++YW  +N I+  QQ +IM+  G +  L   +
Sbjct: 538 PTDPTQQMIFAWMPWVFMFMLGGFASGLVVYWIANNTITFTQQYLIMRSQGYKPDLWGNI 597

Query: 571 RSTFSKNYNSQ 581
              F +     
Sbjct: 598 AGGFKRTPKGD 608


>gi|110678771|ref|YP_681778.1| putative inner membrane protein translocase component YidC
           [Roseobacter denitrificans OCh 114]
 gi|123172722|sp|Q16AA1|OXAA_ROSDO RecName: Full=Inner membrane protein oxaA
 gi|109454887|gb|ABG31092.1| inner membrane protein oxaA, putative [Roseobacter denitrificans
           OCh 114]
          Length = 606

 Score =  448 bits (1152), Expect = e-123,   Method: Composition-based stats.
 Identities = 214/605 (35%), Positives = 333/605 (55%), Gaps = 28/605 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQ------PNQVDNSYAA 55
           ++N N  +A ALS I++  W   +  P  E       + +          P+   ++  +
Sbjct: 3   DQNKNLILATALSFIVILVWFVLFPPPEPEMPLTGETSTELTPDAATGSLPSVTSDTAPS 62

Query: 56  VLID--DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSP 113
           V+I+   R+ AL  +PRVE+    + GSI+L G + DDL+L+ Y      ++ IVT+LSP
Sbjct: 63  VVIEGETRSAALEQAPRVEIATDRVKGSISLLGGRIDDLSLKDYRETQEEDADIVTMLSP 122

Query: 114 SNTKNAYFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERT 171
             +  AY+A   + + A     ++P  +T W +I G IL+   P+ L + N   + F R 
Sbjct: 123 VGSPGAYYALYGWAAGAGVDPSQVPGPDTEWQVIDGDILSVDAPVTLQWDNGAGLSFTRI 182

Query: 172 ISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVE 231
           I +D++Y+F+I  +V N S   +  +P G + RH        F +    +  + D  L E
Sbjct: 183 IEIDDNYMFQITQSVANTSDAPVTVAPYGILARHGEPDDLKNFFILHEGVVAMADGELTE 242

Query: 232 QKYSDIEKSSISNFHESN---------SWLGISDKYWASVFIPSKETSFHSQFKYLSDGH 282
             + DI +  +                 W+G +D +W SV IP    S     KY     
Sbjct: 243 TNWDDIPEFPVDQREGVPAERIENVLNGWIGFTDHFWMSVLIPDPSASARLTTKYRP-RA 301

Query: 283 ARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFI 342
             YQA+      T+ PG S++ T  LFAGAKE+ TI +Y+ D  + RF   IDWGWF+F+
Sbjct: 302 DIYQAETVLPAQTVAPGTSVSATTQLFAGAKEWETIRNYQTD-GVDRFIDSIDWGWFFFL 360

Query: 343 AKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREK 402
            KP+F L+ Y    +GN G AI+  T+ +K +  PLA K YVS A MK +QP++++L+E+
Sbjct: 361 TKPIFFLLHYLNAFIGNMGWAIIGLTLIIKAILLPLAYKSYVSMAKMKELQPQMEKLKEE 420

Query: 403 FKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWI 462
                 Q +Q+ M++LYK   +NP AGC PILLQIP+FF++YKVI +++E+RHAPF+G  
Sbjct: 421 AGD-DRQKMQQGMMELYKKEKVNPAAGCLPILLQIPIFFSLYKVIFVTIELRHAPFFGPF 479

Query: 463 KDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQ 516
           +DL+A DPT+I  L+G+LPF  P        + +GI P+++ +SM++Q K++P P D  Q
Sbjct: 480 QDLSAPDPTSIMNLYGLLPFDGPEPGSIMALIFIGILPLLLGISMWLQQKLNPAPTDPTQ 539

Query: 517 AMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSK 576
            MI  WMP VF+F L  F +GL++YW  +N I+ VQQ +IM+  G +  +   ++  F K
Sbjct: 540 QMIFAWMPWVFMFMLGGFASGLVVYWIANNTITFVQQYMIMRSQGYKPDVFGNIKGGFQK 599

Query: 577 NYNSQ 581
                
Sbjct: 600 KTKPD 604


>gi|209965568|ref|YP_002298483.1| hypothetical protein RC1_2283 [Rhodospirillum centenum SW]
 gi|209959034|gb|ACI99670.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 602

 Score =  447 bits (1149), Expect = e-123,   Method: Composition-based stats.
 Identities = 226/593 (38%), Positives = 323/593 (54%), Gaps = 33/593 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRI---EEMNNERKNIQTVKQPNQVDNSYAA-- 55
           M    N  +AI +SV I++ +  FY  PR    EE   ++  +Q    P  V    A   
Sbjct: 1   MTDQKNLILAIVISVAILFGFNYFYERPRQQALEEYRQQQAALQAETAPAAVPGVTAPGS 60

Query: 56  ------------------------VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDD 91
                                       DR   L  S RV++  P L GS+NL+G + DD
Sbjct: 61  TVPGPAGDIPVPAPGAPAPTDAVPAAPRDRGAVLGDSQRVQVDTPRLHGSVNLRGGRIDD 120

Query: 92  LNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTAN--NIELPNSNTVWNLISGKI 149
           L L  YH+    +SP V LLSP  T   YFAE  +V TA+     LP   T W  +S   
Sbjct: 121 LTLANYHVTPDKSSPEVVLLSPVGTSQPYFAEFGWVPTADTAGQPLPGPTTDWQPVSQGP 180

Query: 150 LTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT 209
           LTP +P+ L + N   ++FER I++D  Y+F +   VTN S   +   P G + R    T
Sbjct: 181 LTPDSPVVLRWDNGQGLVFEREIAIDRDYMFTVTQRVTNQSGQPVTLHPYGFVQRRGTPT 240

Query: 210 ATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKET 269
            +  F + EG + V              + +  +    +  W G +DKYW    +P + +
Sbjct: 241 TSGFFILHEGALGVFDGTLREFDYSDLKDSTQPATQTTTGGWFGFTDKYWLVTLVPDQAS 300

Query: 270 SFHSQFKYLS-DGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIP 328
               +  +    G   YQ  F    +T+ PG +  +T+ LFAGAK   T+  YE +L I 
Sbjct: 301 PVDVRVLHQDQGGQPLYQVDFRGQGLTVAPGATAESTHRLFAGAKIVRTLDAYESELGIA 360

Query: 329 RFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTAN 388
           RF   +DWGWFYF+ KP F  +      +GNFGIAI++ TV ++L FFPLA KQY + A 
Sbjct: 361 RFSYAVDWGWFYFLTKPFFYGLDLLGQALGNFGIAILVFTVLLRLAFFPLANKQYKAFAK 420

Query: 389 MKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVIS 448
           MK +QPK++ELR++      Q L  A ++LYK   +NPL+GC PILLQIPVFFA+YKV+ 
Sbjct: 421 MKLLQPKMEELRKRHGD-DRQKLSMATMELYKQEKVNPLSGCLPILLQIPVFFALYKVLF 479

Query: 449 ISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMS 508
           +++EMRHAPF+GWI DL+A DPT +F LFG++P+  PGF+ VG  P++M  +M++Q K+S
Sbjct: 480 VTIEMRHAPFYGWITDLSAPDPTTVFNLFGLIPWSPPGFLMVGALPLMMGFTMWLQQKIS 539

Query: 509 PPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHG 561
           P   D  Q  I   +P +F + +++FPAGL+IYW+WSN+++I QQ  IM+  G
Sbjct: 540 PANPDPIQQRIFMVLPFLFTYMMAAFPAGLVIYWTWSNLLAIAQQWYIMRRMG 592


>gi|163733766|ref|ZP_02141208.1| putative inner membrane protein translocase component YidC
           [Roseobacter litoralis Och 149]
 gi|161392877|gb|EDQ17204.1| putative inner membrane protein translocase component YidC
           [Roseobacter litoralis Och 149]
          Length = 606

 Score =  447 bits (1149), Expect = e-123,   Method: Composition-based stats.
 Identities = 213/605 (35%), Positives = 331/605 (54%), Gaps = 28/605 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQ------PNQVDNSYAA 55
           ++N N  +A ALS +++  W   +  P  E       + +          P+   ++  +
Sbjct: 3   DQNKNLILATALSFVVILVWFVLFPPPEPEIPLTSETSTELTPDAATGSLPSVTSDTAPS 62

Query: 56  VLID--DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSP 113
           V+I+   R+ AL  +PRVE+    L GSI+L G + DDL+L+ Y      ++ IVT+LSP
Sbjct: 63  VVIEGETRSAALEEAPRVEIATDRLKGSISLLGGRIDDLSLKDYRETQEDDADIVTMLSP 122

Query: 114 SNTKNAYFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERT 171
             +  AY+A   + + A     ++P  +T W +I G IL+   PI L + N   + F R 
Sbjct: 123 VGSPGAYYALYGWAAGAGVDPSQVPGPDTEWQVIDGDILSVDAPITLQWNNGAGLSFTRI 182

Query: 172 ISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVE 231
           I +D++Y+F+I  +V N S   +  +P G + RH        F +    +  + D  L E
Sbjct: 183 IEIDDNYMFEITQSVANTSDAPVTVAPYGILARHGEPADLKNFFILHEGVVAMADGELTE 242

Query: 232 QKYSDIEKSSISNFHESN---------SWLGISDKYWASVFIPSKETSFHSQFKYLSDGH 282
             + DI +  +                 W+G +D +W SV IP    S     KY     
Sbjct: 243 TNWDDIPEFPVDQREGVPAERIENVLNGWIGFTDHFWMSVLIPDPSASARLTTKYRP-RA 301

Query: 283 ARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFI 342
             YQA+      T+ PG S++ T  LFAGAKE+ TI +Y+ D  + RF   IDWGWF+F+
Sbjct: 302 DIYQAETVLPAQTVAPGTSVSATTQLFAGAKEWETIRNYQTD-GVDRFIDSIDWGWFFFL 360

Query: 343 AKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREK 402
            KP+F L+ Y    +GN G AI+  T+ +K +  PLA K YVS A MK +QP++++L+E+
Sbjct: 361 TKPIFFLLHYLNAFIGNMGWAIIGLTLIIKAILLPLAYKSYVSMAKMKELQPQMEKLKEE 420

Query: 403 FKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWI 462
                 Q +Q+ M++LYK   +NP AGC PILLQIP+FF++YKVI +++E+RHAPF+G  
Sbjct: 421 AGD-DRQKMQQGMMELYKKEKVNPAAGCLPILLQIPIFFSLYKVIFVTIELRHAPFFGPF 479

Query: 463 KDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQ 516
           +DL+A DPT+I   +G+LPF  P        + +GI P+++ +SM++Q K++P P D  Q
Sbjct: 480 QDLSAPDPTSIMNFYGLLPFDGPEPGSIMALIFIGILPLLLGISMWMQQKLNPAPTDPTQ 539

Query: 517 AMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSK 576
            MI  WMP VF+F L  F +GL++YW  +N I+  QQ +IM+  G +  +   ++  F K
Sbjct: 540 QMIFAWMPWVFMFMLGGFASGLVVYWIANNTITFAQQYMIMRSQGYKPDVFGNIKGGFQK 599

Query: 577 NYNSQ 581
                
Sbjct: 600 KTKPD 604


>gi|85705859|ref|ZP_01036955.1| putative inner membrane protein translocase component YidC
           [Roseovarius sp. 217]
 gi|85669447|gb|EAQ24312.1| putative inner membrane protein translocase component YidC
           [Roseovarius sp. 217]
          Length = 611

 Score =  447 bits (1148), Expect = e-123,   Method: Composition-based stats.
 Identities = 212/599 (35%), Positives = 332/599 (55%), Gaps = 22/599 (3%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPR---IEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           ++N N   A ALS +++  W   +  P    ++         Q+V  P     + A    
Sbjct: 3   DQNKNLIFATALSFLVILVWFVMFPPPESPAVDPNAPVPSATQSVPAPVADSTADATTTQ 62

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
                    +PR+ +  PSL G+I+L+G + DDL L+ Y   +   S IV LL+P  ++ 
Sbjct: 63  TAAPATEPDAPRLNIDTPSLQGTISLQGGRIDDLFLKNYRETIDPASDIVRLLAPVGSEA 122

Query: 119 AYFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE 176
            Y+A   +   A     ++P SNT+W + SG+ LTPT+PI L + N   ++F R +S+DE
Sbjct: 123 PYYALYGWAPGAGLTADQVPGSNTLWQIESGETLTPTSPITLSWDNGAGLIFRRELSVDE 182

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
            ++F +  +V N     +  +P G + RH        F +    +  + D +L E KY D
Sbjct: 183 DFMFSVRQSVENTGASAVSLAPYGILARHGRPADLKKFFILHEGLIGMADGTLSEIKYDD 242

Query: 237 IEKSSIS---------NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA 287
           +E+   +              N W+G +D YW +  IP+    F S  K+       +Q 
Sbjct: 243 VEEYPFNAREGAPAEVTQVTENGWIGFTDHYWMTTLIPASGNPFKSVSKF-DPQRGIFQT 301

Query: 288 KFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMF 347
           +      T+ PG++ +    LFAGAKE+ TI  Y+ +  + RF   IDWGWF+F+ KP+F
Sbjct: 302 ETVQPTQTVEPGQTASADTRLFAGAKEWATIRAYQNEQGVDRFLDSIDWGWFFFLTKPIF 361

Query: 348 MLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSP 407
             + + + ++GN G AI+  T+ +K L  PLA K YVS A MK +QP++++++E      
Sbjct: 362 AALHWLHAIIGNMGWAIIALTLLIKALVLPLAYKSYVSMAKMKELQPQMEKIKE-TAGDD 420

Query: 408 PQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAA 467
            Q LQK M++LYK   +NP AGC PILLQIP+FF++YKVI ++LE+RHAP+  WIKDL+A
Sbjct: 421 RQKLQKEMMELYKREKVNPAAGCLPILLQIPIFFSLYKVIFVTLELRHAPWVAWIKDLSA 480

Query: 468 ADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILN 521
            D ++++ L+GILP+  P        + +GI P+ + +SM++Q K++P P D  Q MI  
Sbjct: 481 PDTSSLYNLWGILPWAAPEPGSVLALIFIGILPLCLGVSMWLQQKLNPSPTDPTQKMIFA 540

Query: 522 WMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNS 580
           WMP VF+F L SF +GL+IYW  +NVI+  QQ VIM+ HG +  +   + S+F +   +
Sbjct: 541 WMPWVFMFMLGSFASGLVIYWIANNVITFSQQYVIMRSHGHKPDVFGNILSSFKRKKPA 599


>gi|254439216|ref|ZP_05052710.1| 60Kd inner membrane protein [Octadecabacter antarcticus 307]
 gi|198254662|gb|EDY78976.1| 60Kd inner membrane protein [Octadecabacter antarcticus 307]
          Length = 590

 Score =  446 bits (1146), Expect = e-123,   Method: Composition-based stats.
 Identities = 202/592 (34%), Positives = 324/592 (54%), Gaps = 18/592 (3%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQ----PNQVDNSYAAVL 57
           ++N N  +A ALS I++  W   +  P + E     +   T         QV    A + 
Sbjct: 3   DQNKNLILATALSFIVILIWFVLFPPPDVTEPAPTAEVTSTDGTTLGVDAQVPTQVAVLP 62

Query: 58  IDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTK 117
                 A++ +PR+ + + +L GS++L G + DDL+L+ Y + + S++ +V LLSP  T+
Sbjct: 63  PLSAEDAIADAPRIMIDSENLTGSLSLTGGRIDDLSLKDYRVTLDSDADLVRLLSPIGTE 122

Query: 118 NAYFAELDYVST--ANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD 175
             Y+A   +V+   A   ++P ++T W L SG  L P + I L++ N   + F +T ++D
Sbjct: 123 APYYALNGWVAAVGATADQVPGASTQWQLESGDTLEPGSDITLIWDNGAGLTFRKTFAVD 182

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLV--EQK 233
           E++LF +  TV N++  +I   P G + RH        F   EG + +            
Sbjct: 183 ENFLFTVTQTVENSTGAEIALRPYGLVARHGEPDQIGFFIQHEGVVRMSDGSMEEINYGD 242

Query: 234 YSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANE 293
             D+         E N W+G SD+YW +  IP+    F S  K+ ++    YQ +     
Sbjct: 243 MPDLTSDEGRIEVEENGWIGFSDQYWMTALIPTPGRDFRSTAKFANN---IYQIETVYPL 299

Query: 294 ITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYF 353
            T+  G + +     FAGA+E+  I  Y+ DL I RF   IDWGWF+F+ KP+F ++ + 
Sbjct: 300 TTVASGATASAETQFFAGAQEWVVIRSYQDDLGIDRFLDSIDWGWFFFLTKPIFAVLHWL 359

Query: 354 YNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQK 413
             L+GN G +I+  T  +K L  PLA K YVS A M+ +QP++ +L+E       + LQK
Sbjct: 360 NGLIGNMGWSIICLTFVIKALLLPLAYKSYVSMAKMRELQPEMAKLKEAAGDDREK-LQK 418

Query: 414 AMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNI 473
            M+ LYK + +NP +GC PIL+QIP+FF++YKVI +++E+RHAP+ GWI DL+A D + +
Sbjct: 419 GMMSLYKENKVNPASGCLPILMQIPIFFSLYKVIFVTIELRHAPWIGWINDLSAPDTSTL 478

Query: 474 FTLFGILPFYLPG------FMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVF 527
           + LFG+LP+  P        + +G+ PI++ +SM++Q K++P P D  Q MI  WMP VF
Sbjct: 479 YNLFGLLPWGAPAPDSILALVFIGVMPIVLGISMWLQQKLNPAPTDPTQKMIFAWMPWVF 538

Query: 528 VFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYN 579
           +F L SF +GL++YW  +N I+ +QQ  IM+  G +  L   +      +  
Sbjct: 539 MFMLGSFASGLVLYWIANNTITFMQQYAIMRSQGFKPDLFGNITGRKDSDPE 590


>gi|259415716|ref|ZP_05739636.1| inner membrane protein OxaA [Silicibacter sp. TrichCH4B]
 gi|259347155|gb|EEW58932.1| inner membrane protein OxaA [Silicibacter sp. TrichCH4B]
          Length = 611

 Score =  445 bits (1143), Expect = e-122,   Method: Composition-based stats.
 Identities = 218/607 (35%), Positives = 333/607 (54%), Gaps = 30/607 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
           ++N N  +A ALS +++  W  F+  P        +    T    +    + A    +  
Sbjct: 3   DQNKNLLLATALSFLVILGWYFFFPPPEEAPQPAAQVTETTATPGDTSGPAAAPSAGEAT 62

Query: 62  AQALS----------MSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLL 111
           A+A +           +PR+ +  P + GSI+LKG + DDL L+ Y   +  +SPIVTLL
Sbjct: 63  AEADAAATAEVDAAEDAPRLAINTPRVEGSISLKGGRIDDLRLKDYRETLDDDSPIVTLL 122

Query: 112 SPSNTKNAYFAELDYVSTANN--IELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFE 169
           SP+   NAY+A   +         ++P +NT W    G  LTP T + L + N   + F 
Sbjct: 123 SPAGQANAYYALYGWAPGTGLGIEDVPTANTRWQAADGATLTPETSVTLTWDNGKGLTFS 182

Query: 170 RTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSL 229
           R I++DE Y+F I  +VTN S + +  +P G + RH        F V    +  + D  L
Sbjct: 183 REIAIDEDYMFSITQSVTNTSGESVALAPYGTLARHGLPANLENFFVLHEGVVGMADGEL 242

Query: 230 VEQKYSDIEKSSISNFHES---------NSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
            E  Y D+          S         N W+G +  YW S  IP+   +F S  KY  +
Sbjct: 243 AEIDYDDMTDFDPDPRDGSRSQITSVTENGWIGFTGHYWMSTLIPAPGDAFRSIVKY-DE 301

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
               YQ       +T+  G+S + +  LFAGAKE+ TI  YE+   I  F   IDWGWF+
Sbjct: 302 RRDIYQTDVVLPTVTLAAGESTSASTQLFAGAKEWATIREYERG-GIAGFLDSIDWGWFF 360

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           F  KP+F ++ +    +GN G+AI+  T  +K+L FPLA K Y S A MK +QP++++LR
Sbjct: 361 FFTKPIFAVLHWLNAAIGNMGVAIIALTFLLKILVFPLAYKSYASMARMKELQPEMEKLR 420

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E+      Q +QK M++LYK   +NP AGC PIL+QIP+FF++YKVI ++LE+RH+ F+G
Sbjct: 421 ERAGD-DRQKMQKEMMELYKREKVNPAAGCLPILIQIPIFFSLYKVIFVTLELRHSAFFG 479

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPG------FMHVGIWPIIMSLSMFIQMKMSPPPADK 514
             +DL+A DPT+++ LFG+LP+  P        + +GI PI++ +SM++Q K++P PAD+
Sbjct: 480 PFQDLSAPDPTSLYNLFGLLPWGAPAPDSLLALVFIGILPILLGISMWLQQKLNPAPADE 539

Query: 515 GQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTF 574
            Q MI  WMP VF+F L  F +GL++YW  +NVI+  QQ +IM+ HG    +   ++S+F
Sbjct: 540 TQKMIFAWMPWVFMFMLGGFASGLVVYWITNNVITFTQQYLIMRSHGYTPDVFGNIKSSF 599

Query: 575 SKNYNSQ 581
            +   ++
Sbjct: 600 KRGEKAE 606


>gi|83594668|ref|YP_428420.1| putative inner membrane protein translocase component YidC
           [Rhodospirillum rubrum ATCC 11170]
 gi|83577582|gb|ABC24133.1| protein translocase subunit yidC [Rhodospirillum rubrum ATCC 11170]
          Length = 595

 Score =  444 bits (1141), Expect = e-122,   Method: Composition-based stats.
 Identities = 215/598 (35%), Positives = 335/598 (56%), Gaps = 37/598 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQ-------------TVKQPN 47
           M +  N  +AI LS+ +++ ++ F+   +      ++ + Q             +V+ P 
Sbjct: 1   MLQQRNLILAIVLSMAVLFGFEYFFGAKQPPMTAQQQDSAQMAAPSNGQMAAPSSVQAPG 60

Query: 48  QVDNSYAAVLIDDRAQALSM--------------------SPRVELKNPSLIGSINLKGA 87
           Q   +   V     A   +                     SPR+ +    L GSI L+GA
Sbjct: 61  QSPVAAPQVPAQPGAAVPTPGGMTPGAASLSREEALAADISPRIGIDTARLHGSIRLRGA 120

Query: 88  QFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISG 147
           + DDL+L  Y   V   SP ++LLSP      Y+AE  +V+    +++P+++T+W    G
Sbjct: 121 RIDDLSLVDYRETVDPQSPEISLLSPPGAPLPYYAEFGWVAGTPGVKVPDADTLWQADRG 180

Query: 148 KILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKP 207
            +     P+ L + N   + F R I++D  ++F I   V N     +   P G + R   
Sbjct: 181 ALGVDA-PVTLTWDNGEGLRFIRKIAIDHDFMFSITQAVENTGAGAVTLFPYGLVSRINT 239

Query: 208 QTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSK 267
               N + + EG + V    +L E KYS ++         +  W+GI+DKYW +  +  +
Sbjct: 240 PALLNYYILHEGPLGVFD-GTLKEVKYSALKDDGEVKHTSTGGWMGITDKYWLTALVTDQ 298

Query: 268 ETSFHSQFKYLS-DGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLA 326
                 +F Y   DG   YQA F     T+ PG  I T+N LF+GAKE   +  Y  +L 
Sbjct: 299 SMPVTGRFLYQPRDGRDGYQADFLGAAFTVEPGGRIETSNHLFSGAKEVKLLDRYTDELG 358

Query: 327 IPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVST 386
           I  F++ ID+GWFYF+ KP F+ + + + ++GN G+AI+  TV +KL+FFPLA K Y S 
Sbjct: 359 IKNFDLAIDFGWFYFMTKPFFLSIQFLHGILGNMGLAILAFTVVLKLVFFPLANKSYRSM 418

Query: 387 ANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKV 446
           + MK +QP++ +L+E+FK      L + M+ LYK   +NPL+GC PI++QIPVFFA+YKV
Sbjct: 419 SKMKLLQPELKKLQERFKDDRA-RLNQEMMSLYKKEQVNPLSGCLPIVIQIPVFFALYKV 477

Query: 447 ISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMK 506
           + +S+EMRH PF+GWI+DLAA DPT +F LFG++P+  P  + +G WP+IM ++M++Q K
Sbjct: 478 LFVSIEMRHEPFYGWIRDLAAPDPTTVFNLFGLIPWDPPNMLMLGAWPLIMGVTMWMQQK 537

Query: 507 MSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEI 564
           ++P PAD  QA I+ ++P++F F L+ F AGL+IYW+W+N++SI QQ VIMK  GA+ 
Sbjct: 538 LNPTPADPTQAKIMMFLPIMFTFMLAHFAAGLVIYWTWNNLLSITQQWVIMKRMGAKT 595


>gi|148556519|ref|YP_001264101.1| putative inner membrane protein translocase component YidC
           [Sphingomonas wittichii RW1]
 gi|148501709|gb|ABQ69963.1| protein translocase subunit yidC [Sphingomonas wittichii RW1]
          Length = 577

 Score =  444 bits (1140), Expect = e-122,   Method: Composition-based stats.
 Identities = 210/570 (36%), Positives = 316/570 (55%), Gaps = 12/570 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQN----FYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAV 56
           ME   N  +AI LS ++++ WQ     F+   +      E    + + QP     +    
Sbjct: 1   MENQRNMILAIVLSALVLFGWQFLGDRFFPPAKPPVTKIEGGQEKVLPQPGADPAAAGPK 60

Query: 57  LIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNT 116
            I  RA  L  +PRV +  P L GSINLKGA+ DDL L+ Y   V+ N+P + LLSP  +
Sbjct: 61  AIRARAAVLRETPRVAIDTPKLAGSINLKGARIDDLVLKAYRETVAKNAPPIRLLSPLGS 120

Query: 117 KNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE 176
             AY+A   +  T + ++ P  NTVW   SG  LTP TP+ L + N     FE  I++D 
Sbjct: 121 PAAYYAGFGW--TGDGVDAPGPNTVWT-ASGTALTPETPVTLSWTNTRGQRFETVIAVDR 177

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS- 235
            Y+F I   + N     +   P G I +       +++ +  G I V  D +  +  +  
Sbjct: 178 DYMFTITQKLVNGGAGAVAARPYGLISKDGVSKDPSSWTLHTGPIGVFNDAANYDLSFKK 237

Query: 236 -DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
            D        F  +  WLG  DKYW +  +P  + S  + F         YQA  S   +
Sbjct: 238 LDEAGQPGIRFASTGGWLGFGDKYWLTALVPDSKASVDAGFLST--APQVYQAVESGRAL 295

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
            I PG++ + +   FAGAKE   +  YE D  +P F   IDWGWF  + KP+F ++   +
Sbjct: 296 VIAPGQAGSVSQRFFAGAKEVALLDRYENDQGVPLFSRAIDWGWFRVLEKPIFWVLDQVF 355

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
            LVGNFG+AI++ T  V+ L FP+A+KQ+ S A M+ +QPK+ EL+E+ K   P  LQ+ 
Sbjct: 356 KLVGNFGVAIIILTFLVRGLMFPIAQKQFRSMAGMRRVQPKMKELQERLKDDKP-RLQQE 414

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           +++LY+   +NPLAGC PIL+QIPVF+A+YKV+ +++EMRH PF  WI+DL+A DP ++ 
Sbjct: 415 LLKLYQEEKVNPLAGCLPILVQIPVFYALYKVLMVTIEMRHQPFVLWIRDLSAPDPLHVL 474

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSF 534
            LFG+L F  P F+ +G+  +++ +SM++Q K++P P D  Q  +   MP + +F ++ F
Sbjct: 475 NLFGLLDFTPPAFLGIGVLALLLGVSMWLQFKLNPQPMDDAQKQVFALMPWIMMFIMAPF 534

Query: 535 PAGLIIYWSWSNVISIVQQAVIMKMHGAEI 564
            AGL+IYW  SN ++I QQA + + H  E 
Sbjct: 535 AAGLLIYWVTSNFLTIAQQAWLYRQHPVEP 564


>gi|254464722|ref|ZP_05078133.1| 60 kDa inner membrane insertion protein [Rhodobacterales bacterium
           Y4I]
 gi|206685630|gb|EDZ46112.1| 60 kDa inner membrane insertion protein [Rhodobacterales bacterium
           Y4I]
          Length = 600

 Score =  444 bits (1140), Expect = e-122,   Method: Composition-based stats.
 Identities = 223/600 (37%), Positives = 334/600 (55%), Gaps = 23/600 (3%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
           ++N N  +A  LS +++  W   +  P  E+      +         +  S AA  +D  
Sbjct: 3   DQNKNLILATVLSFLVILGWYTLFPPPEPEQAPETAVSETAPAGNTALAPSAAAEAVDSS 62

Query: 62  AQALSMSP---RVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
           A A + +P   R+ +  P + GSI+L+G + DDL+L+ Y   + +NSPIV LL P     
Sbjct: 63  APAQAEAPQAARLAIDTPRVTGSISLQGGRIDDLSLKDYRETLDANSPIVKLLKPVGEAQ 122

Query: 119 AYFAELDYVSTANN--IELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE 176
           AY+A   +   A     ++P +NTVW+  +   LTP +P+ L + N   + F RTIS+DE
Sbjct: 123 AYYALYGWAPGAGLSLDDVPGANTVWSAGADATLTPDSPVTLTWDNGKGLTFSRTISVDE 182

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
            Y+F I  +V N S   +  +P G + RH        F +    +  + D  L E  Y D
Sbjct: 183 DYMFSITQSVANASGGTVSLAPYGTLARHSQPADLKNFFILHEGLVGMSDGELAEIDYDD 242

Query: 237 IEKSSISNFHES---------NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA 287
           +          S         N W+G +D YW S  +P+   +F S  K+  +    YQ 
Sbjct: 243 MADFEADARDGSKAEVRQVAENGWIGFTDHYWMSTLVPAPGQAFRSIAKF-DERRDIYQT 301

Query: 288 KFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMF 347
                 +T+  G+S   T  LFAGAKE+ TI  Y+K   I  F  +IDWGWF+F+ KPMF
Sbjct: 302 DIVLPTVTVADGQSSEVTTQLFAGAKEWETIRGYQKA-GIQGFLDVIDWGWFFFLTKPMF 360

Query: 348 MLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSP 407
            L+     L+GN G AI+  TV +K+L FPLA K Y S A MK +QP++++L+E+     
Sbjct: 361 WLLHNLNVLIGNMGWAIIGLTVVIKILVFPLAYKSYASMAKMKELQPEMEKLKERAGD-D 419

Query: 408 PQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAA 467
            Q +QK M++LYK   +NP AGC PIL+QIP+FF++YKVI ++LE+RHAPF+G  +DL+A
Sbjct: 420 RQKMQKEMMELYKREKVNPAAGCLPILIQIPIFFSLYKVIFVTLELRHAPFFGPFQDLSA 479

Query: 468 ADPTNIFTLFGILPFYLPG------FMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILN 521
            DPT+IF LFG+LP+  P        + +GI PI++ +SM++Q K++P P D  Q MI  
Sbjct: 480 PDPTSIFNLFGLLPWAAPAPESILALVFIGILPILLGVSMWLQQKLNPAPTDPTQQMIFA 539

Query: 522 WMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ 581
           WMP VF+F L  F +GL++YW  +N I+  QQ +IM+ HG    +   ++S+F K   ++
Sbjct: 540 WMPWVFMFMLGGFASGLVVYWIANNTITFTQQYLIMRSHGYSPDVFGNIKSSFKKKPKAE 599


>gi|254512338|ref|ZP_05124405.1| 60 kDa inner membrane insertion protein [Rhodobacteraceae bacterium
           KLH11]
 gi|221536049|gb|EEE39037.1| 60 kDa inner membrane insertion protein [Rhodobacteraceae bacterium
           KLH11]
          Length = 607

 Score =  442 bits (1136), Expect = e-122,   Method: Composition-based stats.
 Identities = 208/607 (34%), Positives = 333/607 (54%), Gaps = 31/607 (5%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNI----QTVKQPNQVDNSYAAVL 57
           ++N N  +A  LS +++  W   +  P       + +        V+ P+          
Sbjct: 3   DQNKNLILATVLSFLVIIVWFVLFPPPEPTPGEEQAEIAVLEGDEVQTPSASGTVGEVTA 62

Query: 58  IDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTK 117
             + A     +PRV++  P L GS++L G + D+L L+ Y + +   +PIV LL+P  T+
Sbjct: 63  ATEEALPEEQAPRVQIDTPRLKGSLSLSGGRIDELFLKDYKVSIEEGAPIVELLAPVGTE 122

Query: 118 NAYFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD 175
           +AY+A   +   A     ++P  NTVW L  G++L    P+ LV++N N + F R IS+D
Sbjct: 123 SAYYALYGWAPAAGLAGADVPGPNTVWALEQGEVLGVDAPVTLVWENGNGLTFRRMISVD 182

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKP------QTATNTFGVQEGFIAVLGDKSL 229
           + Y+F +  +V N +  ++  +P G + RH            N F + EG I +    +L
Sbjct: 183 QDYMFTVTQSVENGTQSEVGMAPYGILARHGIGEDGDLPGLKNFFILHEGVIGMSD-GTL 241

Query: 230 VEQKYSDIEKSSISNFH---------ESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
            E  Y D+    I               + W+G +D YW +  IP   ++F +  KY   
Sbjct: 242 TEVDYGDVRDFDIDPIERAQAEVYQVNQDGWIGFTDHYWMTTLIPEPGSAFKAAAKY-DS 300

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
               YQ +     +T+ PG++   T  LFAGAKE+ TI  Y+ +  + +F   IDWGWF+
Sbjct: 301 RRKIYQTETVLPTVTVAPGETTEVTTRLFAGAKEWETIREYQAE-GVQKFIDSIDWGWFF 359

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           F+ KP+F L+     L+GN G +I+  T+ +K + FPLA K YVS A MK +QP+++ L+
Sbjct: 360 FLTKPIFWLLHNINALIGNMGWSIIGLTLIIKAILFPLAYKSYVSMAKMKELQPQMEALK 419

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E       Q +Q+ M++LYK   +NP AGC PIL+QIP+FF++YKVI +++E+R AP++G
Sbjct: 420 EAAGD-DRQKMQQGMMELYKKEKVNPAAGCLPILMQIPIFFSLYKVIFVTIELRQAPWFG 478

Query: 461 WIKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADK 514
             +DL+A DPT+I  LFG+LPF  P        + +GI P+++ +SM++Q K++P P D 
Sbjct: 479 PFQDLSAPDPTSIMNLFGLLPFAGPQPDTFLALIFIGILPLLLGISMWLQQKLNPAPTDP 538

Query: 515 GQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTF 574
            QAMI  WMP VF+F L SF +GL++YW  +N I+  QQ +IM+  G +  +   ++S F
Sbjct: 539 TQAMIFAWMPWVFMFMLGSFSSGLVVYWIANNTITFTQQYLIMRSQGYKPDVFGNIKSGF 598

Query: 575 SKNYNSQ 581
            +   + 
Sbjct: 599 KRTPKTD 605


>gi|163740285|ref|ZP_02147679.1| putative inner membrane protein translocase component YidC
           [Phaeobacter gallaeciensis 2.10]
 gi|161386143|gb|EDQ10518.1| putative inner membrane protein translocase component YidC
           [Phaeobacter gallaeciensis 2.10]
          Length = 605

 Score =  442 bits (1135), Expect = e-122,   Method: Composition-based stats.
 Identities = 213/604 (35%), Positives = 331/604 (54%), Gaps = 27/604 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVY-------PRIEEMNNERKNIQTVKQPNQVDNSYA 54
           ++N N  +A ALS +++  W  F+           +        ++ +            
Sbjct: 3   DQNKNLLLATALSFLVILGWYVFFPPPEPQPQPDAVVAETAPAGDVVSAPAAASPAAGSE 62

Query: 55  AVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPS 114
              +   A+  + +PR+ ++ P + G+I+L G + DDL+L+ Y + +  ++ IV +LSP+
Sbjct: 63  GAAVTAEAETAADAPRLTIETPRVSGTISLLGGRLDDLSLKDYRVSLEEDAAIVKMLSPA 122

Query: 115 NTKNAYFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTI 172
              NAY+A   +   A     ++P +NT+W       LTP +P+ L + N   + F RTI
Sbjct: 123 GDPNAYYALYGWAPGAGLGPDDVPGANTLWQAEGDATLTPDSPVTLTWDNGKGLTFNRTI 182

Query: 173 SLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ 232
           ++D+ YLF I  +VTN S   +  +P G + RH        F +    +  + D +L E 
Sbjct: 183 AVDQDYLFTITQSVTNASGSTVALAPYGTLARHGEPQDLKNFFILHEGVIGMADGTLAEI 242

Query: 233 KYSDIEKSSIS---------NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
            Y D+    +             E+N W+G +D YW S  +P    +F S  K+  +   
Sbjct: 243 DYDDMTDFEVDARSGARAEVTQVETNGWIGFTDHYWMSTLVPEPGQAFRSIAKF-DERRE 301

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
            YQ       +T+  G +   T  LFAGAKE+ TI  Y+KD  I  F   IDWGWF+F+ 
Sbjct: 302 IYQTDIVLPTVTVAAGDTSEVTTMLFAGAKEWATIRGYQKD-GIEGFLDSIDWGWFFFLT 360

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           KP+F ++ +   L+GN G AI+  TV +KLL FPLA K Y S A MK +QP+++E++EK 
Sbjct: 361 KPIFAVLHWLNALIGNMGWAIIGLTVLIKLLVFPLAYKSYASMAKMKELQPRMEEIKEKA 420

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
                Q LQ+ M+ LYK   +NP AGC PIL+QIP+FF++YKVI ++LE+RHAPF+G  +
Sbjct: 421 GD-DRQKLQQEMMALYKKEKVNPAAGCLPILIQIPIFFSLYKVIFVTLELRHAPFFGPFQ 479

Query: 464 DLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQA 517
           DL+A DPT+I  LFG+LP   P        + +GI PI++ +SM++Q K++P P D  Q 
Sbjct: 480 DLSAPDPTSIMNLFGLLPMAAPVEGTLMATIFIGILPILLGISMWLQQKLNPAPTDPTQQ 539

Query: 518 MILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           MI  WMP VF+F L  F +GL++YW  +N I+  QQ +IM+ HG +  +   ++S F K 
Sbjct: 540 MIFAWMPWVFMFMLGGFASGLVVYWIANNTITFTQQYLIMRSHGYKPDVFGNIKSGFKKT 599

Query: 578 YNSQ 581
             ++
Sbjct: 600 PKAE 603


>gi|310816968|ref|YP_003964932.1| inner membrane protein oxaA, putative [Ketogulonicigenium vulgare
           Y25]
 gi|308755703|gb|ADO43632.1| inner membrane protein oxaA, putative [Ketogulonicigenium vulgare
           Y25]
          Length = 612

 Score =  442 bits (1135), Expect = e-122,   Method: Composition-based stats.
 Identities = 203/602 (33%), Positives = 315/602 (52%), Gaps = 25/602 (4%)

Query: 1   ME-RNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPN-----QVDNSYA 54
           ME +N N  +A  LS++++  W   +          + +                  + +
Sbjct: 1   MENQNKNLILATVLSLVVIVVWFFLFPPEATNPTLTDEQTTSVATDGTLPVGGAGSTAGS 60

Query: 55  AVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPS 114
              I D   + + + RV ++ P L GSI+L G + DDL L  Y   +  +S  V LL P 
Sbjct: 61  LEAITDADASPATAARVGIETPRLSGSISLLGGRIDDLFLSDYQETIDEDSATVRLLRPV 120

Query: 115 NTKNAYFAELDYVSTAN--NIELPNSNTVWNLIS-GKILTPTTPIKLVFKNANNILFERT 171
             + AY+A   + +        +P  +T+W+L S    LTP TP+ LV+ N    +F  T
Sbjct: 121 GERGAYYASFGWAAAQGIAPEAVPGPDTLWSLESANDTLTPETPVTLVWDNGAGQVFRTT 180

Query: 172 ISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVE 231
            ++D  Y+F +  +V N     +   P G + RH        F +    I  + D  L E
Sbjct: 181 FAIDADYMFTVDQSVQNMGDAAVEMRPYGLVRRHGMPEGLREFFILNEGIVRMADGRLEE 240

Query: 232 QKYSDIEKSS--------ISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
            KYS +   +             + + W+G +D YW +  IP +   F S  KYL     
Sbjct: 241 MKYSKMSDMNDAELGVPAEVAEAQESGWIGFTDHYWMTTLIPEQGQPFRSVQKYLP-SRD 299

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
            +Q +       +  G  +T +  LFAGAKE+ TI  Y+ +  +PRF   IDWGWFYF+ 
Sbjct: 300 IFQVEAVMPRQDVAAGAEVTISTRLFAGAKEWATIREYQNEDGVPRFIDSIDWGWFYFLT 359

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           KP+F ++ +    +GN G +I+  T+ +K +  PLA K YVS A MK +QP++++L+ + 
Sbjct: 360 KPIFSVLHWLNQHIGNMGWSIIALTLILKAIVLPLAYKSYVSMARMKELQPELEKLQARH 419

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
           K    Q LQ  M++LYK + +NP +GC P+++QIP+FF++YKVI +++E+RHAP+ GW++
Sbjct: 420 KD-DRQALQTGMMELYKKNKVNPASGCLPMIVQIPIFFSLYKVIFVTIELRHAPWIGWLQ 478

Query: 464 DLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQA 517
           DL+A DPT+I  LFG+LP+  P          +G+ PI + LSM++Q K++P P D  Q 
Sbjct: 479 DLSAPDPTSILNLFGLLPWGTPEIDSFFFIFSLGVLPIFLGLSMWLQQKLNPLPPDPTQR 538

Query: 518 MILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           MI  WMP VF+F L SF +GL++YW  +NVI+ VQQ  IM  HG    L   +   F + 
Sbjct: 539 MIFAWMPWVFMFMLGSFSSGLVLYWIANNVITFVQQYSIMTYHGHRPDLFGNILGGFKRK 598

Query: 578 YN 579
             
Sbjct: 599 PK 600


>gi|163739492|ref|ZP_02146902.1| 60 kDa inner membrane insertion protein [Phaeobacter gallaeciensis
           BS107]
 gi|161387245|gb|EDQ11604.1| 60 kDa inner membrane insertion protein [Phaeobacter gallaeciensis
           BS107]
          Length = 605

 Score =  441 bits (1134), Expect = e-121,   Method: Composition-based stats.
 Identities = 213/604 (35%), Positives = 333/604 (55%), Gaps = 27/604 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVY-------PRIEEMNNERKNIQTVKQPNQVDNSYA 54
           ++N N  +A ALS +++  W  F+           +        ++ +            
Sbjct: 3   DQNKNLLLATALSFLVILGWYVFFPPPEPQPQPDAVVAETAPAGDVVSAPAAASPAAGSE 62

Query: 55  AVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPS 114
              +   A+  + +PR+ ++ P + G+I+L G + DDL+L+ Y + +  ++ IV +LSP+
Sbjct: 63  GAAVTAEAETAADAPRLAIETPRVSGTISLLGGRLDDLSLKDYRVSLEEDAAIVKMLSPA 122

Query: 115 NTKNAYFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTI 172
              NAY+A   +   A     ++P +NT+W       LTP +P+ L + N   + F RTI
Sbjct: 123 GDPNAYYALYGWAPGAGLGPDDVPGANTLWQAGGDATLTPDSPVTLTWDNGKGLTFNRTI 182

Query: 173 SLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ 232
           ++D+ YLF I  +VTN S + +  +P G + RH        F +    +  + D +L E 
Sbjct: 183 AVDQDYLFTITQSVTNASGNTVALAPYGTLARHGEPQDLKNFFILHEGVIGMADGTLAEI 242

Query: 233 KYSDIEKSSIS---------NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
            Y D+    +             E+N W+G +D YW S  +P    +F S  K+  +   
Sbjct: 243 DYDDMTDFEVDARSGARAEVTQVETNGWIGFTDHYWMSTLVPEPGQAFRSIAKF-DERRE 301

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
            YQ       +T+  G++   T  LFAGAKE+ TI  Y+KD  I  F   IDWGWF+F+ 
Sbjct: 302 IYQTDIVLPTVTVADGETSEATTMLFAGAKEWATIRGYQKD-GIEGFLDSIDWGWFFFLT 360

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           KP+F ++ +   L+GN G AI+  TV +KLL FPLA K Y S A MK +QP+++E++EK 
Sbjct: 361 KPIFAVLHWLNALIGNMGWAIIGLTVLIKLLVFPLAYKSYASMAKMKELQPRMEEIKEKA 420

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
                Q LQ+ M+ LYK   +NP AGC PIL+QIP+FF++YKVI ++LE+RHAPF+G  +
Sbjct: 421 GD-DRQKLQQEMMALYKKEKVNPAAGCLPILIQIPIFFSLYKVIFVTLELRHAPFFGPFQ 479

Query: 464 DLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQA 517
           DL+A DPT+I  LFG+LP   P        + +GI PI++ +SM++Q K++P P D  Q 
Sbjct: 480 DLSAPDPTSIMNLFGLLPMAAPVEGTLMATIFIGILPILLGISMWLQQKLNPAPTDPTQQ 539

Query: 518 MILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           MI  WMP VF+F L  F +GL++YW  +N I+  QQ +IM+ HG +  +   ++S F K 
Sbjct: 540 MIFAWMPWVFMFMLGGFASGLVVYWIANNTITFTQQYLIMRSHGYKPDVFGNIKSGFKKT 599

Query: 578 YNSQ 581
             ++
Sbjct: 600 PKAE 603


>gi|126728217|ref|ZP_01744033.1| putative inner membrane protein translocase component YidC
           [Sagittula stellata E-37]
 gi|126711182|gb|EBA10232.1| putative inner membrane protein translocase component YidC
           [Sagittula stellata E-37]
          Length = 600

 Score =  441 bits (1133), Expect = e-121,   Method: Composition-based stats.
 Identities = 208/600 (34%), Positives = 334/600 (55%), Gaps = 24/600 (4%)

Query: 1   MER-NWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQP--------NQVDN 51
           M+  N N F+A ALS +++  W   +      E  N    +     P             
Sbjct: 1   MDEQNKNLFLATALSFVVILVWFILFPPQDPVEDPNAPAEVSQTADPATGVAAVPEAAPG 60

Query: 52  SYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLL 111
           + AA    +   A+  +PR+ L    L GSI+L G + DDL L+ Y + + S+  IV + 
Sbjct: 61  TEAAAPAGEPVDAVDDAPRLPLDTARLEGSISLTGGRLDDLRLKDYTVSLDSDE-IVQVF 119

Query: 112 SPSNTKNAYFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFE 169
               + +AY+    +         E+P +NT W++ +G+ LT  TP+ L + + + ++F 
Sbjct: 120 HRVGSSDAYYTLYGWAPGGGLSMDEVPGANTPWSVETGETLTTETPVTLRWDSPSGLIFR 179

Query: 170 RTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSL 229
           RTI++DE+Y+F +  T+ N S   +  +P G + RH        F +       + D  L
Sbjct: 180 RTIAVDENYMFTVTQTIENASDASVSLAPYGVLARHGEPQNVKKFFILHEGGISMIDGEL 239

Query: 230 VEQKYSDIEKS--SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA 287
            E  Y D + +        E+  W G +D YW S  IP++  +  S F   +  +  YQ 
Sbjct: 240 TETDYDDFQTAGQHQDVTMETAGWTGFTDHYWMSTLIPTQPGTKVSTF--HNQSNDIYQT 297

Query: 288 KFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMF 347
                 +T+ PG++   ++ LFAGAKE+ TI  Y+K+  + RF   IDWGWF+F+ KP+F
Sbjct: 298 TARMPTMTVAPGETQQVSSKLFAGAKEWETIREYQKN-GVDRFIDSIDWGWFFFLTKPIF 356

Query: 348 MLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSP 407
            ++ + + ++GN GIAI+  T+ +K+L FPLA K Y S A MK +QP++++L+E+     
Sbjct: 357 AVLHWLHGVIGNMGIAIIGLTILLKILLFPLAYKSYASMAKMKELQPEMEKLKERAGDDR 416

Query: 408 PQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAA 467
            + LQK M+ LYK   +NP AGC PILLQIP+FF++YKVI ++LE+RHA F+G  +DL+A
Sbjct: 417 EK-LQKEMMALYKKEKVNPAAGCLPILLQIPIFFSLYKVIFVTLELRHANFFGPFRDLSA 475

Query: 468 ADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILN 521
            DPT+++ LFG+LP+  P        + +GI PI++ +SM++Q K++P PAD  Q MI  
Sbjct: 476 PDPTSLYNLFGLLPWAAPEAGSILALVFIGILPILLGISMWLQQKLNPAPADPTQQMIFA 535

Query: 522 WMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ 581
           WMP VF+F L  F +GL++YW  +N I+  QQ +IM+ HG    ++  ++ +F +    +
Sbjct: 536 WMPWVFMFMLGGFASGLVVYWITNNTITFTQQYLIMRSHGYHPNVLGNIKGSFKRGKKDE 595


>gi|149203002|ref|ZP_01879973.1| putative inner membrane protein translocase component YidC
           [Roseovarius sp. TM1035]
 gi|149143548|gb|EDM31584.1| putative inner membrane protein translocase component YidC
           [Roseovarius sp. TM1035]
          Length = 611

 Score =  440 bits (1132), Expect = e-121,   Method: Composition-based stats.
 Identities = 208/599 (34%), Positives = 335/599 (55%), Gaps = 22/599 (3%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEE---MNNERKNIQTVKQPNQVDNSYAAVLI 58
           ++N N  +A ALS +++  W   +  P               +++  P+    + A    
Sbjct: 3   DQNKNLILATALSFVVILVWFVMFPPPEPAPVDPNAAVPTATESLPTPSATGGAEATTAT 62

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
                A   +PR+ +  PSL G+I+L+G + DD+ L+ Y   +   S IV L++P   + 
Sbjct: 63  TAAPVAEPDAPRLTIDTPSLKGTISLQGGRIDDIFLKNYRETIDPASEIVRLMAPVGNET 122

Query: 119 AYFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE 176
            Y+A   +   A     ++P +NT+W + SG+ LT +TP+ L + N   ++F R +S+DE
Sbjct: 123 PYYALYGWAPGAGLTPDQVPGANTLWQVESGEKLTTSTPVTLSWDNGAGLIFRRELSVDE 182

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
            ++F +  +V N     +  +P G + RH        F +    + ++ D +L E  Y D
Sbjct: 183 DFMFSVRQSVENTGATAVSLAPYGILARHGRPADLKNFFILHEGLIMMADGTLSEIDYDD 242

Query: 237 IEKSSIS---------NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA 287
           +E+   +              N W+G +D YW +  IP+  +SF +  K+       YQ 
Sbjct: 243 VEEYPFNAREGAPAEVTQVTENGWIGFTDHYWMTTLIPAAGSSFKAVAKF-DPQRGIYQT 301

Query: 288 KFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMF 347
           +      T+ PG++ +    LFAGAKE+ TI HY+ +  + RF   IDWGWF+F+ KP+F
Sbjct: 302 EAVQPTQTVEPGQTASAETRLFAGAKEWATIRHYQNEQGVDRFLDSIDWGWFFFLTKPIF 361

Query: 348 MLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSP 407
            ++ +   L+GN G AI+  T+ +K L  PLA K YVS A MK++QP++++++E      
Sbjct: 362 AVLHWLNALIGNMGWAIIALTLLIKALVLPLAYKSYVSMAKMKDLQPQMEKIKE-TAGDD 420

Query: 408 PQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAA 467
            Q LQK M++LYK   +NP AGC PILLQIP+FF++YKVI ++LE+RHAP+ GWIKDL+A
Sbjct: 421 RQKLQKEMMELYKREKVNPAAGCLPILLQIPIFFSLYKVIFVTLELRHAPWVGWIKDLSA 480

Query: 468 ADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILN 521
            DP+++F L+G+LP+  P        + +GI P+ + +SM++Q K++P P D  Q MI  
Sbjct: 481 PDPSSLFNLWGVLPWAAPEPGSIMALIFIGILPLALGISMWLQQKLNPSPTDPTQKMIFA 540

Query: 522 WMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNS 580
           WMP VF+F L SF +GL+IYW  +NVI+  QQ +IM+  G +  +   + S F +   +
Sbjct: 541 WMPWVFMFMLGSFASGLVIYWIANNVITFSQQYMIMRSQGYKPDVFGNITSGFKREKPA 599


>gi|255264683|ref|ZP_05344025.1| 60 kDa inner membrane insertion protein [Thalassiobium sp. R2A62]
 gi|255107018|gb|EET49692.1| 60 kDa inner membrane insertion protein [Thalassiobium sp. R2A62]
          Length = 601

 Score =  440 bits (1131), Expect = e-121,   Method: Composition-based stats.
 Identities = 203/599 (33%), Positives = 328/599 (54%), Gaps = 26/599 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLID-- 59
           ++N N  +A ALS +++  W   +            +  Q++                  
Sbjct: 3   DQNKNLILATALSFLVILVWFVLFPPEEPVVDPITAETAQSIDGATVPTADTGIAPTTGE 62

Query: 60  ---DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNT 116
              ++    S +PR+ ++   L GSI+L G + DDL+L+ Y +++ +   +V LLSP  T
Sbjct: 63  AEPEQEAEASDAPRIAIETEKLSGSISLLGGRLDDLSLKDYPIELDAEE-VVRLLSPVGT 121

Query: 117 KNAYFAELDYVSTANNIE--LPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISL 174
            NAY+A   + +        +P  NT+W + SG  L  +  + L + N   + F R IS+
Sbjct: 122 DNAYYALYGWAAAQGVAADAVPGPNTLWTVESGDTLNTSDAVTLAWDNGAGLTFRREISV 181

Query: 175 DEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKY 234
           DE Y+F I  +V N +  ++  +P G I RH        F + EG + +     L E  Y
Sbjct: 182 DEDYMFNITQSVENTTSTEVALAPYGFIARHGEPDTVGFFILHEGVVRMSD-GELQEIDY 240

Query: 235 SDIEKSSISNFH---------ESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARY 285
           +D+    I               N W+G +DKYW +  +P++ ++F S   Y +  +  Y
Sbjct: 241 NDMPDFDIDARRGAPAESIDVTENGWVGFTDKYWMTNIVPTQGSAFKSSAIY-NPRNDIY 299

Query: 286 QAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKP 345
           Q +      T+  G +   +  LFAGAKE+  I +Y+ D  I  F   IDWGWF+F+ KP
Sbjct: 300 QTEALMPTQTVAVGATAAVSTQLFAGAKEWEAIRNYQNDGGIDGFLDSIDWGWFFFLTKP 359

Query: 346 MFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQ 405
           +F L+ +   ++GN G +I++ T+ +K +  PLA K YVS A MK +QP++++L+E    
Sbjct: 360 IFALLHWLNGVIGNMGWSIIVLTLIIKAILLPLAYKSYVSMARMKELQPEMEKLKEASGD 419

Query: 406 SPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDL 465
              Q LQ+ M++LYK + +NP +GC PILLQIP+FF++YKVI +++E+RHA + GWI+DL
Sbjct: 420 -DRQKLQQGMMKLYKDNKVNPASGCVPILLQIPIFFSLYKVIFVTIELRHAEWMGWIRDL 478

Query: 466 AAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMI 519
           +A DP++I  LFG+LPF  P        + +G+ PII+ +SM++Q K++P P D  Q MI
Sbjct: 479 SAPDPSSILNLFGLLPFNTPESGSLLFILSLGVLPIILGISMWMQQKLNPAPTDPTQKMI 538

Query: 520 LNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNY 578
             WMP VF+F L SF +GL++YW  +N I+  QQ +IM+  G +  +   +R++ S+  
Sbjct: 539 FAWMPWVFMFMLGSFASGLVLYWIANNTITFTQQYLIMRSQGVKPDVFGNIRASLSRKK 597


>gi|254455826|ref|ZP_05069255.1| 60 kDa inner membrane protein [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207082828|gb|EDZ60254.1| 60 kDa inner membrane protein [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 558

 Score =  440 bits (1131), Expect = e-121,   Method: Composition-based stats.
 Identities = 215/563 (38%), Positives = 330/563 (58%), Gaps = 7/563 (1%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
               N   AI+LS  ++  +  ++  P I +     KN           +    +    R
Sbjct: 1   MDTRNVIAAISLSAAVIILYSLYFAPPPITKEQLAEKNKTEQTTDAPSLDQKETITEVSR 60

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
            +ALS S R++ +N S+IGSI+LKGA  DDL  + Y++ + S+   V LLSP + K+ Y 
Sbjct: 61  EEALSQSKRIKFENQSIIGSISLKGAAIDDLTFKEYNVALESDEK-VKLLSPRSAKDGYL 119

Query: 122 AELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFK 181
            E  +++T  NI++PNSN+ W++    ILT  +P+KL + N   I FE+ ISLD+ +LF 
Sbjct: 120 IESGFITTDKNIDIPNSNSEWSVSGSNILTDQSPVKLTWTNDQGITFEKEISLDDKFLFT 179

Query: 182 IVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSS 241
           I   V N++  +  F P G+I+R +    +N + + EG IA L  + L+E+ Y DI++  
Sbjct: 180 IKQKVINSTNKEFDFYPYGQIIRKEIPEISNFYILHEGLIATLD-EELIEEDYDDIQEEK 238

Query: 242 ISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKS 301
            S       WLGISDK+W +  IP     F + F Y     A +        + +    S
Sbjct: 239 FSKT-SQKGWLGISDKFWITSLIPPNGKEFKTTFDYKDKFRANF---VGTEPLELKGNSS 294

Query: 302 ITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFG 361
           I     +   AK    I  Y + L I +F++ IDWG+ YFI KP+F  + YF+ L+GN+G
Sbjct: 295 IEDKLQVIVAAKRVDVIDGYAESLNIDKFDLTIDWGFLYFITKPLFYGIDYFFKLLGNYG 354

Query: 362 IAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKT 421
           +AI+  T+ ++L FFPLA   + S A MK +QP++  L++  K+   + LQ+ M+ LYK 
Sbjct: 355 LAIIAITICIRLAFFPLANFSFRSMAKMKALQPEMVRLKDLHKEDKMK-LQQEMMALYKK 413

Query: 422 HNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILP 481
             +NP++GC PIL+QIPVFFA+YKV+ +++EMR  PF+GWI+DL+  DPT++F LFG+LP
Sbjct: 414 EKVNPMSGCLPILVQIPVFFALYKVLFVTIEMRQMPFYGWIQDLSERDPTSLFNLFGLLP 473

Query: 482 FYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIY 541
           + +P F+ +G WPI M +SMFIQ K++P P D  QA I  + P+     L+ FPAGL+IY
Sbjct: 474 YDVPSFLMIGAWPIAMGVSMFIQQKLNPAPTDPMQAKIFMFFPLFLTIILAPFPAGLVIY 533

Query: 542 WSWSNVISIVQQAVIMKMHGAEI 564
           W+ +N++++ QQ  IMK    + 
Sbjct: 534 WTVNNILTMAQQVFIMKRTTVKT 556


>gi|114569009|ref|YP_755689.1| protein translocase subunit YidC [Maricaulis maris MCS10]
 gi|122316769|sp|Q0ASI6|OXAA_MARMM RecName: Full=Inner membrane protein oxaA
 gi|114339471|gb|ABI64751.1| protein translocase subunit yidC [Maricaulis maris MCS10]
          Length = 592

 Score =  440 bits (1130), Expect = e-121,   Method: Composition-based stats.
 Identities = 213/588 (36%), Positives = 346/588 (58%), Gaps = 15/588 (2%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNS-----YAAV 56
           E   N F+A+ L ++I+  +Q F + P  EE   E+  ++  ++    D        AA 
Sbjct: 3   EDQRNLFIALGLILVILTGYQMFVMGPAEEERRAEQAAVEASQELADPDLPASALEPAAA 62

Query: 57  LIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNT 116
              DR  AL  + RV +  PS++GS++L GA+ DD+ LR +   +  ++P V LL+P  +
Sbjct: 63  TTVDRETALGGNQRVTIDAPSVLGSLSLTGARLDDVRLRRHTETIDDDTP-VALLNPIGS 121

Query: 117 KNAYFAELDYVSTANNI-ELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD 175
            + ++A   + S  +   +LP  +T W L SG  LTP TPI L + + + + FER IS+D
Sbjct: 122 DHVFYARDGWTSATSGFTDLPGGSTEWTLASGSTLTPDTPITLTYDSPSGLHFERVISVD 181

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
           ++YLF + DTVTNNS  ++  S  G +                     + D ++V   + 
Sbjct: 182 DNYLFTLTDTVTNNSGQEVELSRYGLVRHEGRPEDETRNMAVFEGALAVIDGAMVRSSFG 241

Query: 236 DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGH-ARYQAKFSANEI 294
            +E  + +    +  W+GI+ +YW +  +P ++  F ++F+ +  G    ++A +    I
Sbjct: 242 KLEDGNQTEESGTGGWVGITQRYWMAAAVPDQDRPFTARFRTIERGEIDAFEASYVEQAI 301

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
            +  G+S+ +T  +FAGAKE   +   + ++ I RF+M I+WGW +F+ +P   L++   
Sbjct: 302 AVPAGESLASTTRIFAGAKELGVLQQVQNEVGIERFDMAINWGWLWFLTRPFVWLLTMLE 361

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
             +G FG+AI+  T+ VK++ FPLA + Y S A MK +QPK+ E++E++  +  Q  Q+A
Sbjct: 362 GALGQFGLAILALTLMVKIVMFPLANRAYASMAKMKAVQPKMAEIKERY-GADQQKQQQA 420

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           +++LYKT  INPLAGC PIL QIP+FFA+Y+ +  ++EMRHAPF+GWI+DL+AADPTNI+
Sbjct: 421 LMELYKTEKINPLAGCLPILPQIPIFFALYQTLFNAIEMRHAPFFGWIRDLSAADPTNIW 480

Query: 475 TLFGILPFYLPGF------MHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFV 528
            LFG++P+   G       + +G WPIIM L+M  Q  ++PPP D  QA I  ++P+VF 
Sbjct: 481 NLFGLIPYDPTGIWLIGGVLGIGAWPIIMGLTMAAQQALNPPPPDPMQARIFAFLPIVFT 540

Query: 529 FALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSK 576
           F L+ F AGL+IYW+W+N +S++QQ +IM+ HG E  +   +     +
Sbjct: 541 FILAPFAAGLVIYWAWNNFLSVLQQYIIMRRHGNETQVDKLVARLLKR 588


>gi|83854933|ref|ZP_00948463.1| putative inner membrane protein translocase component YidC
           [Sulfitobacter sp. NAS-14.1]
 gi|83842776|gb|EAP81943.1| putative inner membrane protein translocase component YidC
           [Sulfitobacter sp. NAS-14.1]
          Length = 604

 Score =  440 bits (1130), Expect = e-121,   Method: Composition-based stats.
 Identities = 212/597 (35%), Positives = 331/597 (55%), Gaps = 26/597 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVD--------NSY 53
           ++N N   A  LS I++  W   +  P  E + +     Q     +              
Sbjct: 3   DQNKNLIFATVLSFIVILGWFLLFPPPETETITDPAATQQVTDATSTEAIVPSSAGAADN 62

Query: 54  AAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSP 113
                D+   AL  +PR+ ++   + GSI+L G + DDL+L+ Y+  +  +SPIV+LLSP
Sbjct: 63  VTDASDEATAALEEAPRIPVETARISGSISLLGGRVDDLHLKDYNTTIEKDSPIVSLLSP 122

Query: 114 SNTKNAYFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERT 171
           + T +AY+A   +   A     ++P  NT+W L  G+ L+  TP+ L + N    LF RT
Sbjct: 123 AGTPDAYYALYGWAPGAGIAPEQVPGPNTLWTLSQGETLSVETPVTLTWDNDAGQLFSRT 182

Query: 172 ISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVE 231
           IS+DE+Y+FKI   V N S + +  +P G I RH   +    F +    +  + +  L+E
Sbjct: 183 ISIDENYMFKIEQKVENTSENTVSLAPYGLIARHGIPSDAQNFFILHEGLVAMNNGELLE 242

Query: 232 QKYSDIEKSSISNFHES-------NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR 284
             + DI +  + N   S       N W+G +  Y+ +  IP  E       KYL      
Sbjct: 243 TAWDDIPELDVVNGVPSKRIDGVTNGWIGFTGHYFMTNLIPDPEQPTRLTVKYLP-RTEI 301

Query: 285 YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAK 344
           +Q +      T+  G++ T T  LFAGAKE+  +  Y +   + +F   IDWGWF+F+ K
Sbjct: 302 FQTESVMPTQTVASGQTATVTTQLFAGAKEWEILRDY-EAQGVYKFIDSIDWGWFFFLTK 360

Query: 345 PMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK 404
           P+F ++ +   L+GN G+AI+  T+ +K L FPLA K YVS A MK +QP++++L+ K  
Sbjct: 361 PIFWVLHHLNLLIGNMGVAIIGLTLLIKALLFPLAYKSYVSMAKMKELQPQMEKLK-KDA 419

Query: 405 QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKD 464
               Q LQ+ M++LYK   +NP AGC PILLQIP+FF++YKVI ++LE+RHAPF+G  +D
Sbjct: 420 GDDRQKLQQGMMELYKREKVNPAAGCLPILLQIPIFFSLYKVIFVTLELRHAPFFGPFQD 479

Query: 465 LAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAM 518
           L+A DPT+IF  +G+LP+  P        + +GI P+++ +SMF+Q K++P P D  Q M
Sbjct: 480 LSAPDPTSIFNFYGLLPWAAPEAGTVLALVFIGILPLLLGISMFLQQKLNPAPTDPTQQM 539

Query: 519 ILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFS 575
           I  WMP VF+F L  F +GL++YW  +N I+  QQ +IM+  G +  ++  ++ +  
Sbjct: 540 IFAWMPWVFMFMLGGFASGLVVYWIANNTITFTQQYLIMRSQGYKPDILGNIKGSMK 596


>gi|254488170|ref|ZP_05101375.1| 60 kD inner-membrane protein [Roseobacter sp. GAI101]
 gi|214045039|gb|EEB85677.1| 60 kD inner-membrane protein [Roseobacter sp. GAI101]
          Length = 616

 Score =  439 bits (1129), Expect = e-121,   Method: Composition-based stats.
 Identities = 204/597 (34%), Positives = 325/597 (54%), Gaps = 28/597 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAV----- 56
           ++N N  +A  LS I++  W   +  P      +  +   T        ++         
Sbjct: 3   DQNKNLIIATVLSFIVILGWFLLFPPPEPNTPLDGTEISATAPTDVTTPDAAVPAGTALP 62

Query: 57  -----LIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLL 111
                  + RA +L  +PRV ++   L GSI+L G + DDL L+ Y   +  ++PIVTLL
Sbjct: 63  ATTADPEETRADSLEQAPRVPVETSRLTGSISLLGGRIDDLRLKDYRTTIEDDAPIVTLL 122

Query: 112 SPSNTKNAYFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFE 169
           SP+ T +AY+A   + + A     ++P  NT+W+L SG  L+  +P+ + + N    +F 
Sbjct: 123 SPAGTDDAYYALYGWAAGAGIAPEQVPGPNTLWSLASGDTLSVGSPVTMTWDNGAGQVFS 182

Query: 170 RTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSL 229
           R IS+DE+++F++  +V N S   +  +P G I RH   T    F +    +  + +  L
Sbjct: 183 RVISVDENFMFEVEQSVQNTSETSVTLAPYGIIARHGIPTDAQNFFILHEGMVAMNNGEL 242

Query: 230 VEQKYSDIEKSSISNFHES-------NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGH 282
           +E  + DI          S       N W+G +  Y+ +  IP          KYL    
Sbjct: 243 IETGWEDIPDLDPVGGVPSKRIDGVTNGWIGFTGHYFMTNLIPDPAQQSRLTAKYLP-RT 301

Query: 283 ARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFI 342
             +Q +       I  G S + +  LFAGAKE+  +  Y +   + +F   IDWGWF+F+
Sbjct: 302 DIFQTEAVLPTQVIAAGSSASVSTQLFAGAKEWEALRDY-EAAGVYKFVDSIDWGWFFFL 360

Query: 343 AKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREK 402
            KP+F ++ +   L+GN G+AI+  T+ +K L FPLA K YVS A MK +QP++++L+ K
Sbjct: 361 TKPIFWVLHHLNILIGNMGVAIIGLTLLIKALLFPLAYKSYVSMAKMKELQPQMEKLK-K 419

Query: 403 FKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWI 462
                 Q LQ+ M++LYK   +NP AGC PI++QIP+FF++YKVI ++LE+RHAPF+G  
Sbjct: 420 DAGDDRQKLQQGMMELYKREKVNPAAGCLPIIMQIPIFFSLYKVIFVTLELRHAPFFGPF 479

Query: 463 KDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQ 516
           +DL+A DPT+IF  +G+LP+ +P        + +GI P+++ +SMF+Q K++P P D  Q
Sbjct: 480 QDLSAPDPTSIFNFYGLLPWGVPEAGSVMALIFIGILPLLLGISMFLQQKLNPAPTDPTQ 539

Query: 517 AMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRST 573
            MI  WMP VF+F L  F +GL++YW  +N I+  QQ +IM+  G +  L+  +   
Sbjct: 540 QMIFAWMPWVFMFMLGGFASGLVVYWIANNTITFTQQYLIMRSQGYKPDLLGNITGG 596


>gi|254460224|ref|ZP_05073640.1| 60 kDa inner membrane insertion protein [Rhodobacterales bacterium
           HTCC2083]
 gi|206676813|gb|EDZ41300.1| 60 kDa inner membrane insertion protein [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 601

 Score =  439 bits (1127), Expect = e-121,   Method: Composition-based stats.
 Identities = 203/603 (33%), Positives = 322/603 (53%), Gaps = 27/603 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRI------EEMNNERKNIQTVKQPNQVDNSYAA 55
           ++N N  +A ALS I++  W   +  P          ++ E   +          ++   
Sbjct: 3   DQNKNLILATALSFIVILVWFVLFPPPEPTPADPNAVISAEGDAVLPSVSAGDDADAGVN 62

Query: 56  VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSN 115
                  +    +PR+ ++   L GSI+L G + D L L+ Y + +  ++PIV LLSP  
Sbjct: 63  TAAAQAEEPTQDAPRIAIETGRLKGSISLLGGRIDQLALKDYRVSLDDDAPIVDLLSPVG 122

Query: 116 TKNAYFAELDYVSTANN--IELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTIS 173
            K+ Y+A   +   A     ++P  NT+W+  S   L+   P+ L + N N + F RTIS
Sbjct: 123 EKSPYYALYGWAPGAGLAFEQVPGPNTIWSAQSSGNLSVDAPVTLTWDNGNGLQFTRTIS 182

Query: 174 LDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQK 233
           +DE+++F +  +V N     +  +P G + RH        F +    +  + D  L E  
Sbjct: 183 VDENFMFSVAQSVENTGAGTVSLAPYGILARHGEPQNLKNFFILHEGVVAMSDGELTEID 242

Query: 234 YSDIEKSSISNFH---------ESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR 284
           YSD+    ++                W+G +D+YW +  IP+    F S  KY  D    
Sbjct: 243 YSDMPDFDVNPNEGARAEVTQVAEQGWVGFTDQYWMTTLIPAPGA-FKSTAKY-DDRRDI 300

Query: 285 YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAK 344
           YQ +       + PG + + T  LFAGAKE+ TI  Y +   +  F   IDWGWF+F+ K
Sbjct: 301 YQTEAVLPTQRLAPGATASATTQLFAGAKEWATIRDY-ETAGVEGFIDSIDWGWFFFLTK 359

Query: 345 PMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK 404
           P+F ++ Y   ++GN G AI+  T  +KL+ FPLA K  VS A MK +QP++++++E   
Sbjct: 360 PIFAVLHYLNAMIGNMGWAIIGLTFLIKLILFPLAYKSNVSMAKMKALQPQMEKIKESAG 419

Query: 405 QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKD 464
               Q LQ+ M+ +YK   +NP +GC PIL+QIP+FF++YKVI ++LE+RHAP+ GWIKD
Sbjct: 420 DDK-QKLQQDMMAMYKKEKVNPASGCLPILVQIPIFFSLYKVIFVTLELRHAPWIGWIKD 478

Query: 465 LAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAM 518
           L+A DP++I  LFG+L F  P          +GI PI++ +SM++Q K++P P D  QAM
Sbjct: 479 LSAPDPSSILNLFGLLSFVPPEPGSILAIFSLGILPILLGISMWMQQKLNPAPTDPTQAM 538

Query: 519 ILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNY 578
           I  WMP VF+F L +F +GL++YW  +N I+  QQ +IM+  G +  +   +++ F +  
Sbjct: 539 IFAWMPWVFMFMLGTFASGLVVYWIANNTITFTQQYLIMRSQGVKPDVFGNIKAGFKRKP 598

Query: 579 NSQ 581
             +
Sbjct: 599 KEE 601


>gi|17984422|gb|AAL53516.1| 60 kDa inner membrane protein yidc [Brucella melitensis bv. 1 str.
           16M]
          Length = 588

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 252/546 (46%), Positives = 354/546 (64%), Gaps = 3/546 (0%)

Query: 36  ERKNIQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLR 95
             +            ++ AA     R  A++ SPR+E+  PSL GSINL GA+ DDL L+
Sbjct: 40  TPQMPANPDSIPGQGDTKAAGAPLTRDAAIAQSPRIEIDTPSLRGSINLTGARLDDLYLK 99

Query: 96  GYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTP 155
            YH  VS  SP + LL+PS+ K  YF EL +        +P  NTVW +     LTP+TP
Sbjct: 100 KYHETVSDKSPEIELLAPSSLKQGYFVELGFTGNDATGAVPGPNTVWVVEGNNKLTPSTP 159

Query: 156 IKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIM-RHKPQTATNTF 214
           + L + N  N+ F+R IS+D+ Y+F + DT+ NN    +  +  GR+   ++P+ A+ T+
Sbjct: 160 VTLTYTNDKNLTFKRVISVDDAYMFTVDDTIINNGGSTVSLASYGRVTRFNQPEHASATY 219

Query: 215 GVQEGFIAVLGDKSLVEQKYSD-IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHS 273
            + EG I V+G   L E KY+   +   IS       W+GI+DKYWA+  IP ++  F  
Sbjct: 220 VLHEGLIGVMGQDGLQEIKYAKIEDNKDISFKDVIGGWVGITDKYWAATLIPPQDEKFTG 279

Query: 274 QFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEML 333
           +F + ++   RYQ+   +  +T+ PG+S    N +FAGAK   TI +YE    I +F++L
Sbjct: 280 RFSHFTNDRPRYQSDLLSAPLTVAPGQSQKIQNRVFAGAKVVNTIQNYETKYHIKQFDLL 339

Query: 334 IDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQ 393
           IDWGWFYFI KPMF L+ + Y   GNFG+AI++ TV +K LFFPLA K Y S A MK +Q
Sbjct: 340 IDWGWFYFITKPMFYLIDWIYKFTGNFGVAILVVTVLLKALFFPLANKSYKSMARMKLMQ 399

Query: 394 PKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEM 453
           PK+ E+REK+     +  Q+AM++LYK   INPLAGCWP+L+QIPVFFA+YKV+ +++EM
Sbjct: 400 PKMTEIREKYADDKMK-QQQAMMELYKREKINPLAGCWPVLVQIPVFFALYKVLYVTIEM 458

Query: 454 RHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPAD 513
           RHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G+WPIIM + MF+QM+M+P P D
Sbjct: 459 RHAPFFGWIQDLAAPDPTSIFNLFGLLPYTVPHFLMIGVWPIIMGIIMFLQMRMNPTPPD 518

Query: 514 KGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRST 573
             QA I  WMP++F F L+SFPAGL+IYW+W+N +SI+QQ+VIMK  G +I L D L+  
Sbjct: 519 PTQAAIFTWMPIIFTFMLASFPAGLVIYWAWNNTLSIIQQSVIMKRQGVKIELFDNLKGL 578

Query: 574 FSKNYN 579
           F +   
Sbjct: 579 FRRKPK 584


>gi|83941456|ref|ZP_00953918.1| putative inner membrane protein translocase component YidC
           [Sulfitobacter sp. EE-36]
 gi|83847276|gb|EAP85151.1| putative inner membrane protein translocase component YidC
           [Sulfitobacter sp. EE-36]
          Length = 604

 Score =  437 bits (1123), Expect = e-120,   Method: Composition-based stats.
 Identities = 211/597 (35%), Positives = 330/597 (55%), Gaps = 26/597 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVD--------NSY 53
           ++N N   A  LS I++  W   +  P  E + +     Q     +              
Sbjct: 3   DQNKNLIFATVLSFIVILGWFVLFPPPETETITDPAATQQVTDATSTEAVVPSSAGAADN 62

Query: 54  AAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSP 113
                D+   AL  +PR+ ++   + GSI+L G + DDL+L+ Y+  +  ++PIV+LLSP
Sbjct: 63  VTDASDEATAALEEAPRIPVETARISGSISLLGGRVDDLHLKDYNTTIEDDAPIVSLLSP 122

Query: 114 SNTKNAYFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERT 171
           + T +AY+A   +   A     ++P  NT+W L  G+ L+  TP+ L + N    LF RT
Sbjct: 123 AGTPDAYYALYGWAPGAGIAPEQVPGPNTLWTLSQGETLSVETPVTLTWDNDAGQLFSRT 182

Query: 172 ISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHK-PQTATNTFGVQEGFIAVLGDKSLV 230
           IS+DE+Y+FKI   V N S + +  +P G I RH  P  A N F + EG +A+   + L 
Sbjct: 183 ISIDENYMFKIEQKVENTSENSVSLAPYGLIARHGIPSDAQNFFILHEGLVAMNNGELLE 242

Query: 231 EQKYSDIEKSSISNFHES------NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR 284
                  E  +++           N W+G +  Y+ +  IP          KYL      
Sbjct: 243 TAWDDIPELDAVNGVPSKRIDGVTNGWIGFTGHYFMTNLIPDPAQPTRLSVKYLP-RTEI 301

Query: 285 YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAK 344
           +Q +      T+  G++ T T  LFAGAKE+  +  Y +   + +F   IDWGWF+F+ K
Sbjct: 302 FQTESVMPTQTVARGQTATVTTQLFAGAKEWEILRDY-EAQGVYKFIDSIDWGWFFFLTK 360

Query: 345 PMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK 404
           P+F ++ +   L+GN G+AI+  T+ +K L FPLA K YVS A MK +QP++++L+ K  
Sbjct: 361 PIFWVLHHLNLLIGNMGVAIIGLTLLIKALLFPLAYKSYVSMAKMKELQPQMEKLK-KDA 419

Query: 405 QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKD 464
               Q LQ+ M++LYK   +NP AGC PIL+QIP+FF++YKVI ++LE+RHAPF+G  +D
Sbjct: 420 GDDRQRLQQGMMELYKREKVNPAAGCLPILMQIPIFFSLYKVIFVTLELRHAPFFGPFQD 479

Query: 465 LAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAM 518
           L+A DPT+IF  +G+LP+  P        + +GI P+++ +SMF+Q K++P P D  Q M
Sbjct: 480 LSAPDPTSIFNFYGLLPWAAPEAGTVLALVFIGILPLLLGISMFLQQKLNPAPTDPTQQM 539

Query: 519 ILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFS 575
           I  WMP VF+F L  F +GL++YW  +N I+  QQ +IM+  G +  ++  ++ +  
Sbjct: 540 IFAWMPWVFMFMLGGFASGLVVYWIANNTITFTQQYLIMRSQGYKPDILGNIKGSMK 596


>gi|99080148|ref|YP_612302.1| putative inner membrane protein translocase component YidC
           [Ruegeria sp. TM1040]
 gi|122398415|sp|Q1GJX6|OXAA_SILST RecName: Full=Inner membrane protein oxaA
 gi|99036428|gb|ABF63040.1| protein translocase subunit yidC [Ruegeria sp. TM1040]
          Length = 608

 Score =  437 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 214/598 (35%), Positives = 324/598 (54%), Gaps = 28/598 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVY--------PRIEEMNNERKNIQTVKQPNQVDNSY 53
           ++N N  +A ALS +++  W  F+            + E   +         P+    + 
Sbjct: 3   DQNKNLLLATALSFLVILGWYFFFPPPEEAPQPATEVTETAPQGDTTAPAAAPSAGAATA 62

Query: 54  AAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSP 113
                    +     PR+ +  P + GSI+LKG + DDL L+ Y   +  +SPIVTLLSP
Sbjct: 63  EVDAAAAETEITEDVPRLTIDTPRVEGSISLKGGRIDDLRLKDYRETLDDDSPIVTLLSP 122

Query: 114 SNTKNAYFAELDYVSTANN--IELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERT 171
           +   +AY+A   +   A     ++P +NT+W   +G  LTP TP+ L + N   + F R 
Sbjct: 123 AGQPHAYYALYGWAPGAGLGIEDVPTANTLWQAEAGATLTPDTPVTLTWDNGKGLTFSRE 182

Query: 172 ISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVE 231
           +S+DE Y+F I  +VTN+S   +  +P G + RH        F V    +  + D  L E
Sbjct: 183 VSIDEDYMFSITQSVTNSSGASVALAPYGTLARHGEPANLENFFVLHEGVVGMADGELSE 242

Query: 232 QKYSDIEKSSISN---------FHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGH 282
             Y D+                    N W+G +  YW S  IP+   +F +  KY  +  
Sbjct: 243 IDYDDMTDFDPDPRDGSRAQVNTVTENGWIGFTGHYWMSTLIPAPGEAFRAIAKY-DERR 301

Query: 283 ARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFI 342
             YQ       +T+  G+S +    LFAGAKE+ TI  YE+   I  F   IDWGWF+F 
Sbjct: 302 DIYQTDVVLPTVTLAAGESTSANTQLFAGAKEWATIREYERA-GIEGFLDSIDWGWFFFF 360

Query: 343 AKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREK 402
            KP+F ++ +    +GN G+AI+  T  +K+L FPLA K Y S A MK +QP++++LRE+
Sbjct: 361 TKPIFAVLHWLNAAIGNMGVAIIALTFLLKILVFPLAYKSYASMARMKELQPEMEKLRER 420

Query: 403 FKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWI 462
                 Q +QK M++LYK   +NP AGC PIL+QIP+FF++YKVI ++LE+RHA F+G  
Sbjct: 421 AGD-DRQKMQKEMMELYKREKVNPAAGCLPILIQIPIFFSLYKVIFVTLELRHAAFFGPF 479

Query: 463 KDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQ 516
           +DL+  DPT++F LFG+LP+  P        + +GI PI++ +SM++Q K++P P D+ Q
Sbjct: 480 QDLSVPDPTSLFNLFGLLPWAAPAPDSLLSLVFIGILPILLGVSMWVQQKLNPAPTDETQ 539

Query: 517 AMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTF 574
            MI  WMP VF+F L  F +GL++YW  +NVI+  QQ +IM+ HG    +   ++S F
Sbjct: 540 RMIFAWMPWVFMFMLGGFASGLVVYWITNNVITFTQQYLIMRSHGYTPDVFGNIKSGF 597


>gi|89053128|ref|YP_508579.1| putative inner membrane protein translocase component YidC
           [Jannaschia sp. CCS1]
 gi|122499543|sp|Q28UQ8|OXAA_JANSC RecName: Full=Inner membrane protein oxaA
 gi|88862677|gb|ABD53554.1| protein translocase subunit yidC [Jannaschia sp. CCS1]
          Length = 626

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 219/626 (34%), Positives = 336/626 (53%), Gaps = 49/626 (7%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTV------------KQPNQV 49
           ++N N  +A  LS +++  W   +  P + E  N                          
Sbjct: 3   DQNRNLILATGLSFVVILVWFLLFPPPEMVEDPNAIPPAAETGGVETDTGIALTPPVTVA 62

Query: 50  DNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVT 109
           D    A        ALS + R+++  P++ GSI+L G + DDL+LR Y  +V  +  IV 
Sbjct: 63  DAPAGADTTAPSEVALSEAARIDIDTPAVEGSISLLGGRIDDLSLRNYFTEVDGDQ-IVR 121

Query: 110 LLSPSNTKNAYFAELDYVSTANN--IELPNSNTVWNLISGKILTPTTPIKLVFKNANNIL 167
           LLSP  + + Y+A   +  + +    ++P S+T W L SG ILTP +PI L + N + ++
Sbjct: 122 LLSPVGSDDPYYALYGWTPSGDLGYADVPTSDTPWELESGTILTPDSPITLAWDNGSGLI 181

Query: 168 FERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDK 227
           F RTI +D+ ++F++  +V N    ++  +P G + RH   +    F +    +    D 
Sbjct: 182 FRRTIEIDDRFMFQVTQSVENTGGAEVNLAPYGIVARHGLPSDLQNFFILHEGVVRKVDG 241

Query: 228 SLVEQKYSDIEKSSIS---------NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYL 278
            L E  YSD+    I             E+N W+G +DKYW +  IP +  SF S  KY+
Sbjct: 242 ELSELGYSDLPDLDIIAREGVPAEVMEVETNGWIGFTDKYWMTTLIPGENQSFVSVVKYV 301

Query: 279 SDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDL------------- 325
                 YQ +     ++I PG++   T  LFAGAKE   I  YE                
Sbjct: 302 PSA-EIYQTEARLPYMSIAPGETAEVTTQLFAGAKEAEAIRDYENAEPGLIASLFGAEQD 360

Query: 326 ----AIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKK 381
                IPRF   IDWGWFYF+ KP+F L+ +    +GN G+AI+  T+ VK + FPLA +
Sbjct: 361 ASRGEIPRFIDSIDWGWFYFLTKPLFWLLHWLNGAIGNMGLAIISLTLIVKAVLFPLAYR 420

Query: 382 QYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFF 441
            YVS A MK +QP+I++L+E       Q LQ+ M++LYK + +NP  GC PILLQIP+FF
Sbjct: 421 SYVSMAKMKELQPEIEKLKE-SAGDDRQKLQQGMMELYKKNKVNPAGGCLPILLQIPIFF 479

Query: 442 AIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPI 495
           ++YKVI ++LE+RHAPF+GW+ DL+A D ++I  L+G+LP   P        + +GI P+
Sbjct: 480 SLYKVIFVTLELRHAPFFGWLNDLSAPDSSSIINLYGLLPNPAPEPESIMALIFIGILPL 539

Query: 496 IMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAV 555
           ++ +SM++Q K++P P D  QA I  W+P VF+F L SF +GL++YW  +N ++  QQ +
Sbjct: 540 LLGISMWLQQKLNPAPTDAMQAQIFAWLPWVFMFMLGSFASGLLVYWIANNTLTFTQQYL 599

Query: 556 IMKMHGAEIGLIDRLRSTFSKNYNSQ 581
           IM+  G +  +   +RS+F K    +
Sbjct: 600 IMRSQGFKPDVFGNIRSSFKKKAKEE 625


>gi|119383628|ref|YP_914684.1| putative inner membrane protein translocase component YidC
           [Paracoccus denitrificans PD1222]
 gi|166975878|sp|A1B0E4|OXAA_PARDP RecName: Full=Inner membrane protein oxaA
 gi|119373395|gb|ABL68988.1| protein translocase subunit yidC [Paracoccus denitrificans PD1222]
          Length = 635

 Score =  435 bits (1118), Expect = e-120,   Method: Composition-based stats.
 Identities = 208/619 (33%), Positives = 326/619 (52%), Gaps = 48/619 (7%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVY-PRIEEMNNERKNIQTVKQPNQVDNSYAAVLID- 59
           + N N  +A+ LS +++  W  F+   P     +    + Q   QP     +    +   
Sbjct: 3   DNNRNLILAMVLSALVMLVWSIFFAPEPVPPAQDTPAASTQGTAQPEAGGPATPGAVPQG 62

Query: 60  ---------DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTL 110
                      +   + + RV +++ SL G+I+L G + DDL L GY   + + SP V L
Sbjct: 63  AAPELEAAAASSDPSANAGRVAIESSSLAGTISLAGGRIDDLELTGYRETLDTRSPFVRL 122

Query: 111 LSPSNT--------------------KNAYFAELDYVSTANNIE--LPNSNTVWNLISGK 148
           LSP+                      +  Y+A   ++  A      +P   TVW + SG 
Sbjct: 123 LSPTAQTTVQAEGSPVAPGGGAELAVQKPYYAVYGWMPAAGTDPALVPGPATVWEVESGA 182

Query: 149 ILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQ 208
            L P  P+ L + N    +F RT  LD+ +LF +  T+ N        +P G + RH   
Sbjct: 183 KLGPGQPVTLRWDNGAGQIFRRTYELDDKFLFTVTQTLENTGTAPFSAAPYGILARHGKP 242

Query: 209 TATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSIS-------NFHESNSWLGISDKYWAS 261
              N F + EG + +   K L ++     +   +           + N W+G +DKYW +
Sbjct: 243 DTQNFFVLHEGAVGMTDGKLLEKKYKDMTKLDPLPGEGPAELVEVQENGWIGFTDKYWMT 302

Query: 262 VFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHY 321
              P+   SF +  KY   G   YQ +      T+ PG + T++++LFAGAK +  I+ Y
Sbjct: 303 TLAPAPGQSFTAVAKYAP-GADIYQTEARMPVQTVAPGATGTSSSYLFAGAKVWEVINGY 361

Query: 322 EKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKK 381
           + +  I RF   IDWGWFYF+ KP+F L+ + + ++GN G AI+  T  +KLL FPLA+K
Sbjct: 362 QTNPGIDRFVDSIDWGWFYFLTKPIFRLLHWLHGMIGNMGWAIIALTFVLKLLVFPLARK 421

Query: 382 QYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFF 441
            Y+S A MK +QP+++ ++E+      +  QK +++LYK   +NP AGC P+LLQIP+FF
Sbjct: 422 SYISMAKMKELQPQMEAIKERTGDDRMK-FQKEVMELYKREKVNPAAGCLPVLLQIPIFF 480

Query: 442 AIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGF------MHVGIWPI 495
           A+YKVI +++E+RHAP+ GWI+DLAA DP++++ LFG+LP+  PG         + +  I
Sbjct: 481 ALYKVIFVTIELRHAPWIGWIRDLAAPDPSSLWNLFGLLPWAAPGQGSFLHSFTLPVLAI 540

Query: 496 IMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAV 555
           ++ +SM++Q K++P P D  Q MI  WMP VF+F L  F +GL++YW  +N I+I+QQ  
Sbjct: 541 LLGVSMWMQQKLNPAPTDPAQKMIFAWMPWVFMFMLGGFASGLVLYWITNNTITIIQQYT 600

Query: 556 IMKMHGAEIGLIDRLRSTF 574
           IM MHG        +RS+ 
Sbjct: 601 IMSMHGHRPDFFGNIRSSL 619


>gi|83313455|ref|YP_423719.1| putative inner membrane protein translocase component YidC
           [Magnetospirillum magneticum AMB-1]
 gi|82948296|dbj|BAE53160.1| Preprotein translocase subunit YidC [Magnetospirillum magneticum
           AMB-1]
          Length = 579

 Score =  435 bits (1118), Expect = e-119,   Method: Composition-based stats.
 Identities = 220/581 (37%), Positives = 330/581 (56%), Gaps = 20/581 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIE-----------------EMNNERKNIQTV 43
           M    N FVAIA+SV I+  WQ F+   +                             + 
Sbjct: 1   MNDQRNLFVAIAISVAILIGWQYFFPTAKPPVEQAAQQQSAEQKASAPATAPTPATASSP 60

Query: 44  KQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSS 103
            Q      + AA     RA AL  S R+ ++ PS+ GSI L GA+ DD+ L  Y    ++
Sbjct: 61  AQVPGSPAAAAAQPAATRADALGKSRRIAIQTPSMHGSIALTGARIDDITLVKYRETPAA 120

Query: 104 NSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNA 163
           +S  + L+SP+ +   Y+AE  +V+T  N+++P  ++VW       LTP +P+ L + N 
Sbjct: 121 DSREIDLMSPAESPEPYWAEFGWVATEANVKVPGPDSVWQAQGSGPLTPASPLVLTWDNG 180

Query: 164 NNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAV 223
             + F RT ++DE+Y+F +   V N         P   + R         + + EG + V
Sbjct: 181 EGLRFVRTYTVDENYMFGVAQRVENYGTKPASLHPYALLARTGTPHVAGMYILHEGPLGV 240

Query: 224 LGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLS-DGH 282
               +L E KY D++K   S    +  W GI+DKYW +  +P  +T    +F +      
Sbjct: 241 FD-GTLKEMKYDDLKKEGSSRHKTTGGWAGITDKYWLTALVPPAKTEITGRFVHQRLGNA 299

Query: 283 ARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFI 342
            RYQ  + A    I PGKS      LF GAK+   +  Y +   I RF++ ID+GWFYF+
Sbjct: 300 DRYQVDYLAPARMIEPGKSEEAGFHLFTGAKQVSLLDGYAEKFGIDRFDLAIDFGWFYFL 359

Query: 343 AKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREK 402
            KP F L+   ++ +GN G+AI+  TV +KL  FPLA K YV+   MK +QPK+ EL+ +
Sbjct: 360 TKPFFYLLQMLHSALGNMGLAILALTVILKLAMFPLANKSYVAMGKMKKLQPKVQELQAR 419

Query: 403 FKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWI 462
           +       LQ+ M+ LYKT  +NP++GC PI++QIPVFFA+YKV+ +++EMRHAPF+GWI
Sbjct: 420 YADDK-MRLQQEMMALYKTEKVNPVSGCLPIMVQIPVFFALYKVLFVTIEMRHAPFYGWI 478

Query: 463 KDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNW 522
            DL+A DPTNIFTLFG++P+  P   H+G+WP+IM ++MF+Q K++P P D  QA ++ +
Sbjct: 479 SDLSAQDPTNIFTLFGMIPWTPPSMFHLGVWPLIMGVTMFLQQKLNPQPTDPVQAKMMQF 538

Query: 523 MPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           +P++F F L++F +GL+IYW+WSN +SI+QQ VIMK    +
Sbjct: 539 LPIIFTFLLANFASGLVIYWAWSNTLSILQQWVIMKRAEEK 579


>gi|83950483|ref|ZP_00959216.1| inner membrane protein YidC, putative [Roseovarius nubinhibens ISM]
 gi|83838382|gb|EAP77678.1| inner membrane protein YidC, putative [Roseovarius nubinhibens ISM]
          Length = 599

 Score =  435 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 202/596 (33%), Positives = 321/596 (53%), Gaps = 18/596 (3%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYV------YPRIEEMNNERKNIQTVKQPNQVDNSYAA 55
           ++N N  +A  LS++++  W   +                      T   P       + 
Sbjct: 3   DQNKNLILASILSLLVIIIWTVLFPAAETDLPADTVTTTASAPAGDTALTPGSAGGEVST 62

Query: 56  VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSN 115
                       + RV ++ PS+ GSI+L+G + D+L L  Y   +   + IVTLL+P+ 
Sbjct: 63  ETTAPAEPLPESAARVAVETPSVTGSISLRGGRLDELALNNYRESLDPGAEIVTLLNPTG 122

Query: 116 TKNAYFAELDYVSTA--NNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTIS 173
           + + Y+A   +      N+  +P +NT+W++ SG+ LTP +P+ L+++N   + F R IS
Sbjct: 123 SASPYYALFGWAPGTGLNSDSVPGANTLWSVESGETLTPESPVTLLWENGQGLTFRREIS 182

Query: 174 LDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQK 233
           +D  Y+F I  TV N        +P G I RH        F +       + D  L E  
Sbjct: 183 VDAKYMFTIRQTVENTGDAAPVLAPYGIIARHGEPADLKNFFILHEGAVQMADGELNEID 242

Query: 234 YSDIEKSSISNF--HESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSA 291
           Y D E +         +N W G +D YW +  IP  ET F     +       YQ     
Sbjct: 243 YDDFEGAGNHTPLKVATNGWTGFTDHYWMTTLIPRGETGFDLST-FQDPRRNIYQTTVKQ 301

Query: 292 NEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMS 351
             IT+ PG++   T  LFAGAKE+ TI +Y+    + +F   IDWGWF+F+ KP+F L+ 
Sbjct: 302 PAITLEPGQTAEATTQLFAGAKEWETIRNYQNKGGVDKFLDSIDWGWFFFLTKPIFALLH 361

Query: 352 YFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVL 411
           +    +GN G +I+  T+ +KL+  PLA K YVS A MK +QP++++++E+      Q L
Sbjct: 362 WLNQQIGNMGWSIIALTLIIKLVLLPLAYKSYVSMAKMKELQPQMEKIKERAGD-DRQAL 420

Query: 412 QKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPT 471
           QK M+ LYK   +NP +GC PILLQIP+FF++YKVI ++LE+RHAP+ GWI+DL+A DP+
Sbjct: 421 QKEMMALYKKEKVNPASGCLPILLQIPIFFSLYKVIFVTLELRHAPWIGWIRDLSAPDPS 480

Query: 472 NIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPV 525
           +++ L+G+LP+  P        + +GI P+++ +SM++Q K++P P D  Q M+  WMP 
Sbjct: 481 SLYNLWGLLPWNAPEPGSLLALIFIGILPLLLGISMWLQQKLNPAPTDPTQKMVFAWMPW 540

Query: 526 VFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ 581
           +F+F L SF +GL++YW  +N I+  QQ  IM+  G +  +   ++S F +   + 
Sbjct: 541 IFMFMLGSFASGLVVYWIANNTITFTQQYAIMRSQGYKPDVFGNIKSGFKRTRKTD 596


>gi|56695446|ref|YP_165794.1| putative inner membrane protein translocase component YidC
           [Ruegeria pomeroyi DSS-3]
 gi|81676422|sp|Q5LW11|OXAA_SILPO RecName: Full=Inner membrane protein oxaA
 gi|56677183|gb|AAV93849.1| inner membrane protein YidC, putative [Ruegeria pomeroyi DSS-3]
          Length = 609

 Score =  434 bits (1115), Expect = e-119,   Method: Composition-based stats.
 Identities = 211/608 (34%), Positives = 336/608 (55%), Gaps = 31/608 (5%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNER------KNIQTVKQPNQVDNSYAA 55
           ++N N  +A ALS +++  W   +  P   E             +QT         +   
Sbjct: 3   DQNKNLILATALSFLVILVWFILFPPPEQTEAPATEIATTNGTAVQTPTAAATEGGAGEV 62

Query: 56  VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSN 115
             +D  A   + +PRV++  P L GS++L G + D+L+L+ Y + +  ++ IV +L+P+ 
Sbjct: 63  PALDSAAPTQAEAPRVQIDTPRLKGSVSLLGGRIDELSLKDYRVSLDEDAEIVEMLTPAG 122

Query: 116 TKNAYFAELDYVSTA--NNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTIS 173
           + +AY+A   +   A  N  ++P   T W+L SG  L+  TP+ L + N + + F RT++
Sbjct: 123 STSAYYALYGWAPGAGLNAADVPGPLTEWSLESGDTLSVGTPVTLSWSNGSGVTFRRTLA 182

Query: 174 LDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAV-----LGDKS 228
           +DE Y+F +  +V N S   I  +P G + RH      +  G++  FI       + D +
Sbjct: 183 VDEDYMFTVTQSVENGSAAPIGAAPYGILARHGIGEDADLPGLKNFFILHEGVVAMNDGT 242

Query: 229 LVEQKYSDIEKSSISNF---------HESNSWLGISDKYWASVFIPSKETSFHSQFKYLS 279
           L E  Y D+ K  I            ++S+ W+G +D YW +  IP   T+F S  KY  
Sbjct: 243 LSEIDYKDVRKFDIDPNEGAQAEVFQNKSDGWIGFTDHYWMATLIPGSGTAFKSAAKY-D 301

Query: 280 DGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWF 339
                YQA+     +++ PG+S   T  LFAGAKE+ +I  Y++D  + +F   IDWGWF
Sbjct: 302 ARRKIYQAETVLPTMSVAPGESAEVTTRLFAGAKEWESIRAYQQD-GVQKFLDSIDWGWF 360

Query: 340 YFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDEL 399
           +F+ KP+F L+     L+GN G +I+  T+ +K + FPLA K YVS A MK +QP+++ L
Sbjct: 361 FFLTKPIFWLLHQINGLIGNMGWSIIGLTLIIKAIVFPLALKSYVSMAKMKELQPQMEAL 420

Query: 400 REKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFW 459
           +E       Q +Q+ M++LYK   +NP AGC PILLQIP+FF++YKVI +++E+R AP++
Sbjct: 421 KEAAGD-DRQKMQQGMMELYKKEKVNPAAGCLPILLQIPIFFSLYKVIFVTIELRQAPWF 479

Query: 460 GWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSL------SMFIQMKMSPPPAD 513
           G  +DL+  DPT+I   FG LP+  P    +    +I  L      SM++Q K++P P D
Sbjct: 480 GPFRDLSMPDPTSIMNFFGWLPWAGPEAGSLTATILIGILPLLLGISMWLQQKLNPAPTD 539

Query: 514 KGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRST 573
             QAMI  WMP VF+F L SF +GL++YW  +N I+  QQ +IM+ HG +  +   ++S 
Sbjct: 540 PTQAMIFAWMPWVFMFMLGSFASGLVVYWIANNTITFTQQYIIMRSHGYKPDVFGNIKSG 599

Query: 574 FSKNYNSQ 581
           F++   + 
Sbjct: 600 FARRAKAD 607


>gi|149913108|ref|ZP_01901642.1| 60 kDa inner membrane insertion protein [Roseobacter sp. AzwK-3b]
 gi|149813514|gb|EDM73340.1| 60 kDa inner membrane insertion protein [Roseobacter sp. AzwK-3b]
          Length = 604

 Score =  434 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 211/603 (34%), Positives = 327/603 (54%), Gaps = 26/603 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDN-------SYA 54
           ++N N  +A ALS +++  W   +  P   + +       +    +           + A
Sbjct: 3   DQNKNLILATALSFVVILVWFVLFPPPEPPQQDATTPEAASQVDGSATAPLTATAPATGA 62

Query: 55  AVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPS 114
                        +PRV +  PSL GSI+LKG + D L+L+ Y   +   S  VTLLSP 
Sbjct: 63  TAGTPAPEAEEPEAPRVAISTPSLDGSISLKGGRIDQLSLKNYRETLEPGSDTVTLLSPI 122

Query: 115 NTKNAYFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTI 172
            T +AY+A   +          +P +NTVW + SG  L+P TP+ LV+ N   + F R I
Sbjct: 123 GTDSAYYALFGWAPGQGLTAETVPGANTVWKVESGDQLSPETPVTLVWDNQQGLTFRREI 182

Query: 173 SLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ 232
           S+D+ ++F +  +V N   D    +P G + RH        F +       + D  L E 
Sbjct: 183 SVDDKFMFTVTQSVENTGADTPSLAPYGILARHGEPVDLKNFFILHEGGIRMVDGQLSEI 242

Query: 233 KYSDIEKS--SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFS 290
            Y D E +    +     + W G +D YW +  IPS   +  + F+        YQ    
Sbjct: 243 DYDDFEPASNHETLTVNESGWTGFTDHYWMTTLIPSMAGAQVTTFQ--DTRRNIYQTTVR 300

Query: 291 ANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLM 350
            N  T+ PG+S T T  LFAGAKE+ TI +Y+ +  I RF   IDWGWF+F+ KP+F ++
Sbjct: 301 KNTETVAPGQSATVTTRLFAGAKEWETIRNYQNEDGIDRFLDSIDWGWFFFLTKPIFAVL 360

Query: 351 SYF------YNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK 404
            +         + G+ G AI+  T+ +K L  PLA K YVS A MK +QP++++++E   
Sbjct: 361 HWLNVTLAGMGIAGSMGWAIIGLTLLIKALLLPLAYKSYVSMAKMKELQPQMEKIKE-SA 419

Query: 405 QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKD 464
            +  Q LQK MI+LYK   +NP +GC PILLQIP+FF++YKVI ++LE+RHAP+ GWI D
Sbjct: 420 GNDRQKLQKEMIELYKKEKVNPASGCLPILLQIPIFFSLYKVIFVTLELRHAPWIGWIDD 479

Query: 465 LAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAM 518
           L+A DP++++ L+GILP+  P        + +GI P+++ +SM++Q K++P P D  Q M
Sbjct: 480 LSAPDPSSLYNLWGILPWAAPEPGSIIALIFIGILPLLLGISMWLQQKLNPAPTDPTQQM 539

Query: 519 ILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNY 578
           I  WMP VF+F L SF +GL++YW  +N+I+  QQ +IM+  G +  ++  + S+  +  
Sbjct: 540 IFAWMPWVFMFMLGSFASGLVVYWIANNMITFAQQYLIMRSQGYKPDVLGNILSSMKRKP 599

Query: 579 NSQ 581
            ++
Sbjct: 600 KTE 602


>gi|254450534|ref|ZP_05063971.1| 60 kD inner-membrane protein [Octadecabacter antarcticus 238]
 gi|198264940|gb|EDY89210.1| 60 kD inner-membrane protein [Octadecabacter antarcticus 238]
          Length = 593

 Score =  433 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 199/595 (33%), Positives = 320/595 (53%), Gaps = 21/595 (3%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQ-------TVKQPNQVDNSYA 54
           ++N N  +A ALS I++  W   +  P + E     +             Q  +     A
Sbjct: 3   DQNKNIILATALSFIVILTWFVLFPPPEVAEQAPTTEITTTDGTTLGVDAQIPEQVGEVA 62

Query: 55  AVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPS 114
            +        ++ +PR+ + + SL GS++L G + DDL+L+GY   +  ++ +V LLSP 
Sbjct: 63  VLAPLSAEDVIADAPRLVIDSESLTGSLSLTGGRIDDLSLKGYRETLKPDADLVRLLSPI 122

Query: 115 NTKNAYFAELDYVST--ANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTI 172
            T + Y+A   +V+   A   ++P ++T W + SG+ L+P + + LV+ N   + F +T 
Sbjct: 123 GTDSPYYALHGWVAAVGATADQVPGASTQWQIESGETLSPGSDVTLVWGNGAGLTFRKTF 182

Query: 173 SLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLV-- 230
           ++DE +LF +  TV N +  +I   P G + RH        F   EG + +         
Sbjct: 183 AVDEEFLFTVTQTVENTTGAEIALRPYGLVARHGEPDQIGFFIQHEGVVRMSDGSMEEIN 242

Query: 231 EQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFS 290
                D+           N W+G SD+YW +  IP+    F S  K+ +D    YQ +  
Sbjct: 243 YDDMPDLTTEESRIEVTENGWIGFSDQYWMTALIPTPGRDFRSTAKFAND---IYQIETV 299

Query: 291 ANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLM 350
              IT+ PG + +     FAGA+E+  I  Y+ DL I RF   IDWGWF+F+ KP+F ++
Sbjct: 300 YPMITVAPGATASADTQFFAGAQEWEVIRSYQNDLGIDRFLDSIDWGWFFFLTKPIFAML 359

Query: 351 SYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQV 410
            +   L+GN G +I+  T  +K L  PLA K YVS A M+ +QP++ +L+E       + 
Sbjct: 360 HWLNGLIGNMGWSIICLTFVIKALLLPLAYKSYVSMAKMRELQPEMAKLKEAAGDDREK- 418

Query: 411 LQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADP 470
           LQK M+ LYK + +NP +GC PIL+QIP+FF++YKVI +++E+RHAP+ GW+ DL+A D 
Sbjct: 419 LQKGMMSLYKENKVNPASGCLPILMQIPIFFSLYKVIFVTIELRHAPWIGWVNDLSAPDT 478

Query: 471 TNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMP 524
           + ++ LFG+LP+  P          +G+ PI++ +SM++Q K++P P D  Q MI  WMP
Sbjct: 479 STLYNLFGLLPWGAPEPDSILALAFIGVMPIVLGISMWLQQKLNPAPTDATQKMIFAWMP 538

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYN 579
            VF+F L  F +GL++YW  +N I+ +QQ  IM+  G +  L   +      +  
Sbjct: 539 WVFMFMLGGFASGLVLYWIANNSITFMQQYAIMRSQGFKPDLFGNITGRKKPDPE 593


>gi|300024925|ref|YP_003757536.1| membrane protein insertase, YidC/Oxa1 family [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526746|gb|ADJ25215.1| membrane protein insertase, YidC/Oxa1 family [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 624

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 243/603 (40%), Positives = 354/603 (58%), Gaps = 31/603 (5%)

Query: 3   RNWNYFVAIALSVIIVYAWQNFYVYPRIE-----------------------EMNNERKN 39
              N   A+ALS++++  WQ F+  P ++                         N     
Sbjct: 9   DQNNLMFAVALSILVLMGWQYFFARPELQNEHARQEFNKKIEAQNKDGSSETPPNVASTP 68

Query: 40  IQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHL 99
           +              A     R  AL  S R++++ PSL GSI+LKG + DDL L  Y  
Sbjct: 69  VAPPSTDAPTGAQAPATAPVSREAALQGSQRLKIETPSLEGSIDLKGGRLDDLVLMKYRE 128

Query: 100 DVSSNSPIVTLLSPSNTKNAYFAELDYVSTANN-IELPNSNTVWNLISGKILTPTTPIKL 158
            V  NS  V LLSPS +   YFAE  +V  + + +++P  +++W + SG  LTP TP+ L
Sbjct: 129 TVDPNSARVILLSPSGSPEPYFAEYGWVPQSGSAVKVPTRDSLWTVESGTRLTPETPVTL 188

Query: 159 VFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQE 218
           ++ N   ++F RT+S+D  Y+FKI D + N +  ++   P  R+ R     +   + + E
Sbjct: 189 MWDNGGGLVFHRTVSVDNDYMFKIKDEIENKTQAEVTLLPYARVHRSGHPPSQAFYVLHE 248

Query: 219 GFIAVLGDKSLVEQKYSDIEKSSISNFHESN--SWLGISDKYWASVFIPSKETSFHSQFK 276
           G + V GD  L E  ++D  KS +    ++    WLGI+DKYWA+  +P +   + + + 
Sbjct: 249 GLVGVSGDHGLQEFTFADALKSGVPTTFDNVTGGWLGITDKYWATALVPEQSEPYRAMYS 308

Query: 277 Y----LSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEM 332
                   G   +Q  +    +++  G        LFAGAK+   I  YE  L I RF+ 
Sbjct: 309 ALKARDPAGKDAFQTDYLRGALSVPAGLRKGVEGHLFAGAKQASLIDGYENALGILRFDR 368

Query: 333 LIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNI 392
           +IDWGWFYFI +P+F LM +   LV NFGI I++ TV VK  F+PLA KQY S A MK +
Sbjct: 369 MIDWGWFYFITRPLFRLMEFINGLVHNFGITILILTVLVKAAFYPLANKQYESMARMKKL 428

Query: 393 QPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLE 452
           QP++  ++E++K    Q  QK + +LY+T  INPLAGCWPILLQIPVFFA+YKV+ ++++
Sbjct: 429 QPEMQRIKEQYKD-DTQRQQKEIFELYRTQKINPLAGCWPILLQIPVFFALYKVLFVTID 487

Query: 453 MRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPA 512
           MRHAPF+GWI DL+A DPT++F LFG+LPF  P F+H+G+WP+IM ++M++QM+++PP  
Sbjct: 488 MRHAPFFGWIHDLSAPDPTSLFNLFGLLPFDSPTFLHIGVWPLIMGVTMWMQMQLNPPQP 547

Query: 513 DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRS 572
           D  Q  I  WMPVVF F L+SFPAGL+IYW+WSN +SI+QQ  I K +GAE+ L+D ++ 
Sbjct: 548 DPIQQQIFQWMPVVFTFMLASFPAGLVIYWAWSNTLSILQQVRINKKNGAEVHLLDNIKR 607

Query: 573 TFS 575
           TF 
Sbjct: 608 TFR 610


>gi|315122061|ref|YP_004062550.1| putative inner membrane protein translocase component YidC
           [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495463|gb|ADR52062.1| putative inner membrane protein translocase component YidC
           [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 578

 Score =  430 bits (1105), Expect = e-118,   Method: Composition-based stats.
 Identities = 442/581 (76%), Positives = 499/581 (85%), Gaps = 3/581 (0%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           ME+NWNYF AIA+SV IVY WQ  YV PRIE +   +K   T+++ +        V ID+
Sbjct: 1   MEKNWNYFAAIAISVAIVYVWQLVYVQPRIEAIKEGKKTPLTIEKQSI---QNTIVPIDN 57

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           RAQALS SPRVE+ +PSL GSINLKGAQFDDL+L+GY +DVS NSP+V LL+P NT+NAY
Sbjct: 58  RAQALSRSPRVEINSPSLAGSINLKGAQFDDLSLKGYRVDVSRNSPMVALLNPLNTENAY 117

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF 180
           FAEL+Y+ST N    PN NTVWNL+SG++LTP++PIKL FK+ANNILFER ISLDE+YLF
Sbjct: 118 FAELNYISTTNTTVFPNENTVWNLVSGQVLTPSSPIKLAFKSANNILFERIISLDENYLF 177

Query: 181 KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS 240
            IVDT+TNN  + I FSP G+I R+K Q  +N+FGVQEGFIAVLGD+SL+E+KYSDIEKS
Sbjct: 178 TIVDTITNNGTNLISFSPYGKITRYKLQKESNSFGVQEGFIAVLGDQSLIEKKYSDIEKS 237

Query: 241 SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGK 300
           S+SNFHESNSWLGISDKYWAS FIP KE SF S+F Y SDG ARYQA F  NEI + PGK
Sbjct: 238 SVSNFHESNSWLGISDKYWASAFIPPKEKSFQSRFDYFSDGRARYQANFKINEIILSPGK 297

Query: 301 SITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF 360
           S  TTN LF GAKE P I HYEK+L IPRFEMLIDWGWFYFIAKPMF LMSYFYNLVGNF
Sbjct: 298 STKTTNSLFVGAKELPIIQHYEKELEIPRFEMLIDWGWFYFIAKPMFALMSYFYNLVGNF 357

Query: 361 GIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYK 420
           GIAIMLTT+FVK LFFPLAKKQYVSTANMKNIQPKID LREKFKQ+ PQVLQK M+QLYK
Sbjct: 358 GIAIMLTTIFVKALFFPLAKKQYVSTANMKNIQPKIDALREKFKQASPQVLQKEMLQLYK 417

Query: 421 THNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL 480
           TH INPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF+GWI+DLAA DPTNIFTLFGIL
Sbjct: 418 THKINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFFGWIQDLAAPDPTNIFTLFGIL 477

Query: 481 PFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLII 540
           PF LP F+HVGIWPIIMSLSMF+Q+KMSPPP DKGQA++LNWMPVVFVFALSSFPAGLII
Sbjct: 478 PFQLPEFIHVGIWPIIMSLSMFLQLKMSPPPTDKGQAIVLNWMPVVFVFALSSFPAGLII 537

Query: 541 YWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ 581
           YWSWSN+ISI+QQ VIMKM+GA+I +IDRLRS F+K+ NS+
Sbjct: 538 YWSWSNIISIIQQTVIMKMYGAKIDIIDRLRSMFAKSSNSK 578


>gi|288957364|ref|YP_003447705.1| preprotein translocase YidC subunit [Azospirillum sp. B510]
 gi|288909672|dbj|BAI71161.1| preprotein translocase YidC subunit [Azospirillum sp. B510]
          Length = 577

 Score =  430 bits (1104), Expect = e-118,   Method: Composition-based stats.
 Identities = 216/579 (37%), Positives = 324/579 (55%), Gaps = 19/579 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIE---------------EMNNERKNIQTVKQ 45
           M    N  +AIALS+ I+  +Q FY  PR+E                +      +     
Sbjct: 1   MTDQRNLIIAIALSIAILLGFQYFYEKPRVEQQKQLAAQQAAQTEQSVPVPAPGVPAQLP 60

Query: 46  PNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNS 105
                   A       A+ ++   RV++  P+L GS+NL G + DDL L  YH      S
Sbjct: 61  SGMSTAEVAKERPVLLAEQMAAGTRVKIDTPALHGSVNLVGGRIDDLTLAQYHETPDPKS 120

Query: 106 PIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANN 165
           P + LL+P+ T  AY+AE  +V     +  P + T W    G  LTP  P+ L + N   
Sbjct: 121 PEIVLLAPAGTPAAYYAEFGWVPQGAGVATPTATTRWT-ADGAALTPEKPLTLSWDNGQG 179

Query: 166 ILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLG 225
           ++FER I++D  ++F +  TV N     +   P   + R      +  + + EG + V  
Sbjct: 180 LVFERKIAVDPDFMFTVTQTVRNTGAAPVTLLPYSLVSRSGTPHTSGYYILHEGPLGVFN 239

Query: 226 DKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLS-DGHAR 284
             SL E+KY D+ K+       +  W+GI+DKYW    +P       ++F Y       R
Sbjct: 240 -GSLTEEKYDDVRKAGSIAKDTTGGWIGITDKYWLVSLVPDPSEKVTARFLYNQVANADR 298

Query: 285 YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAK 344
           YQ       +T+ PG S   T  LFAGAK+   +  Y + L I  F++ ID+GWFYF+ K
Sbjct: 299 YQTDTMGAPVTVAPGASAENTGRLFAGAKQVKLLDGYSEKLNIKNFDLAIDFGWFYFLTK 358

Query: 345 PMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK 404
           P F  + +   ++GNFGIAI++ TV VK +FFPLA K Y + + MK +QPK+ ELREKF 
Sbjct: 359 PFFYALDFLGRIIGNFGIAILVLTVCVKAVFFPLANKSYQAMSKMKALQPKMQELREKFS 418

Query: 405 QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKD 464
                 + + ++ LYK   ++P++GC PI++QIPVFF++YKV+ +++EMRHAPF+GWI D
Sbjct: 419 D-DQARMNQELMALYKREKVSPVSGCLPIVIQIPVFFSLYKVLFVTIEMRHAPFFGWIHD 477

Query: 465 LAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMP 524
           L++ DPT IF LFG++P+  P  +H+G+WP+IM ++M+ Q KM+P P D  QA +  ++P
Sbjct: 478 LSSPDPTTIFNLFGLIPWDPPAMLHLGLWPLIMGVTMWFQQKMNPAPPDPVQAKVFQFLP 537

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           +VF F L+ FPAGL+IYW+W+N +S++QQ  IMK  G +
Sbjct: 538 IVFTFMLAGFPAGLVIYWAWNNTLSVLQQWTIMKRMGVK 576


>gi|315498839|ref|YP_004087643.1| membrane protein insertase, yidc/oxa1 family [Asticcacaulis
           excentricus CB 48]
 gi|315416851|gb|ADU13492.1| membrane protein insertase, YidC/Oxa1 family [Asticcacaulis
           excentricus CB 48]
          Length = 658

 Score =  429 bits (1103), Expect = e-118,   Method: Composition-based stats.
 Identities = 216/610 (35%), Positives = 349/610 (57%), Gaps = 32/610 (5%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNE---RKNIQTVKQPNQVDNSYAAVLI 58
           + N N F+ +ALS+ I++ +Q F   P++E+       +K I+  K P     S      
Sbjct: 4   DDNRNMFIFLALSMAILFGYQFFVAGPQMEKERAAAMAQKKIEAAKSPVATPESLFVEGK 63

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
             R QA++ +PRV + +P+L GS++L GA+ DDL L+ Y   + ++SP V L  P   ++
Sbjct: 64  LPRDQAVAATPRVAIDSPALKGSLSLAGARIDDLFLKQYKETLKADSPNVELFRPQGAEH 123

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHY 178
           AY+AE  +V  AN   LP+ N+VW ++SG +L+P   + L +     + FER +SLD+ Y
Sbjct: 124 AYYAESGWVG-ANVPGLPSGNSVWTVVSGSVLSPGKDVVLGYDAGTGLRFERRLSLDDKY 182

Query: 179 LFKIVDTVTNNSIDQIRFSPRGRIMRHK-PQTATNTFGVQEGFIAVLGD------KSLVE 231
           +  + DTV N +   +  +P   ++R   P+T      + EG I            +  E
Sbjct: 183 MITVTDTVVNTTGAAVTLAPYANVVRQGAPETLGKNMILHEGGIGAFSKDATGKGYTTPE 242

Query: 232 QKYSDIEKSSISNFHE---SNSWLGISDKYWASVFIPSKETSFHSQFKYLS-------DG 281
            K+ + EK       +   +  W+G++DKYW +  IP ++   H+  K          D 
Sbjct: 243 FKFHNWEKDEKKANFKADSTGGWMGLTDKYWLAAVIPDQKAKIHASMKATDQTTANEKDF 302

Query: 282 HARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYF 341
           +  YQA + A+ +T+ PGK ++ T  +FAGAK+   +  Y+  L +P F+  IDWG F+F
Sbjct: 303 NFLYQAGYVADAVTVQPGKPVSVTYHIFAGAKQASLLAAYQDKLKLPAFDKAIDWGMFWF 362

Query: 342 IAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELRE 401
             +PMF ++ + +  VGNFG+AI+  TV VKL+FFPLA K Y S   MK +QP+++EL++
Sbjct: 363 FTRPMFFVLDFLFKYVGNFGLAILGLTVLVKLIFFPLAHKSYESMTKMKMLQPQVEELKK 422

Query: 402 KFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGW 461
           K + +P Q+    M+ LY+   +NP++GC PI +Q+PVF+A+YKV+ +++EMRHAPF+GW
Sbjct: 423 KHEGNPQQMQI-EMMGLYQKEKVNPMSGCLPIFVQMPVFYALYKVLFVTIEMRHAPFFGW 481

Query: 462 IKDLAAADPTNIFTLFGILPFYLPGF----------MHVGIWPIIMSLSMFIQMKMSPPP 511
           I+DL+  DPT +F LFG+LP+               +H+GI P++   SM++   M+PP 
Sbjct: 482 IQDLSDKDPTTMFNLFGLLPYDPAALPVIGGLMATSLHIGILPLLYGASMWLSQSMNPPM 541

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLR 571
            D  Q  I  +MPV+F F ++ F +GL+IYW W+NV+++ QQ ++M+  G E  +   L 
Sbjct: 542 PDPMQRKIFAFMPVMFTFIMAPFASGLLIYWIWNNVLTVAQQYMLMRQMGVENPIDTLLG 601

Query: 572 STFSKNYNSQ 581
                   S+
Sbjct: 602 KVAKTKPKSE 611


>gi|323137577|ref|ZP_08072654.1| membrane protein insertase, YidC/Oxa1 family [Methylocystis sp.
           ATCC 49242]
 gi|322397203|gb|EFX99727.1| membrane protein insertase, YidC/Oxa1 family [Methylocystis sp.
           ATCC 49242]
          Length = 591

 Score =  429 bits (1102), Expect = e-118,   Method: Composition-based stats.
 Identities = 237/591 (40%), Positives = 345/591 (58%), Gaps = 17/591 (2%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLID-- 59
           E   N  +A ALS+I +  W  FY +P +++        + + +  ++     A      
Sbjct: 3   ENTKNMLLAAALSLIFIGLWDYFYAFPEMDKQKKALSEQERMAKIPKLGAPEKAAAAAKP 62

Query: 60  ---DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNT 116
               R  AL++SPRV +   S+ GSI LKGA+ DD++L+ YH  V   SPI+TLLSP   
Sbjct: 63  VVRSREAALALSPRVAIDTKSISGSIALKGARVDDVSLKNYHQTVDPRSPIITLLSPEEG 122

Query: 117 KNAYFAELDYVST-ANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD 175
              Y+AEL Y+S    N  +  +           LT + P+ L + N   ++F+R IS+D
Sbjct: 123 PEPYYAELGYLSAETENAPVLPNTETLWTADADKLTTSQPVTLSWDNGQGLVFKRVISID 182

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
           + YL  + D+V N     +      R+ R     +     + EGF+ V+GD    E  Y 
Sbjct: 183 DEYLLTVKDSVENKGGKPVTLYSYSRVSRVGHPPSAGYAALHEGFVGVIGDTG-QELTYD 241

Query: 236 DIEKSSI--SNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR-YQAKFSAN 292
            IEK       F     W+G +DKYW +V  P +     +++  +  G  + YQA   + 
Sbjct: 242 KIEKEPNATKTFKGVGGWVGFTDKYWGAVVAPDQNAPMEARYMLMGGGPVKTYQADTVSE 301

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
             T+ P  S  TT ++FAGAKE  T+  Y+ +  + RF++LIDWGWFYFI +PMF L+ +
Sbjct: 302 PKTLEPNASTATTTYVFAGAKEVDTLDAYKANPGLKRFDLLIDWGWFYFITRPMFRLIDF 361

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
            Y ++GNFG+AI+  TV VK  F PLA K Y S A MK IQPKI EL+EK+     +   
Sbjct: 362 LYRVLGNFGLAILAVTVIVKAAFLPLANKSYKSIAKMKEIQPKIKELKEKYGDDKHK-FN 420

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
              ++LYK   +NP +GC P+LLQIPVFF++YKV+ +++EMRHAPF+GWIKDL+A DPTN
Sbjct: 421 MEQMELYKREKVNPASGCLPVLLQIPVFFSLYKVLVVTIEMRHAPFFGWIKDLSAPDPTN 480

Query: 473 IFTLFGILPFYLPG------FMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVV 526
           +F LFG++P+          ++ +G+WP++M ++M++QMKM+P P D+ Q  +  WMPV+
Sbjct: 481 VFNLFGLIPWDPTHVAIFGPYLALGVWPLVMGVTMWLQMKMNPEPTDEIQKTMFAWMPVM 540

Query: 527 FVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           F F + SF +GLIIYWSW+N++SIVQQ VIMK  G +  L D LR TFS+ 
Sbjct: 541 FTFTMGSFASGLIIYWSWNNLLSIVQQGVIMKRAGVKFELWDNLRKTFSRA 591


>gi|40062654|gb|AAR37575.1| inner membrane protein, 60 kDa [uncultured marine bacterium 313]
          Length = 560

 Score =  428 bits (1100), Expect = e-117,   Method: Composition-based stats.
 Identities = 206/565 (36%), Positives = 327/565 (57%), Gaps = 8/565 (1%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  +AI LS +++  W  F+  P +E    E +  ++ +  +            +
Sbjct: 1   MDF-KNVLIAIVLSTLVLVFWATFFEPPPVERQIVEDQITKSEEPSSPSIEKVELSKKIE 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           R  A+    RV+++N ++ GSI+L+GA  DD+  + Y   + S+   V  L+P ++   Y
Sbjct: 60  RNDAIDSVARVKIENNNIKGSISLQGAIIDDIIFKNYKESLESDQK-VIFLNPKSSDEGY 118

Query: 121 FAELDYVSTAN-NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYL 179
           + E  + S +N  ++LP  NT+W +   K+LTP  PI L + N   ++F + I LD+ YL
Sbjct: 119 YIETGWASNSNEKLKLPLDNTIWKVKGNKVLTPNNPIVLEWDNNEGLIFTKKIELDDKYL 178

Query: 180 FKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEK 239
           FKI   + N S     F P  +I R+        + + EGFI +  D  L E+ Y D+E 
Sbjct: 179 FKISQGIKNTSNKSYEFFPYAQITRNYKPDVIPIYILHEGFIGMFDD-ELKEEDYKDVED 237

Query: 240 SSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPG 299
                 + S  WLGI+DKYW +  +P K   F S+F  +   +             +   
Sbjct: 238 EKFI-INSSKGWLGITDKYWLTAIVPEKGKKFKSEFLSIDGKYKANFI--IKEPTVLSSN 294

Query: 300 KSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGN 359
            SIT     F  AKE   I  Y + L+I +F++ IDWGWFYFI KP+F ++ YF+ L GN
Sbjct: 295 ASITNEINAFVMAKEVAVIDGYAERLSIEKFDLTIDWGWFYFITKPLFFVIEYFFKLTGN 354

Query: 360 FGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLY 419
           FG+AI++ T  V+++FFPL+   + S A MK +QP++  L+E  K    + LQ+ M+ LY
Sbjct: 355 FGVAIIILTALVRIVFFPLSNYSFRSMAKMKILQPEMIRLKELHKDDKTK-LQQEMMALY 413

Query: 420 KTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGI 479
           K   +NP++GC P+L+QIP FFA+YK++ +++EMR  PF+GWI+DL+A DPT+IF LFG+
Sbjct: 414 KREKVNPISGCLPVLIQIPFFFAVYKMLYVTIEMRQQPFFGWIQDLSARDPTSIFNLFGL 473

Query: 480 LPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLI 539
           +P+  P F+ +G+WPI+M L+MF+Q K++P P D  QA I  ++P+     L+ FP+GL+
Sbjct: 474 IPWDPPTFLMIGVWPILMGLTMFLQQKLNPTPPDPMQAKIFMFLPIFLTIILAPFPSGLV 533

Query: 540 IYWSWSNVISIVQQAVIMKMHGAEI 564
           +YW+ SNV+++ QQ VI++    + 
Sbjct: 534 VYWTISNVLTMAQQWVIIRGTKVKT 558


>gi|114327390|ref|YP_744547.1| 60 kDa inner membrane protein YIDC [Granulibacter bethesdensis
           CGDNIH1]
 gi|122327634|sp|Q0BU78|OXAA_GRABC RecName: Full=Inner membrane protein oxaA
 gi|114315564|gb|ABI61624.1| 60 kDa inner membrane protein YIDC [Granulibacter bethesdensis
           CGDNIH1]
          Length = 578

 Score =  428 bits (1099), Expect = e-117,   Method: Composition-based stats.
 Identities = 212/581 (36%), Positives = 315/581 (54%), Gaps = 15/581 (2%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVK-QPNQVDNSYAAVLIDD 60
                 F+AIA+S+ I+  +Q  Y +   E     R      + +PN    +        
Sbjct: 1   MDQKRLFLAIAISLGILLGFQGLYRHFVPEPPAAARTATNAGQGKPNNTLGAVPTDATAS 60

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           ++       R+ +  P + GSI+L GA+FDDL LR YH  V  NSP+V LL+P +    Y
Sbjct: 61  QSPPPKEGARLAVDAPRVKGSISLVGARFDDLVLRDYHETVDKNSPLVRLLAPLSGDEPY 120

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF 180
           + E  +V   + I  P  +T W       LTP  P+ L + N   + F   +++D  Y+F
Sbjct: 121 YVEYGWVPEESGIATPGRDTEWK-ADAATLTPNKPVTLSWDNGAGLTFMLKVAVDADYMF 179

Query: 181 KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS 240
            +  +V N +   +   P  R+ R           + EG I V+    L E  Y   +  
Sbjct: 180 SVTQSVRNTTGKPVVLHPYARVRRDYRPEVEGYTVLHEGLIGVVDGI-LHEITYKSADSD 238

Query: 241 SISN------FHESNSWLGISDKYWASVFIPSKETSFHSQFK-YLSDGHARYQAKFSANE 293
              N         +  W GI+DKYW +  IP + TS    F+    +G   YQ    ++ 
Sbjct: 239 GAKNNGLAFEHASTGGWAGITDKYWLTALIPDQITSVDFSFRDTKPNGRDGYQVGIISHN 298

Query: 294 ITI-LPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
                 G    +T  LFAGAK    + HY+ +  IP F   +D+GWF+FI +P F  + +
Sbjct: 299 PDQVAAGAESASTTHLFAGAKVVSLLDHYQAEYHIPSFWEAVDFGWFWFITRPFFYALDW 358

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
            Y+LVGNFG+AI++ TV VK  F+PLA K Y S + M+ + PKI  LRE++K   P  +Q
Sbjct: 359 LYHLVGNFGVAILIFTVLVKAAFYPLASKSYRSMSKMRLLAPKIQSLRERYKD-DPTRMQ 417

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           + ++QLYK    NP +GC P+LLQ P+FF++YKVI +++EMRHAPF+GWI DL+A DPTN
Sbjct: 418 QEVMQLYKAEGANPASGCLPMLLQFPIFFSLYKVIFVTIEMRHAPFFGWIHDLSAVDPTN 477

Query: 473 IFTLFGILPFYL---PGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVF 529
           +F LFG+LPF       F+H+GIWP+IM  +M++Q KM+PP  D  QA +  +MP++F F
Sbjct: 478 LFNLFGLLPFDPTHISPFLHLGIWPLIMGGTMYLQQKMNPPMPDPVQARMFQFMPIIFTF 537

Query: 530 ALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL 570
            L+ FP GL+IYWSW+N++SI QQ +I +        + ++
Sbjct: 538 MLARFPVGLVIYWSWNNLLSIGQQWLIQRRTKLPRPELAKV 578


>gi|163868925|ref|YP_001610152.1| putative inner membrane protein translocase component YidC
           [Bartonella tribocorum CIP 105476]
 gi|161018599|emb|CAK02157.1| translocase precursor subunit [Bartonella tribocorum CIP 105476]
          Length = 620

 Score =  427 bits (1097), Expect = e-117,   Method: Composition-based stats.
 Identities = 252/612 (41%), Positives = 366/612 (59%), Gaps = 32/612 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEE--------------------MNNERKNI 40
           ME N N+F+AI LS +++ AWQ  +V P+  +                     +      
Sbjct: 1   MEYNRNFFIAIGLSFLVLIAWQFLHVAPKQAKLQNQQAITQQQQLSKQQSPLSSATVNFS 60

Query: 41  QTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLD 100
                          +  + R   L+ + R+ +K   L GSINL GAQFDDL+L+ Y + 
Sbjct: 61  DDTSTHPSTSIIEQPMTPEVRKAVLAKTERIAIKTNELEGSINLVGAQFDDLHLKKYRVT 120

Query: 101 VSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIE-LPNSNTVWNLISGKIL-TPTTPIKL 158
           V   SP + LL+P   K  Y AE  + S +   + LP  +T W +       TP+TPI L
Sbjct: 121 VDKKSPEIDLLNPKGFKTTYLAEFGFASASLPAKALPQPDTQWQIEGNNTTLTPSTPITL 180

Query: 159 VFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQE 218
           ++ N    +F RT+ +D++Y+F I D+++N S   I  S   R+ R  P   TN   +  
Sbjct: 181 IYNNGQGQIFRRTLFVDDYYMFTIEDSISNESDQPIYLSSYARVARAAPPEHTNATYLLH 240

Query: 219 GFIAVLGDKSLVEQKY---------SDIEKSSISNFHESNSWLGISDKYWASVFIPSKET 269
             +  +   SL  +KY          D  + S++    +  W+GI+DKYWA   IP ++ 
Sbjct: 241 EGMIGIAGDSLKTEKYKTLAELDPNPDNGQKSMTFSKVTGGWIGITDKYWAVAVIPQQDK 300

Query: 270 SFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPR 329
            + S+F Y       YQ+    + +TI P ++ T TN LFAGAK+   I+HY+ +L I +
Sbjct: 301 EYTSRFIYFDRLQTHYQSDLLGSLLTIAPNETKTVTNHLFAGAKQVEIINHYQNNLKINK 360

Query: 330 FEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANM 389
           F +LIDWGWF FI KPMF L+   Y   GNFGIAI+L TV +K+L FPLA K Y S A M
Sbjct: 361 FALLIDWGWFDFITKPMFALIDILYKQTGNFGIAILLVTVLLKILLFPLANKSYQSMARM 420

Query: 390 KNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISI 449
           K +QP++ E++EK+     +  Q+A+I+LYKT  INPLAGCWP+L+Q P+FFA+YKV+ I
Sbjct: 421 KLLQPRLLEIKEKYPDDKNK-QQQAIIELYKTEKINPLAGCWPMLVQFPIFFALYKVLYI 479

Query: 450 SLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSP 509
           ++EMRHAPF+GWI+DLAA DPT++F LFG+LP+  P F+ +G WP+IM ++MF+QM+M+P
Sbjct: 480 TIEMRHAPFFGWIQDLAAPDPTSLFNLFGLLPYTTPAFLMIGAWPLIMGITMFLQMRMNP 539

Query: 510 PPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDR 569
            P D+ QAMI  WMPVVF F L+SFP GL+IYW+W+N++SI+QQ ++MK  GA+I L D 
Sbjct: 540 APQDQTQAMIFTWMPVVFTFMLASFPVGLVIYWAWNNILSIIQQGIMMKRQGAKIELFDN 599

Query: 570 LRSTFSKNYNSQ 581
           L++ + K+   +
Sbjct: 600 LKTMWKKSPKKE 611


>gi|296444656|ref|ZP_06886620.1| membrane protein insertase, YidC/Oxa1 family [Methylosinus
           trichosporium OB3b]
 gi|296257924|gb|EFH04987.1| membrane protein insertase, YidC/Oxa1 family [Methylosinus
           trichosporium OB3b]
          Length = 610

 Score =  427 bits (1096), Expect = e-117,   Method: Composition-based stats.
 Identities = 234/613 (38%), Positives = 346/613 (56%), Gaps = 37/613 (6%)

Query: 1   MER-NWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAA---- 55
           M     N  +A  LS++ + AW  FY +P++E+    +          Q   +       
Sbjct: 1   MNEYTKNVIIAAGLSMLFIGAWDYFYAFPKLEQERQTQAEQIKKTAQAQAPAARKPAAPE 60

Query: 56  -------------------VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRG 96
                               +   R  AL+ SPR+ +  PS+ GSI L G + DD++L+ 
Sbjct: 61  TKQAQAPTATQQQPAAAQKPVKKTREAALAESPRIAIDTPSIAGSIALVGGRIDDVSLKN 120

Query: 97  YHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPI 156
           YH  V   SPI+ LLSP N  + Y+AE  +   A +  LPN+ T+W       L+   P+
Sbjct: 121 YHETVDPKSPIIVLLSPENGPDPYYAETGF-LAAGDAALPNAQTLWT-ADRTTLSAAQPV 178

Query: 157 KLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGV 216
            L + N   ++F+R I++D+ Y+F + D+V N++   +      R+ R           +
Sbjct: 179 TLSYDNGQGLVFKRKIAVDDRYMFTVADSVENHADKPVTLYSYMRVARVGIPAGAGYAAL 238

Query: 217 QEGFIAVLGDKSLVEQKYSDIEKSSISNFHESN--SWLGISDKYWASVFIPSKETSFHSQ 274
            EGFI V+G+  + E KY  +EK   +    S    WLG ++KYWA+V +P ++  F ++
Sbjct: 239 HEGFIGVIGESGVQEMKYEKVEKEPHATKTLSGTGGWLGFTEKYWAAVAVPQQDKPFEAR 298

Query: 275 FKYLSDGHAR-YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEML 333
           F     G  + YQA      +TI PG S  T+  +FAGAK    +  Y+    I  F++L
Sbjct: 299 FSATGAGTVKAYQADTVGAPLTIQPGASGETSQRIFAGAKVVDMLDAYQAQ-GIEHFDLL 357

Query: 334 IDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQ 393
           IDWGWFYF+ +PMF L+   ++++GNFG+AI+  TV VK+ F PLA K Y + A MK +Q
Sbjct: 358 IDWGWFYFLTRPMFRLIDNLFHVLGNFGLAILAVTVLVKIAFLPLANKSYQAVAKMKEVQ 417

Query: 394 PKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEM 453
           PKI  L+EK+     Q L +  + L+K   INP  GC P+LLQIPVFF++YKV+ I++EM
Sbjct: 418 PKIQALKEKYGDDK-QTLSREQMALFKREKINPAGGCLPMLLQIPVFFSLYKVLVITIEM 476

Query: 454 RHAPFWGWIKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKM 507
           RHAPF+GWIKDL+A DPTNIF LFG++PF          F+ +G+WPIIM  +M++QMKM
Sbjct: 477 RHAPFYGWIKDLSAPDPTNIFNLFGLIPFDPTQIPLFGSFLWLGVWPIIMGFTMWMQMKM 536

Query: 508 SPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLI 567
           +P P D+ Q +   WMPV+F F+L SF +GL+IYWSW+N++S+ QQ  IM+  G +  L 
Sbjct: 537 NPEPTDEIQRIAFAWMPVIFTFSLGSFASGLVIYWSWNNILSVTQQWYIMRRAGVKFELW 596

Query: 568 DRLRSTFSKNYNS 580
           D L+ TF     +
Sbjct: 597 DNLKKTFDFKKKA 609


>gi|49475954|ref|YP_033995.1| putative inner membrane protein translocase component YidC
           [Bartonella henselae str. Houston-1]
 gi|49238762|emb|CAF28023.1| hypothetical protein BH12410 [Bartonella henselae str. Houston-1]
          Length = 612

 Score =  424 bits (1090), Expect = e-116,   Method: Composition-based stats.
 Identities = 259/610 (42%), Positives = 370/610 (60%), Gaps = 30/610 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           ME N N+F+AI LS  ++ AW  FYV P+  E+  ++   Q + +     +S  A   D 
Sbjct: 1   MEYNRNFFIAIGLSFGVLIAWHFFYVAPKQTELQQKQLIAQQLLKQQSAVSSPTANFSDS 60

Query: 61  ------------------RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVS 102
                             R   L+ + RV +K   L GSINL GAQFDDL L+ Y L V 
Sbjct: 61  ASTHESALIINHPMSPEIRDAELAKTNRVAIKTNELEGSINLVGAQFDDLLLKKYRLTVD 120

Query: 103 SNSPIVTLLSPSNTKNAYFAELDYVSTA-NNIELPNSNTVWNLISGKIL-TPTTPIKLVF 160
             S  + LL+P   K  Y AE  + S++ +   LP S+T W++       TP+TP+ L++
Sbjct: 121 KKSSEIALLNPKGFKETYLAEFGFTSSSLSKDALPQSDTRWHIEGNNTTLTPSTPVTLIY 180

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGF 220
            N     F R +S+D+HY+F I D++TN S   I  S   R+ R  P   TN   +    
Sbjct: 181 NNGQGQTFRRILSIDDHYMFTIEDSITNESDKPIYLSSYARVARAAPPEHTNATYLLHEG 240

Query: 221 IAVLGDKSLVEQKY---------SDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSF 271
           +  +   SL  +KY          D  + S++       W+GI+DKYWA   IP ++  +
Sbjct: 241 MIGIAGDSLKTEKYKTLAELNPNPDNGQKSMTFSKVIGGWVGITDKYWAVAVIPPQDKEY 300

Query: 272 HSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFE 331
            S+F Y       YQ+    + +T+ P ++ T TN LFAGAK+   I+HY+ DL I +F 
Sbjct: 301 TSRFIYFDRLQTHYQSDLLGSLLTVAPNETKTITNRLFAGAKQVEIINHYQNDLKIKKFA 360

Query: 332 MLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKN 391
           +LIDWGWF FI KPMF L+   Y   GNFGIAI+L TV +K L FPLA K Y S A MK 
Sbjct: 361 LLIDWGWFDFITKPMFSLIDILYKQTGNFGIAILLVTVLLKTLLFPLANKSYKSMARMKL 420

Query: 392 IQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISL 451
           IQP + E++EK+ +   +  Q+A+I+LYKT  INPLAGCWP+L+Q P+FFA+YKV+ I++
Sbjct: 421 IQPMLLEIKEKYPEDRTK-QQQAIIELYKTQKINPLAGCWPMLVQFPIFFALYKVLYITI 479

Query: 452 EMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP 511
           EMRHAPF+GWI+DLAA DPT++F LFG+LP+ +P F+ +G WP+IM ++MF+QM+M+P P
Sbjct: 480 EMRHAPFFGWIQDLAAPDPTSLFNLFGLLPYTVPAFLMLGAWPLIMGITMFLQMRMNPAP 539

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLR 571
            D+ QAMI  WMP+VF F L+SFP GL+IYW+W+N++S++QQ ++MK  G +I L D L+
Sbjct: 540 QDQTQAMIFAWMPIVFTFMLASFPVGLVIYWAWNNILSMIQQGIMMKRQGVKIELFDNLK 599

Query: 572 STFSKNYNSQ 581
           + + K+   +
Sbjct: 600 AMWRKSPKKE 609


>gi|254477563|ref|ZP_05090949.1| 60 kDa inner membrane insertion protein [Ruegeria sp. R11]
 gi|214031806|gb|EEB72641.1| 60 kDa inner membrane insertion protein [Ruegeria sp. R11]
          Length = 604

 Score =  423 bits (1086), Expect = e-116,   Method: Composition-based stats.
 Identities = 219/604 (36%), Positives = 334/604 (55%), Gaps = 27/604 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVY-------PRIEEMNNERKNIQTVKQPNQVDNSYA 54
           ++N N  +A ALS +++  W  F+                    +  +     Q     A
Sbjct: 3   DQNKNLLLATALSFLVILGWYIFFPPPEPAPQPDAEIAQTAPAGDGVSAPSAAQAIAGDA 62

Query: 55  AVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPS 114
           A      A+  + +PRV +    + G+I+L+G + DDL L+ Y + +  +SPIV +LSP+
Sbjct: 63  AAAGAAEAETAADAPRVAIDTARVTGTISLQGGRLDDLALKDYRVSLEPDSPIVKMLSPA 122

Query: 115 NTKNAYFAELDYVSTANN--IELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTI 172
            + NAY+A   +   A     ++P +NT+W+L  G+ LTP TP+ L ++N   + F RTI
Sbjct: 123 GSPNAYYALYGWAPGAGLGIDDVPGANTLWSLHEGETLTPETPVTLSWRNGKGLTFFRTI 182

Query: 173 SLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ 232
           S+DE+Y+F++V +V N     +  +P G I RH        F +    +  + D +L E 
Sbjct: 183 SIDENYMFQVVQSVMNEGAGTVSLAPYGTIARHGMPQDLKNFFILHEGVVGMADGTLAEI 242

Query: 233 KYSDIEKSSIS---------NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
            Y D+    +             E N W+G +D YW S  +P    SF S  K+  +   
Sbjct: 243 DYDDMADFDLDARSGARSEITQVEGNGWIGFTDHYWMSTLVPEPGQSFRSIAKF-DERRE 301

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
            YQ       +T+  G+    T  LFAGAKE+ TI  Y+KD  I  F   IDWGWF+F+ 
Sbjct: 302 IYQTDVVLPTVTLANGEGTEVTTELFAGAKEWATIRGYQKD-GIEGFLDSIDWGWFFFLT 360

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           KP+F ++ +   L+GN G AI+  TV +K+L FPLA K Y S A MK +QP++++++EK 
Sbjct: 361 KPIFAVLHWLNALIGNMGWAIIGLTVLIKILVFPLAYKSYASMAKMKELQPEMEKIKEKA 420

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
                Q LQ+ M+ LYK   +NP AGC PIL+QIP+FF++YKVI ++LE+RHAPF+G  +
Sbjct: 421 GD-DRQKLQQEMMALYKKEKVNPAAGCLPILIQIPIFFSLYKVIFVTLELRHAPFFGPFQ 479

Query: 464 DLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSL------SMFIQMKMSPPPADKGQA 517
           DL+A DPT+I  LFG+LPF  P    +    +I  L      SM++Q K++P P D  Q 
Sbjct: 480 DLSAPDPTSIMNLFGLLPFTGPEPGSILATVLIGILPLLLGISMWLQQKLNPAPTDPTQQ 539

Query: 518 MILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           MI  WMP VF+F L  F +GL++YW  +N I+  QQ +IM+ HG +  +   ++S+F K+
Sbjct: 540 MIFAWMPWVFMFMLGGFASGLVVYWIANNTITFTQQYLIMRSHGYKPDVFGNIKSSFKKS 599

Query: 578 YNSQ 581
             ++
Sbjct: 600 PKAE 603


>gi|297182643|gb|ADI18801.1| preprotein translocase subunit yidc [uncultured SAR11 cluster
           bacterium HF4000_37C10]
          Length = 560

 Score =  422 bits (1083), Expect = e-115,   Method: Composition-based stats.
 Identities = 199/564 (35%), Positives = 321/564 (56%), Gaps = 7/564 (1%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
             + N  +AI LS +++  W  F+  P +E    E +  ++ +  +             R
Sbjct: 1   MDSKNVLMAIVLSTLVLVFWATFFEPPPVERQIAEDQVTKSEELSSPSIEKVELSKKIAR 60

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
              +    RV+++N ++ GSI+L+GA  DD+  + Y   + S+   V  L+P ++   Y+
Sbjct: 61  DDTIDSVARVKIENNNIKGSISLQGAIIDDIIFKNYKESLESDQK-VIFLNPKSSDEGYY 119

Query: 122 AELDYVSTAN-NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF 180
            E  + S +N  ++LP  NT+W +   K+LTP  PI L + N   ++F + I LD+ YLF
Sbjct: 120 IETGWASNSNEKLKLPLDNTIWKVKGNKVLTPNKPIVLEWDNNEGLIFTKKIELDDKYLF 179

Query: 181 KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS 240
           KI   + N S     F P  +I R+        + + EGFI +      ++++  +  + 
Sbjct: 180 KISQGIKNTSNKSYEFFPYAQITRNYKPDVIPIYILHEGFIGMFD--DELKEEDYEDVED 237

Query: 241 SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGK 300
                + S  WLGI+DKYW +  +P K   F S+F  +   +             +    
Sbjct: 238 EKFIINSSKGWLGITDKYWLTAIVPEKGKKFKSEFLSIDGKYKANFI--IKEATVLSSNA 295

Query: 301 SITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF 360
           SIT     F  AKE   I  Y + L I +F++ IDWGWFYFI KP+F ++ YF+ L GNF
Sbjct: 296 SITNEINAFVMAKEVAVIDDYAEKLGIEKFDLTIDWGWFYFITKPLFFVIEYFFKLTGNF 355

Query: 361 GIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYK 420
           G+AI++ T  V+++FFPLA   + S A MK +QP++  L+E  K    + LQ+ M+ LYK
Sbjct: 356 GVAIIILTALVRIVFFPLANYSFRSMAKMKILQPEMIRLKELHKDDKTK-LQQEMMALYK 414

Query: 421 THNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL 480
              +NP++GC P+L+QIP FFA+YK++ +++EMR  PF+GWI+DL+A DPT+IF LFG++
Sbjct: 415 REKVNPVSGCLPVLIQIPFFFAVYKMLYVTIEMRQQPFFGWIQDLSARDPTSIFNLFGLI 474

Query: 481 PFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLII 540
           P+  P F+ +G+WPI+M L+MF+Q K++P P D  QA I  ++P+     L+ FP+GL++
Sbjct: 475 PWDPPTFLMIGVWPILMGLTMFLQQKLNPTPPDPMQAKIFMFLPIFLTIILAPFPSGLVV 534

Query: 541 YWSWSNVISIVQQAVIMKMHGAEI 564
           YW+ SNV+++ QQ VI++    + 
Sbjct: 535 YWTVSNVLTMAQQWVIIRGTKVKT 558


>gi|240850503|ref|YP_002971902.1| preprotein translocase subunit YidC [Bartonella grahamii as4aup]
 gi|240267626|gb|ACS51214.1| preprotein translocase subunit YidC [Bartonella grahamii as4aup]
          Length = 612

 Score =  421 bits (1081), Expect = e-115,   Method: Composition-based stats.
 Identities = 255/610 (41%), Positives = 368/610 (60%), Gaps = 30/610 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQT------------------ 42
           ME N N+F+AI LS +++ AWQ  +V P+  ++  ++   Q                   
Sbjct: 1   MEYNRNFFIAIGLSFVVLIAWQFLHVAPKQAKLQKQQVITQQLSKQQSTLSTTTTNFSDD 60

Query: 43  VKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVS 102
                        +  + R   L+ + R+ +K   L GSINL GAQFDDL+L+ Y L V 
Sbjct: 61  TSTHQATSIIEQPMTPEIRKAVLAKTKRIAIKTNELEGSINLVGAQFDDLHLKKYRLTVD 120

Query: 103 SNSPIVTLLSPSNTKNAYFAELDYVSTANNIE-LPNSNTVWNLISGKIL-TPTTPIKLVF 160
             SP + LL+P   K  Y AE  + S +   + LP S+T W +     + TP+TPI L++
Sbjct: 121 KKSPEIDLLNPKGFKTTYLAEFGFASASLPAKALPQSDTQWQIEGNNTILTPSTPITLIY 180

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGF 220
            N    +F R +S+D+H++F I D+++N S   I  S   R+ R  P   TN   +    
Sbjct: 181 NNGQGQIFRRILSVDDHFMFTIEDSISNESDQPIYLSSYARVARAAPPEHTNATYLLHEG 240

Query: 221 IAVLGDKSLVEQKY---------SDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSF 271
           +  +   SL  +KY          D  + S++    +  W+GI+DKYWA   IP +   +
Sbjct: 241 MIGIAGDSLKTEKYKTLAELDPNPDNGQKSMTFSKVTGGWIGITDKYWAVAVIPPQNKEY 300

Query: 272 HSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFE 331
            S+F Y       YQ+    + +TI P ++ T TN LFAGAK+   I++Y+ DL I +F 
Sbjct: 301 TSRFIYFDRLQTHYQSDLLGSLLTIAPNETKTITNRLFAGAKQVEIINNYQNDLKIKKFA 360

Query: 332 MLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKN 391
           +LIDWGWF FI KPMF L+   Y   GNFGIAI+L TV +K L FPLA K Y S A MK 
Sbjct: 361 LLIDWGWFDFITKPMFSLIDVLYKQTGNFGIAILLVTVLLKTLLFPLANKSYKSMARMKL 420

Query: 392 IQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISL 451
           +QP++ E++EK+     +  Q+A+I+LYKT  INPLAGCWP+L+Q P+FFA+YKV+ I++
Sbjct: 421 LQPRLLEIKEKYPDDKTK-QQQAIIELYKTEKINPLAGCWPMLVQFPIFFALYKVLYITI 479

Query: 452 EMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP 511
           EMRHAPF+GWIKDLAA DPT++F LFG+LP+  P F+ +G WP+IM ++MF+QM+M+P P
Sbjct: 480 EMRHAPFFGWIKDLAAPDPTSLFNLFGLLPYTTPTFLMIGAWPLIMGITMFLQMRMNPAP 539

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLR 571
            D+ QAMI  WMPVVF F L+SFP GL+IYW+W+N++SI+QQ ++MK  G +I L D L+
Sbjct: 540 QDQSQAMIFTWMPVVFTFMLASFPVGLVIYWAWNNILSIIQQGIMMKRQGVKIELFDNLK 599

Query: 572 STFSKNYNSQ 581
           + + K+   +
Sbjct: 600 TMWRKSPKKE 609


>gi|71083172|ref|YP_265891.1| putative inner membrane protein translocase component YidC
           [Candidatus Pelagibacter ubique HTCC1062]
 gi|123647065|sp|Q4FNF1|OXAA_PELUB RecName: Full=Inner membrane protein oxaA
 gi|71062285|gb|AAZ21288.1| 60 kDa inner membrane protein [Candidatus Pelagibacter ubique
           HTCC1062]
          Length = 558

 Score =  420 bits (1080), Expect = e-115,   Method: Composition-based stats.
 Identities = 208/564 (36%), Positives = 333/564 (59%), Gaps = 8/564 (1%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVY-PRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
               N   AI+LS  ++  +  F+   P   + N   +N     +     +         
Sbjct: 1   MDTRNVIAAISLSAAVIILYSLFFQPDPATIKKNLAEQNKIENNEDTPSLDKNENFSKLS 60

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           RA AL  + R++ +N S++GSI+LKGA  DDL  + Y+++++ N   +TLLSP N ++ Y
Sbjct: 61  RADALKENDRIQFENGSVVGSISLKGAAIDDLTFKEYNIELNRNEK-ITLLSPRNVEDGY 119

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF 180
             E  +VST  NI++P+++TVW +     LT   P+KL + N   I FE+ ISLD+ +LF
Sbjct: 120 LIESGFVSTNKNIDIPDASTVWEVSGNNKLTNNNPVKLTWSNTQGITFEKHISLDDQFLF 179

Query: 181 KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS 240
            + + + N+S     F   G+I+R++    +  + + EGF++VL D  L+E+ Y DI+  
Sbjct: 180 TVKEKIINSSDKSYNFYSYGQIIRNELPEISGFYILHEGFLSVLDD-ELIEEDYDDIQDK 238

Query: 241 SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGK 300
             +   +   ++ ISDK+W +  IP K   F + F Y +   A Y    S   I +    
Sbjct: 239 KFTQIAQD-GFVAISDKFWVTSVIPPKGKEFKTTFDYKNKFRANY---ISTKGIEVKANS 294

Query: 301 SITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF 360
           SI     +   AK    I  Y ++L I +F++ IDWG+ YFI KP+F ++ YF+ L+GN+
Sbjct: 295 SIEEKIQIIVAAKRVNVIDGYAENLNINKFDLAIDWGFMYFITKPLFFVLDYFFKLLGNY 354

Query: 361 GIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYK 420
           G+AI+  T+ ++L FFPLA   + S   MK + P++  L+E  K    + LQ+AM+ LYK
Sbjct: 355 GLAIIAVTICIRLAFFPLANFSFKSMGKMKLLAPEMARLKELHKDDKMK-LQQAMMALYK 413

Query: 421 THNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL 480
              +NP++GC PIL+QIPVFFA+YKV+ +++EMRH PF+GWI DL+  DPT++F +FG++
Sbjct: 414 KEKVNPMSGCLPILVQIPVFFALYKVLFVTIEMRHMPFYGWIHDLSDRDPTSLFNVFGLI 473

Query: 481 PFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLII 540
           P+  P F+ +G WPIIM ++M+IQ K++P P D  QA I  + PV     L+ FPAGL+I
Sbjct: 474 PWDPPSFLLIGAWPIIMGITMWIQQKLNPTPPDPIQAKIFMFFPVFLTVILAPFPAGLVI 533

Query: 541 YWSWSNVISIVQQAVIMKMHGAEI 564
           YWS++N+ +++QQ ++ +    + 
Sbjct: 534 YWSFNNIFTMIQQYIVQRKMTIKT 557


>gi|91762399|ref|ZP_01264364.1| putative inner membrane protein translocase component YidC
           [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718201|gb|EAS84851.1| putative inner membrane protein translocase component YidC
           [Candidatus Pelagibacter ubique HTCC1002]
          Length = 558

 Score =  420 bits (1080), Expect = e-115,   Method: Composition-based stats.
 Identities = 208/564 (36%), Positives = 333/564 (59%), Gaps = 8/564 (1%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVY-PRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
               N   AI+LS  ++  +  F+   P   + N   +N     +     +         
Sbjct: 1   MDTRNVIAAISLSAAVIILYSLFFQPDPATIKKNLAEQNKIENNEDTPSLDKNENFSKLS 60

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           RA AL  + R++ +N S++GSI+LKGA  DDL  + Y+++++ N   +TLLSP N ++ Y
Sbjct: 61  RADALKENDRIQFENGSVVGSISLKGAAIDDLTFKEYNIELNRNEK-ITLLSPRNVEDGY 119

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF 180
             E  +VST  NI++P+++TVW +     LT   P+KL + N   I FE+ ISLD+ +LF
Sbjct: 120 LIESGFVSTNKNIDIPDASTVWEVSGNNKLTNNNPVKLTWSNTQGITFEKHISLDDQFLF 179

Query: 181 KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS 240
            + + + N+S     F   G+I+R++    +  + + EGF++VL D  L+E+ Y DI+  
Sbjct: 180 TVKEKIINSSDKSYNFYSYGQIIRNEIPEISGFYILHEGFLSVLDD-ELIEEDYDDIQDK 238

Query: 241 SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGK 300
             +   +   ++ ISDK+W +  IP K   F + F Y +   A Y    S   I +    
Sbjct: 239 KFTQIAQD-GFVAISDKFWVTSVIPPKGKEFKTTFDYKNKFRANY---ISTKGIEVKANS 294

Query: 301 SITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF 360
           SI     +   AK    I  Y ++L I +F++ IDWG+ YFI KP+F ++ YF+ L+GN+
Sbjct: 295 SIEEKIQIIVAAKRVNVIDGYAENLNINKFDLAIDWGFMYFITKPLFFVLDYFFKLLGNY 354

Query: 361 GIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYK 420
           G+AI+  T+ ++L FFPLA   + S   MK + P++  L+E  K    + LQ+AM+ LYK
Sbjct: 355 GLAIIAVTICIRLAFFPLANFSFKSMGKMKLLAPEMARLKELHKDDKMK-LQQAMMALYK 413

Query: 421 THNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL 480
              +NP++GC PIL+QIPVFFA+YKV+ +++EMRH PF+GWI DL+  DPT++F +FG++
Sbjct: 414 KEKVNPMSGCLPILVQIPVFFALYKVLFVTIEMRHMPFYGWIHDLSDRDPTSLFNVFGLI 473

Query: 481 PFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLII 540
           P+  P F+ +G WPIIM ++M+IQ K++P P D  QA I  + PV     L+ FPAGL+I
Sbjct: 474 PWDPPSFLLIGAWPIIMGITMWIQQKLNPTPPDPIQAKIFMFFPVFLTVILAPFPAGLVI 533

Query: 541 YWSWSNVISIVQQAVIMKMHGAEI 564
           YWS++N+ +++QQ ++ +    + 
Sbjct: 534 YWSFNNIFTMIQQYIVQRKMTIKT 557


>gi|49474531|ref|YP_032573.1| putative inner membrane protein translocase component YidC
           [Bartonella quintana str. Toulouse]
 gi|49240035|emb|CAF26454.1| hypothetical protein BQ09780 [Bartonella quintana str. Toulouse]
          Length = 613

 Score =  420 bits (1080), Expect = e-115,   Method: Composition-based stats.
 Identities = 257/611 (42%), Positives = 371/611 (60%), Gaps = 31/611 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAA----- 55
           ME N N+F+AI LS  ++ AW  FYV P+  ++  +R   Q + +     ++        
Sbjct: 1   MEYNRNFFIAIGLSFGVLIAWHFFYVAPKQAQLQQKRLIAQQLSKQQSTLSTSTPYFSDN 60

Query: 56  --------------VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDV 101
                         +  + R +AL+ + R+ +K   L GSINL GAQFDDL L+ Y L V
Sbjct: 61  ASITHESASIITHPITPEIRNEALAKTNRIAIKTDELEGSINLVGAQFDDLLLKKYRLTV 120

Query: 102 SSNSPIVTLLSPSNTKNAYFAELDYVSTA-NNIELPNSNTVWNLISGKIL-TPTTPIKLV 159
              SP + LL+P      Y AE  + S++ +   LP S+T W +       TP+TP+ L+
Sbjct: 121 DKKSPEIALLNPKGFTTTYLAEFGFTSSSLSAKALPQSDTQWQIEGNNTTLTPSTPVTLI 180

Query: 160 FKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEG 219
           + N    +F RT+S+D HY+F I D++ N S   I  S   R+ R  P   TN   +   
Sbjct: 181 YNNGQGQIFRRTLSVDNHYMFTIEDSIKNESDKPIYLSSYARVARAAPPEHTNATYLLHE 240

Query: 220 FIAVLGDKSLVEQKY---------SDIEKSSISNFHESNSWLGISDKYWASVFIPSKETS 270
            +  +   SL  +KY          D  + SI+       W+GI+DKYWA   IP ++  
Sbjct: 241 GMIGIASDSLKTEKYKTLAELNPNPDNSQKSITFSKNIGGWIGITDKYWAVAVIPPQDKE 300

Query: 271 FHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRF 330
           + S+F Y    +  YQ+    + +T+ P ++   TN LFAGAK+   I+HY+ DL I +F
Sbjct: 301 YTSRFIYFDRLNTHYQSDLLGSLLTVAPNETKIVTNRLFAGAKQVEIINHYQNDLKIKKF 360

Query: 331 EMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMK 390
            +LIDWGWF FI KPMF L+   Y   GNFGIAI+L TV +K L FPLA K Y S A MK
Sbjct: 361 ALLIDWGWFDFITKPMFSLIDTLYKQTGNFGIAILLVTVLLKTLLFPLANKSYKSMARMK 420

Query: 391 NIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISIS 450
            IQP + E++EK+     +  Q+A+I+LYKT  INPLAGCWP+L+Q P+FFA+YKV+ I+
Sbjct: 421 LIQPMLLEIKEKYPDDRTK-QQQAIIELYKTQKINPLAGCWPMLIQFPIFFALYKVLYIT 479

Query: 451 LEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPP 510
           +EMRHAPF+GWI+DLAA DPT++F LFG+LP+ +P F+ +G WP+IM ++MF+QM+M+P 
Sbjct: 480 IEMRHAPFFGWIQDLAAPDPTSLFNLFGLLPYTVPTFLMLGAWPLIMGITMFLQMRMNPA 539

Query: 511 PADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRL 570
           P D+ QAMI  WMPV+F F L+SFP GL+IYW+W+N++SI+QQ+++MK  G +I L D L
Sbjct: 540 PQDQTQAMIFAWMPVIFTFMLASFPVGLVIYWAWNNILSILQQSILMKRQGVKIELFDNL 599

Query: 571 RSTFSKNYNSQ 581
           ++ + K+   +
Sbjct: 600 KAMWWKSPKKE 610


>gi|330813521|ref|YP_004357760.1| inner membrane protein translocase component YidC, long form
           [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486616|gb|AEA81021.1| inner membrane protein translocase component YidC, long form
           [Candidatus Pelagibacter sp. IMCC9063]
          Length = 564

 Score =  419 bits (1077), Expect = e-115,   Method: Composition-based stats.
 Identities = 216/570 (37%), Positives = 339/570 (59%), Gaps = 14/570 (2%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYA------- 54
               N   AI LS II+  WQ   + P I++   + +     K      ++ +       
Sbjct: 1   MDTKNILTAIILSTIIIVGWQVLVIDPEIKKEQAKVEKTIQTKPTAGKPSAPSLNKKIQV 60

Query: 55  AVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPS 114
                 R +AL    RV+L N  + GSI+L GA  DD+ L+ Y   +  NS  V +L+P 
Sbjct: 61  QKKKVSRQEALLTDQRVKLDNAKITGSISLVGALIDDVTLKNYQESLDENSKQVVILNPK 120

Query: 115 NTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISL 174
                Y+ E  + S ANNI +P++N+VW L   + LTP TPI+L + N N ++F + I +
Sbjct: 121 KINKGYYLESGWAS-ANNINVPDNNSVWKLTRNRTLTPRTPIELEWDNQNGLVFTKKIEV 179

Query: 175 DEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKY 234
           D+ YLF I +++ NNS   +      +I R +     + + + EG + V+  ++L E+ Y
Sbjct: 180 DDQYLFSITESIKNNSKANVDLFHYSQITRKEKPQVQDFYILHEGLVGVID-ETLQEEDY 238

Query: 235 SDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
            D+ K     +  ++ WLGI+DKYW +  +P K+ +F+++F Y +   A Y      N  
Sbjct: 239 DDV-KDKNQKYQGTSGWLGITDKYWLTAIVPQKKQAFNAEFIYDTAYKANYIL---TNPT 294

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
           +I  GK  ++++  F GAKE  TI  Y +   I +F++ IDWGWFYF  KP+F ++ Y Y
Sbjct: 295 SIPSGKINSSSSQFFIGAKEVKTIDGYAESANINKFDLAIDWGWFYFFTKPLFFIIDYLY 354

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
           N  GNFG AI+L T  +++LFFPLA   + S A MK +QP+I  +++ +K    Q +Q  
Sbjct: 355 NFSGNFGWAIVLLTAGIRILFFPLANYSFASMAKMKALQPEIARMKDLYKDDK-QKIQTE 413

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           M+ LY+   INP++GC P+L+QIP FFAIYK++ ++LEMRHAPF+GWI+DL+A DPT++F
Sbjct: 414 MMGLYRKEKINPVSGCLPMLIQIPFFFAIYKMLFVTLEMRHAPFFGWIQDLSAPDPTSLF 473

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSF 534
            LFG++P+  P F+ +G+WPI+M +SM+IQ K++P P D  QA I  + P+     L+SF
Sbjct: 474 NLFGLIPWDPPSFLMIGVWPILMGVSMWIQQKLNPAPTDPIQAKIFAFFPLFLTVMLASF 533

Query: 535 PAGLIIYWSWSNVISIVQQAVIMKMHGAEI 564
           P+GL++YW+ +NV+++ QQ VI++    + 
Sbjct: 534 PSGLVVYWTVNNVLTMAQQYVIIRKTTIKT 563


>gi|307294062|ref|ZP_07573906.1| membrane protein insertase, YidC/Oxa1 family [Sphingobium
           chlorophenolicum L-1]
 gi|306880213|gb|EFN11430.1| membrane protein insertase, YidC/Oxa1 family [Sphingobium
           chlorophenolicum L-1]
          Length = 567

 Score =  417 bits (1072), Expect = e-114,   Method: Composition-based stats.
 Identities = 206/566 (36%), Positives = 321/566 (56%), Gaps = 12/566 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQN----FYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAV 56
           M+   N  +A+ L+  I++ W      F+          E      +        +  A 
Sbjct: 1   MDDKKNIILAVVLTAAILFGWPYVANHFFPAANPPATKIEGGKTTPLTPSGSAPAAEGAA 60

Query: 57  LIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNT 116
            + D A  L   PR+ ++ P + GSINLKGA+ DD+ L  Y   ++ +S  + L SPS T
Sbjct: 61  AVRDLALVLKDGPRIPIRTPKITGSINLKGARIDDIVLPTYKESIARDSHAIRLYSPSGT 120

Query: 117 KNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE 176
           K+AYFA   +      ++ P+ N+VW   SGK LTP +P+ L + N     FE   S+DE
Sbjct: 121 KDAYFAGFGW--QGEGLKTPDGNSVWT-ASGKELTPASPVTLTWNNGAGQSFEIRYSIDE 177

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
           +Y+      V+N+    +     G + R  P T  +T+ +  G + V    +  +  Y D
Sbjct: 178 NYMITAQQKVSNSGAGTVAVKSYGYVSRAHPSTDPDTWTIHVGPMGVFNGAANYDVNYKD 237

Query: 237 IEKSSISN-FHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
           +EK   S  F  +  W+G +DKYW S  +P ++ +F +Q +       ++Q   S   + 
Sbjct: 238 LEKGPASQSFQSTGGWIGFTDKYWLSALVPDQKAAFSAQMR--KGAGTQFQTDISLAPVM 295

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           +  GKS+T TN LF GAKE  T+  Y +D  IP F+  IDWGWFY+  KP+F L+ + + 
Sbjct: 296 LAAGKSVTQTNRLFVGAKEVKTLEAY-QDAGIPLFDRAIDWGWFYWFEKPIFALLHWLFE 354

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
            +GNFG+AI+  T  V+ L FP+A++Q+ S A M+ +QPK+  L+EK+K   P+ LQ+ M
Sbjct: 355 HIGNFGVAIICLTFVVRGLMFPVAQRQFASMAAMRAVQPKMKALQEKYKDDKPK-LQQEM 413

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           ++LYK   +NPLAGC PI +QIP+FFA+YKV+ +++EMRH PF  WIKDL+A DP +I  
Sbjct: 414 MELYKREKVNPLAGCLPIFIQIPIFFALYKVLQLTIEMRHQPFVLWIKDLSAPDPLHILN 473

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFP 535
           LFG+LPF  P F+ +G+  +++ +SM+ Q K++P   D  Q  +   MP + +F ++ F 
Sbjct: 474 LFGLLPFTPPAFLGIGVLALLLGISMYFQFKLNPAQMDPMQQQVFAIMPWMMMFIMAPFA 533

Query: 536 AGLIIYWSWSNVISIVQQAVIMKMHG 561
           AGL++YW  +N +S++QQ  + K H 
Sbjct: 534 AGLLVYWITNNCLSMLQQWWLYKRHP 559


>gi|329888537|ref|ZP_08267135.1| membrane protein insertase, YidC/Oxa1 family, N-terminal
           domain-containing protein [Brevundimonas diminuta ATCC
           11568]
 gi|328847093|gb|EGF96655.1| membrane protein insertase, YidC/Oxa1 family, N-terminal
           domain-containing protein [Brevundimonas diminuta ATCC
           11568]
          Length = 600

 Score =  417 bits (1070), Expect = e-114,   Method: Composition-based stats.
 Identities = 227/599 (37%), Positives = 338/599 (56%), Gaps = 25/599 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIE--------EMNNERKNIQTVKQPNQVDNSY 53
           E + N  +    + +I+  +    + P+ E            ++    +         + 
Sbjct: 4   ENSRNTIIFFVCAALIMGVYYFMVMRPQAESRRQAQIVAAEQQKAREASADAGLTPSGAA 63

Query: 54  AAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSP 113
             V I DRAQAL    RV ++ P+L GS++L+GA+ DDL L  Y   +  NSP V L  P
Sbjct: 64  PGVFIKDRAQALGTVARVPIQTPTLKGSLSLQGARIDDLYLTRYRETLDKNSPPVELFRP 123

Query: 114 SNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTIS 173
              ++AYFA+  +        +P  NTVW L  G  LTPTTP++L + N + + F R +S
Sbjct: 124 QGMEHAYFAQFGWSGPNVAGGVPGPNTVWRLTKGSTLTPTTPVELTWDNGSGLRFTRVVS 183

Query: 174 LDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHK-PQTATNTFGVQEGFIAVLGD---KSL 229
           +D+ Y+F + DTV N     I  +P GR+ R   P        + EG I   GD    S 
Sbjct: 184 IDDQYMFTVKDTVANLGTQAIAIAPYGRVERQGVPVDLGKQMILHEGAIGTFGDGGGYST 243

Query: 230 VEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLS-DGHARYQAK 288
            + KY D  K        +  WLGI+DKYW +  IP+++ +   +F      G   ++A 
Sbjct: 244 EQVKYKDWAKKPRIENQSTGGWLGITDKYWLAALIPTQDETIEGRFSVRDAQGMNIHEAA 303

Query: 289 FSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFM 348
                 TI PG+ I  T  LFAGAK    +  YE+ L +PRF   IDWG F+F+ +P+F 
Sbjct: 304 MLGATHTIQPGRQIEETQRLFAGAKRAEVLKAYEQSLNLPRFVYAIDWGMFWFLTRPIFT 363

Query: 349 LMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPP 408
           ++ +FY ++GNFG+AI+  TV VKL+ FPLA K Y S + M+N+QPK++E+++K   S P
Sbjct: 364 VVEFFYGVLGNFGLAILALTVVVKLILFPLANKSYESLSKMRNLQPKMEEIKKKH-GSEP 422

Query: 409 QVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAA 468
           Q  Q+ M+ LY+   INPLAGC P+++QIPVF+A+YKV+ +++EMRHAPF+GWI+DL+A 
Sbjct: 423 QKQQQEMMALYQREKINPLAGCLPMVVQIPVFYALYKVLFVTIEMRHAPFFGWIRDLSAR 482

Query: 469 DPTNIFTLFGILPFYLPGF----------MHVGIWPIIMSLSMFIQMKMSPPPADKGQAM 518
           DP+ I+ LFG +P+               +H+G+ P++   +M++QM M+PP  D  Q  
Sbjct: 483 DPSTIWNLFGAIPWDPATLPILGGILNGPLHLGVLPLVYGFTMWLQMAMNPPAQDPMQRQ 542

Query: 519 ILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
           I   MP+VF F ++ F AGL+IYW+W+NV+SI+QQ VIM    AE  +   L + F K 
Sbjct: 543 IFALMPIVFTFIMAPFAAGLLIYWAWNNVLSIIQQYVIMHRFKAENPIDAFL-ARFKKA 600


>gi|294010745|ref|YP_003544205.1| preprotein translocase YidC subunit [Sphingobium japonicum UT26S]
 gi|292674075|dbj|BAI95593.1| preprotein translocase YidC subunit [Sphingobium japonicum UT26S]
          Length = 567

 Score =  417 bits (1070), Expect = e-114,   Method: Composition-based stats.
 Identities = 211/566 (37%), Positives = 321/566 (56%), Gaps = 12/566 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAW----QNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAV 56
           M+   N  +A+ L+  I++ W    Q F+          E      +        +  A 
Sbjct: 1   MDDKKNIILAVVLTAAILFGWPYVAQYFFPAANPPATKIEGGKTTPLTPSGAAPAAEGAA 60

Query: 57  LIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNT 116
            I D A  L  SPRV ++ P + GSINLKGA+ DD+ L  Y   ++ +SP + L SPS T
Sbjct: 61  AIRDLALVLKDSPRVAIRTPKITGSINLKGARIDDIVLPTYKETIAKSSPAIRLYSPSGT 120

Query: 117 KNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE 176
           K+AYFA   +      ++ P+  TVW   S K LTPT+P+ L + N     FE   S+DE
Sbjct: 121 KHAYFAGFGW--QGEGVKTPDGGTVWT-ASAKELTPTSPVTLSWNNGAGQTFEIRYSIDE 177

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
           +Y+      V+N     +     G + R  P    +T+ +  G + V    +  +  YSD
Sbjct: 178 NYMITAQQKVSNGGAGAVGVKSYGYVSRATPSADPDTWTIHVGPMGVFNGAANYDVNYSD 237

Query: 237 IEKSSISN-FHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
           +EK   +  F  +  W+G +DKYW S  IP ++ +F  Q +       ++Q   S   I 
Sbjct: 238 LEKGPATQSFQSTGGWIGFTDKYWLSALIPDQKAAFTGQMR--KGAGTQFQTDMSLAPIM 295

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           + PGK++T TN LF GAKE  T+  Y +D  +P F+  IDWGWFY+  KP+F L+ + + 
Sbjct: 296 VAPGKAVTQTNRLFVGAKEVKTLEAY-QDAGVPLFDRAIDWGWFYWFEKPIFALLHWLFE 354

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
            +GNFG+AI+  T  V+ L FP+A++Q+ S A M+ +QPK+  L+EK+K   P  LQ+ M
Sbjct: 355 HIGNFGVAIICLTFVVRGLMFPVAQRQFASMAAMRAVQPKMKALQEKYKDDKP-RLQQEM 413

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           ++LYK   +NPLAGC PI +QIP+FFA+YKV+ +++EMRH PF  WIKDL+A DP +I  
Sbjct: 414 MELYKREKVNPLAGCLPIFIQIPIFFALYKVLQLTIEMRHQPFVLWIKDLSAPDPLHIVN 473

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFP 535
           LFG+LPF  P F+ +G+  +++ +SM+ Q K++P   D  Q  +   MP + +F ++ F 
Sbjct: 474 LFGLLPFTPPAFLGIGVLALLLGISMYFQFKLNPAQMDPMQQQVFAIMPWMMMFIMAPFA 533

Query: 536 AGLIIYWSWSNVISIVQQAVIMKMHG 561
           AGL++YW  +N +S++QQ  + K H 
Sbjct: 534 AGLLVYWITNNCLSMLQQWWLYKRHP 559


>gi|94495881|ref|ZP_01302460.1| 60 kDa inner membrane insertion protein [Sphingomonas sp. SKA58]
 gi|94424573|gb|EAT09595.1| 60 kDa inner membrane insertion protein [Sphingomonas sp. SKA58]
          Length = 568

 Score =  416 bits (1069), Expect = e-114,   Method: Composition-based stats.
 Identities = 204/568 (35%), Positives = 318/568 (55%), Gaps = 12/568 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAW----QNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAV 56
           M+   N  +A+ L+  I++ W      F+          E      V +P+    + +  
Sbjct: 1   MDDKKNIILAVLLTAAILFGWPYISNYFFPTANPPATKIEGGKQVPVARPDADPAADSPA 60

Query: 57  LIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNT 116
            I DRA  L  SPR+ ++   L GSINLKGA+ DD+ L  Y   ++ +SP V L SPS T
Sbjct: 61  AIRDRALVLRESPRIPIRTAKLTGSINLKGARIDDIVLPTYKETIAKDSPAVRLYSPSGT 120

Query: 117 KNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE 176
           ++AYFA   +      +  P+ NT+W    G  LTPT+P+ L + N    LFE  +S+D+
Sbjct: 121 QDAYFAGFGW--QGEGLRAPDRNTLWT-AQGSALTPTSPVTLSWNNGAGQLFEIRLSVDD 177

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
           +Y+      V+N     +   P   I R       +T+ +  G + V    +  +  Y D
Sbjct: 178 NYMITAAQKVSNTGTGTVGVKPYAYISRTGIPKDPDTWTIHVGPMGVFNGAANYDVNYKD 237

Query: 237 IEKSS-ISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
           ++K   + +F     W+G +DKYW S  +P+ +  F  QF+       +YQA  +     
Sbjct: 238 LDKGPSVQSFQSKGGWIGFTDKYWLSALVPAADADFAGQFR--KGAGTQYQADVALGSNM 295

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           + PGK++T T  LF GAKE  T+  Y +D  +P F+  IDWGWFY+  KP+F L+ + + 
Sbjct: 296 VAPGKAVTQTQRLFVGAKEVKTLEAY-QDAGVPLFDRAIDWGWFYWFEKPIFALLHWLFE 354

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
            +GNFG+AI+  T  V+ + FP+A++Q+ S A M+ +QPK+  L+EK K    Q+  K M
Sbjct: 355 HIGNFGVAIICLTFVVRAIMFPIAQRQFSSMAAMRALQPKMKALQEKHKDDKQQLQMK-M 413

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           ++LYK   +NPLAGC PI +QIP+FFA+YKV+ +++EMRH PF  WIKDL+A DP +I  
Sbjct: 414 MELYKQEKVNPLAGCLPIFIQIPIFFALYKVLMLTIEMRHQPFVLWIKDLSAPDPLHILN 473

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFP 535
           LFG+L F  P F+ +G+  +++ +SM+ Q K++P   D  Q  I+  MP + +F ++ F 
Sbjct: 474 LFGLLDFTPPAFLGIGVLALLLGISMYFQFKLNPTQMDPMQQQIMGIMPWMMMFIMAPFA 533

Query: 536 AGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           AGL++YW  +N +S+ QQ  + + H   
Sbjct: 534 AGLLVYWITNNCLSMAQQWWLYRKHPVP 561


>gi|319408960|emb|CBI82617.1| translocase precursor subunit [Bartonella schoenbuchensis R1]
          Length = 611

 Score =  415 bits (1067), Expect = e-114,   Method: Composition-based stats.
 Identities = 259/609 (42%), Positives = 375/609 (61%), Gaps = 29/609 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYA------ 54
           ME N N+F+AI LS+II  AW  FYV P+  ++   +   Q  KQ +++ ++        
Sbjct: 1   MEYNRNFFIAIGLSLIIFVAWHFFYVAPQQAKLQEMQMAQQLSKQSSEIPSTDMHFSDSA 60

Query: 55  -----------AVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSS 103
                       +  ++R+  L+ + R+ +K   L GSINL GAQFDDL L+ Y L V  
Sbjct: 61  QISGSGSISDRPMTPENRSAELAKTNRIAIKTDELEGSINLVGAQFDDLFLKKYRLTVDK 120

Query: 104 NSPIVTLLSPSNTKNAYFAELDYVSTA-NNIELPNSNTVWNLISGKIL-TPTTPIKLVFK 161
            SP + LL+P+     Y AE  + S++     LP S+T W +       TP+TP+ L++ 
Sbjct: 121 GSPEIALLNPNGFNTTYLAEFGFTSSSLPATALPQSHTQWQIEGKNTTLTPSTPVTLIYN 180

Query: 162 NANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFI 221
           N    +F RT+S+D HY+F I D++ N S + I  SP  R+ R  P   TN   +    +
Sbjct: 181 NGQGQIFRRTLSIDNHYMFTIEDSIKNESDNPIYLSPYARVARAAPPEYTNATYLLHEGM 240

Query: 222 AVLGDKSLVEQKYSD---------IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFH 272
             +   SL  + Y +           + S+     +  W+GI+DKYWA V IP ++  + 
Sbjct: 241 IGIAGDSLKTETYKNLEELNPNPENGQKSMIFSKVTGGWIGITDKYWAVVVIPPQDQEYT 300

Query: 273 SQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEM 332
           S+F Y +  +  YQ+   ++ +T+ P ++ T TN LFAGAK+   I+ Y+  L I +F +
Sbjct: 301 SRFIYFNQLNTHYQSDLQSSLLTVAPNETKTITNHLFAGAKQVEIINRYQNQLKIRKFGL 360

Query: 333 LIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNI 392
           LIDWGWF FI KPMF L+  FY   GNFGIAI+L TV +K+L FPLA K Y S A MK +
Sbjct: 361 LIDWGWFDFITKPMFALIDIFYKQTGNFGIAILLVTVLLKVLLFPLANKSYKSMARMKLV 420

Query: 393 QPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLE 452
           QP + E++EK+     +  Q+A+I LYKT  INPLAGCWP+L+Q P+FFA+YKV+ I++E
Sbjct: 421 QPMMQEIKEKYADDRVK-QQQAVIALYKTQKINPLAGCWPMLVQFPIFFALYKVLYITIE 479

Query: 453 MRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPA 512
           MRHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G WP+IM ++MF+QM+M+P P 
Sbjct: 480 MRHAPFFGWIQDLAAPDPTSIFNLFGLLPYEVPTFLILGAWPLIMGITMFLQMQMNPTPP 539

Query: 513 DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRS 572
           D  QAMI  WMPV+F F L+SFPAGL+IYW+W+N +SI+QQ ++MK  G +I L + L++
Sbjct: 540 DPTQAMIFTWMPVIFTFMLASFPAGLVIYWAWNNTLSIIQQGIMMKRQGVKIELFNNLKA 599

Query: 573 TFSKNYNSQ 581
            F K    +
Sbjct: 600 MFHKKSKKE 608


>gi|296775679|gb|ADH42956.1| preprotein translocase subunit YidC [uncultured SAR11 cluster alpha
           proteobacterium H17925_23J24]
          Length = 569

 Score =  415 bits (1066), Expect = e-113,   Method: Composition-based stats.
 Identities = 211/576 (36%), Positives = 326/576 (56%), Gaps = 18/576 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAV---- 56
           M+   N   AIALS  +++ W   +  P+IEE     ++    K+    D     V    
Sbjct: 1   MDF-RNVIFAIALSFAVLFGWSVIFETPKIEEQAKLEQSENYQKEDAASDAPSVNVEKKD 59

Query: 57  -LIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSN 115
             I  R  A+  + R+  +N +++GSI LKGA  DD+  + Y+  + S+   VT L+P  
Sbjct: 60  LPIVSRNDAIKSTNRINFENENVVGSITLKGALIDDITFKKYNETLGSDKK-VTYLNPQE 118

Query: 116 TKNAYFAELDYVSTA-NNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISL 174
           T   YF E  + ++   +I LPN +T+W +     L+  +P+ + +KN + I F + I L
Sbjct: 119 TNEGYFIETGWAASNVEDIGLPNKDTLWKVKGNNKLSTGSPVIMEWKNKSGITFRKKIEL 178

Query: 175 DEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQ-----TATNTFGVQEGFIAVLGDKSL 229
           D  +LF++   + N S   +   P  +I R++       + + T  + +GFI V      
Sbjct: 179 DSKFLFRVTQEIQNKSGSIVELYPYAQITRNQKPVLQAGSMSGTLILHDGFIGVFN--ED 236

Query: 230 VEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKF 289
           +++   D  K      +  + WLGI+DK+W +  +P K  SF  +F Y S+         
Sbjct: 237 LKEYDYDDIKDKKKEHNAESGWLGITDKFWITALVPEKNQSFRGEFVYKSESFKANYI-- 294

Query: 290 SANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFML 349
           +   I + P  S  +T  +F  AKE   I  Y +  +I +F++ IDWGW YF+ KP+F +
Sbjct: 295 ANKPIVVQPSSSKASTTKIFVAAKEVKVIDGYAEAESINKFDLTIDWGWLYFLTKPLFFI 354

Query: 350 MSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQ 409
           ++Y + L  NFGIAI+L T  V+LLFFPLA   + S A MK +QP++  L+E  K    +
Sbjct: 355 INYLFELTKNFGIAIILVTAAVRLLFFPLANYSFRSMAKMKILQPELLRLKEVHKGDKVK 414

Query: 410 VLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAAD 469
            LQ+ M+ LY+   +NPL+GC PIL+QIP FFAIYK++ ISLEMRH PF+GWIKDL+A D
Sbjct: 415 -LQQEMMALYRREKVNPLSGCLPILIQIPFFFAIYKMLLISLEMRHQPFFGWIKDLSAQD 473

Query: 470 PTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVF 529
           PT+IF +FG++P+  P F+ +G WPI+M  +M++Q K++P P D  QA I  + P+    
Sbjct: 474 PTSIFNIFGLIPWDPPSFLIIGAWPIMMGATMYLQQKLNPTPPDPIQAKIFLFFPLFLTI 533

Query: 530 ALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIG 565
            L+ FPAGL++YW+ +NV++I QQ VIMK    +  
Sbjct: 534 ILAPFPAGLVVYWTINNVLTIAQQWVIMKRTTVKTK 569


>gi|197103856|ref|YP_002129233.1| preprotein translocase subunit [Phenylobacterium zucineum HLK1]
 gi|254773009|sp|B4RDV5|OXAA_PHEZH RecName: Full=Inner membrane protein oxaA
 gi|196477276|gb|ACG76804.1| preprotein translocase subunit [Phenylobacterium zucineum HLK1]
          Length = 598

 Score =  414 bits (1063), Expect = e-113,   Method: Composition-based stats.
 Identities = 206/596 (34%), Positives = 322/596 (54%), Gaps = 19/596 (3%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERK-----NIQTVKQPNQVDNSYAAV 56
           +   N  +    + +++  +Q F + P  +    E                    +    
Sbjct: 4   DNTRNTIIFFVCAALLLVLYQVFVIGPADKRRQAELARQAPPAAAAQAGQAGAPAAPQVP 63

Query: 57  LIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNT 116
               R  A++ +PRV++  P L GS++L+GA+ DDL L  +   V  +SP V LL P   
Sbjct: 64  QAMTRQAAVAATPRVKIDTPMLTGSLSLRGARIDDLYLDRFRQTVEKDSPPVELLRPEGA 123

Query: 117 KNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE 176
           +  +FAE+ +V  AN   LP+S  VW L  G  L P  P+ L + N   + F R I +D+
Sbjct: 124 QYPWFAEVGWVG-ANVPGLPDSGAVWTLAQGSTLAPGQPVVLTYANGQGLTFTRRIEVDD 182

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
            YLF I DTV N +   +  +P G + R           +         D  L + KY  
Sbjct: 183 RYLFTITDTVANTTGQPVTIAPYGTVQRQGVPADLGKNQIVHEGAIGWLDGKLRQVKYGK 242

Query: 237 IEKSSISN-FHESNSWLGISDKYWASVFIPSKETSFHSQFKYLS-DGHARYQAKFSANEI 294
             K      ++ +  WLGI+DKYW +  IP ++ +   QF+     G     A F    +
Sbjct: 243 WRKEGGGPAYNSTGGWLGITDKYWLAALIPGQQEAVTGQFRRTQAPGVDVLDANFVGAPV 302

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
           TI  G+ ++ T   FAGAK+ P +  YE+ L +  F+  +DWG F+F+ +P+F  + + +
Sbjct: 303 TIPAGRQVSETTRFFAGAKQVPILRDYEQSLGVAHFDNAVDWGNFWFLTRPIFQFLEFIH 362

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
             +G FG+AI+  TV V+L+FFPLA KQY S   MK +QP+++ELR+K+K  P +  Q+ 
Sbjct: 363 RYIGTFGLAILALTVVVRLIFFPLANKQYESITKMKKVQPQMEELRKKYKDDPAK-QQQE 421

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           ++ LY+   +NPLAGC P+LLQIPVF+A+YKV+++++EMRHAPF GWI+DL+A DPT I+
Sbjct: 422 LLALYQREKVNPLAGCLPLLLQIPVFYALYKVLTVTIEMRHAPFMGWIQDLSARDPTTIW 481

Query: 475 TLFGILPFYLPGF----------MHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMP 524
            LFG++P+               +H+G+ PI+   +M++ M MSPP  D  Q  I   MP
Sbjct: 482 NLFGLIPWDPASAPLIGAFLNGPLHLGVLPILYGFTMWLTMAMSPPAGDPIQQKIFQLMP 541

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNS 580
           ++F F ++ F  GL+IYW+WSNV++++QQ VIM+    +  +   +R    K   +
Sbjct: 542 IIFTFIMAPFAVGLLIYWTWSNVLTLLQQYVIMRRFKVDNPIDQIIRKLTGKPKPA 597


>gi|157803235|ref|YP_001491784.1| putative inner membrane protein translocase component YidC
           [Rickettsia canadensis str. McKiel]
 gi|166977408|sp|A8EXB6|OXAA_RICCK RecName: Full=Inner membrane protein oxaA
 gi|157784498|gb|ABV72999.1| putative inner membrane protein translocase component YidC
           [Rickettsia canadensis str. McKiel]
          Length = 560

 Score =  414 bits (1063), Expect = e-113,   Method: Composition-based stats.
 Identities = 237/562 (42%), Positives = 344/562 (61%), Gaps = 4/562 (0%)

Query: 1   MERNW-NYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLID 59
           M  N  N   AI LS+ I++ WQ F V P  ++   +    +      Q   +      D
Sbjct: 1   MNNNIMNLIAAIVLSLSIIFGWQYFVVKPEHKKQQQQIAMQKAENLKKQKLKALIKPASD 60

Query: 60  DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNA 119
              Q  +   R+++++ SL GSI+LKG +FDDL L+ Y  D+S NS  V L SP+NT+NA
Sbjct: 61  LVVQEANQVQRIKIESESLTGSISLKGLRFDDLILKKYKQDLSKNSTEVRLFSPANTENA 120

Query: 120 YFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYL 179
           YFAE+  VS  ++++LPN++T+WN   G+IL+P  P+ L + N + + F  TI+LDE+YL
Sbjct: 121 YFAEIGLVSNLSSVKLPNNDTIWN-SDGEILSPEKPVNLFWVNEDGVKFLVTITLDENYL 179

Query: 180 FKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEK 239
           F +  T+ NNS  ++     G I R           + +G I  + +           +K
Sbjct: 180 FTVEQTIVNNSDKELPVQSYGLINRKYIAVEKAVNILHQGPIGCINENLKEYSYDDIKDK 239

Query: 240 SSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILP 298
            S         W+G++DKYW S  IP K +++ S F Y L+ G  RYQ  F +    I  
Sbjct: 240 KSEKFVASKVDWIGMTDKYWLSSLIPDKSSNYSSNFNYALTQGVERYQVDFISPVQIIKS 299

Query: 299 GKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVG 358
           G++ + T+ +FAGAK+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY  VG
Sbjct: 300 GENFSITSRIFAGAKKVDLLDKYEKQYGIKLFDRAIDFGWFYIITKPVFYAMNFFYGYVG 359

Query: 359 NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQL 418
           NFGI+I++ TV +KLL F LA K Y S   MKN+QP+ID ++  +       L + ++ L
Sbjct: 360 NFGISILIVTVIIKLLMFTLANKSYCSMKKMKNLQPEIDRIKNLYGDDKA-RLNQEIMAL 418

Query: 419 YKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFG 478
           YK   +NP+AGC PIL+QIPVFF+IYKV+ +++EMR APF+GWIKDL+A DPT IF LFG
Sbjct: 419 YKKEKVNPVAGCLPILVQIPVFFSIYKVLYVTIEMRQAPFYGWIKDLSAPDPTTIFNLFG 478

Query: 479 ILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGL 538
            LPF  P F+ +G WPI+M+++MF+Q +MSP PAD  QA ++ +MP++F+   SSFP GL
Sbjct: 479 FLPFSPPSFLMIGAWPILMAITMFLQQRMSPEPADPVQAQVMKFMPLIFLVMFSSFPVGL 538

Query: 539 IIYWSWSNVISIVQQAVIMKMH 560
           +IYWSW+N++SI+QQ  I K +
Sbjct: 539 LIYWSWNNILSIIQQYYINKFN 560


>gi|91204826|ref|YP_537181.1| putative inner membrane protein translocase component YidC
           [Rickettsia bellii RML369-C]
 gi|157826396|ref|YP_001495460.1| putative inner membrane protein translocase component YidC
           [Rickettsia bellii OSU 85-389]
 gi|122426155|sp|Q1RKM2|OXAA_RICBR RecName: Full=Inner membrane protein oxaA
 gi|166977407|sp|A8GUC7|OXAA_RICB8 RecName: Full=Inner membrane protein oxaA
 gi|91068370|gb|ABE04092.1| Preprotein translocase subunit YidC [Rickettsia bellii RML369-C]
 gi|157801700|gb|ABV78423.1| putative inner membrane protein translocase component YidC
           [Rickettsia bellii OSU 85-389]
          Length = 559

 Score =  412 bits (1057), Expect = e-112,   Method: Composition-based stats.
 Identities = 235/560 (41%), Positives = 344/560 (61%), Gaps = 6/560 (1%)

Query: 1   MERN-WNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLID 59
           M  N  N   AI LS+ I++ WQ F V P+ ++   +    +      +      A  + 
Sbjct: 1   MNNNIVNLVAAIVLSLGIIFGWQYFIVKPQQQKQQQQIALQKAKDLKKKESAQLEATPVI 60

Query: 60  DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNA 119
            +    S +PR+++ + +L GSI+LKG +FDDL L+ Y  D+S NSP V L SPS+TK+A
Sbjct: 61  VQEA--SQAPRIKIDSNALSGSISLKGLRFDDLILKKYKQDLSENSPEVVLFSPSDTKDA 118

Query: 120 YFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYL 179
           YFAE+ +VS  ++++LPN+ T+WN    +ILTP  P+ L + N + + F   I++DE+YL
Sbjct: 119 YFAEIGWVSNLSSVKLPNNETIWN-SDSEILTPEKPVNLFWVNEDGVKFLVAITVDENYL 177

Query: 180 FKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEK 239
           F I  T+ NNS  ++     G I R           + +G I  + +           +K
Sbjct: 178 FTIEQTIVNNSNQELPVQSYGLINRKYTAVEKAVNILHQGPIGCIDENLKEYSYDDIKDK 237

Query: 240 SSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILP 298
            S         W+GI+DKYW +  IP K +++ S F Y +     RYQ  F +    + P
Sbjct: 238 KSEKFSASKVDWIGITDKYWLTSLIPDKSSNYSSNFNYAVKQEVERYQVDFISPVQIVKP 297

Query: 299 GKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVG 358
           G++ +    LFAGAK+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY  VG
Sbjct: 298 GENFSIKGRLFAGAKKVDLLDKYEKQYDIKLFDRAIDFGWFYIITKPVFYAMNFFYKYVG 357

Query: 359 NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQL 418
           NFGI+I++ TV +KLL F LA K Y S   MKN+QP+I+ ++  +       L + ++ L
Sbjct: 358 NFGISILIVTVIIKLLMFTLANKSYRSMKRMKNLQPEINRIKNLYGDDKA-RLNQEIMAL 416

Query: 419 YKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFG 478
           YK   +NP+AGC PIL+QIPVFF+IYKV+ +++EMR APF+GWIKDL+A DPT+IF LFG
Sbjct: 417 YKKEKVNPVAGCLPILVQIPVFFSIYKVLYVTIEMRQAPFYGWIKDLSAPDPTSIFNLFG 476

Query: 479 ILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGL 538
           +L F LP F+ +G WPI+M+++MF+Q +MSP PAD  QA ++ +MP+VF+   SSFPAGL
Sbjct: 477 LLHFSLPSFLMIGAWPILMAITMFLQQRMSPEPADPVQAQVMKFMPLVFLVMFSSFPAGL 536

Query: 539 IIYWSWSNVISIVQQAVIMK 558
           +IYWSW+N++SI+QQ  I K
Sbjct: 537 LIYWSWNNILSIIQQYYINK 556


>gi|294085069|ref|YP_003551829.1| 60 kDa inner membrane insertion protein [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292664644|gb|ADE39745.1| 60 kDa inner membrane insertion protein [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 592

 Score =  411 bits (1055), Expect = e-112,   Method: Composition-based stats.
 Identities = 210/588 (35%), Positives = 334/588 (56%), Gaps = 34/588 (5%)

Query: 3   RNWNYFVAIALSVIIVYAWQNFYVYPRIEEMN-----------------------NERKN 39
            N N  +AIALS+++++ WQ F + P++E+                         ++  +
Sbjct: 4   DNRNLILAIALSMVVLFGWQMFVIKPQLEQEAAQQELLAAQAQAEAALQASQQADSDTPS 63

Query: 40  IQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHL 99
           +      N   N+ A       A+    +PR+ +  P + GSI++ GA+ DD+ L  Y  
Sbjct: 64  VAQSSGSNVAVNNGAVSGGISDAKPQDTAPRILIDAPLITGSISVMGARIDDVVLTDYKE 123

Query: 100 DVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLV 159
                S  +T L  +++   +F E  + S+  N  +P ++T+W   +  +L+P  P+ L 
Sbjct: 124 TQDPESKNITFLHKASSSQPFFVEFGWSSSDANQPMPRADTLWQ-TNKDVLSPGAPVTLR 182

Query: 160 FKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEG 219
           + N   + F R IS+++ YL    D+V +     I   P G + RH     +  + + EG
Sbjct: 183 WDNGQGLTFIRQISINDDYLISYDDSVQSTLDAAITLFPYGLVRRHGTPPTSGIYILHEG 242

Query: 220 FIAVLGDKSLVEQKYSDIEKSSISNFHESN----SWLGISDKYWASVFIPSKETSFHSQF 275
            + V   ++L E+ YSD+  +       +      W+G++DKYW +  +P + T +   F
Sbjct: 243 PLGVFD-ETLQEEDYSDLRDAEQGKIAVTPSKAGGWIGLTDKYWLAALLPDQNTRYDFSF 301

Query: 276 KYLSDGHARYQAKFS-ANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLI 334
           + L+    RYQ  +  +  + + P  S++    +FAGAK    +  Y +DL IP F++ I
Sbjct: 302 QSLAGSGERYQVDYIDSKGLVLAPNTSVSAKGRVFAGAKIVKLLDQYREDLGIPNFDLAI 361

Query: 335 DWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQP 394
           D+GWFYF+ KP F  +++   L+GNFG+A +  TV VK++FFPLA K Y S   M+ + P
Sbjct: 362 DFGWFYFLTKPFFYAINWLNELLGNFGLATIAFTVVVKVVFFPLANKSYQSMGKMRLLAP 421

Query: 395 KIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMR 454
           KI +LRE+F       L K M+ LYK   +NP AGC P+LLQIPVFFA+YKV+ +++EMR
Sbjct: 422 KIQQLRERF-GEDKMALNKEMMALYKAEKVNPAAGCLPVLLQIPVFFALYKVLFVTIEMR 480

Query: 455 HAPFWGWIKDLAAADPTNIFTLFGILPFYL---PGFMHVGIWPIIMSLSMFIQMKMSPPP 511
           HAPF+GWI DL+A DPT+IF +FG+LPF +   P F+ +G WPI+M +SMF+QM+++P P
Sbjct: 481 HAPFFGWITDLSAPDPTSIFNVFGLLPFSVDFLPPFLQLGAWPIMMGVSMFLQMRLNPAP 540

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKM 559
            D  QA +   MP+ F F L++FPAGL+IYW+W+N++S+ QQ  IM+ 
Sbjct: 541 PDPIQAKVFQLMPIFFTFLLATFPAGLVIYWTWNNLLSMGQQWYIMRR 588


>gi|294675902|ref|YP_003576517.1| inner membrane protein OxaA [Rhodobacter capsulatus SB 1003]
 gi|294474722|gb|ADE84110.1| inner membrane protein OxaA [Rhodobacter capsulatus SB 1003]
          Length = 615

 Score =  411 bits (1055), Expect = e-112,   Method: Composition-based stats.
 Identities = 222/618 (35%), Positives = 326/618 (52%), Gaps = 44/618 (7%)

Query: 1   ME-RNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLID 59
           M+ +N N  +A  LS +++  W  F+  P+ E  +           P     + AA  ++
Sbjct: 1   MDNQNRNLILATVLSALVIVVWTVFFPPPKPEPTDPAVAEQTATPAPTAAPVATAAPAVE 60

Query: 60  DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPS----- 114
              +A    PRV +  P+L GSI+L GA+FDDL+L+ YH  +   SP+V LL+P      
Sbjct: 61  PAPEA----PRVTIDTPALTGSISLLGARFDDLSLKHYHEKLDPASPLVRLLAPVGGSDL 116

Query: 115 NTKNAYFAELDYVSTAN--NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTI 172
           N    Y+    + + A     ++P   T+W   +G  LTP TP+ L + N   + F RTI
Sbjct: 117 NAAKPYYVVQGWSALAGVTAAQVPGPKTLWTAPAGAKLTPETPLVLTWDNGAGLTFTRTI 176

Query: 173 SLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLG----DKS 228
           ++D  YLF + D VTN     +  +P G I RH        + + EG + +      +  
Sbjct: 177 AVDPQYLFTVTDAVTNTGAAAVSIAPWGIIARHGIPAGNRVYVLHEGAVRMTNGELQEIK 236

Query: 229 LVEQKYSDIEKSSISNFHESN---SWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARY 285
             +    D  +        S     W G +DKYW +  IP     F S  KY+      Y
Sbjct: 237 YKKITDLDALEGEGQADVRSADTGGWAGFTDKYWMTTLIPDT-ARFTSVVKYVPSA-DLY 294

Query: 286 QAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLA----------------IPR 329
           Q +     + I  G S + T  LFAGAKE+  I  Y+ D                  I R
Sbjct: 295 QTETRQPAVEIAAGASTSVTMRLFAGAKEWEAIAQYQNDPGMFDRLFGDKIDPTQPQITR 354

Query: 330 FEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANM 389
           F   IDWGW+YF+ KPMF L+ + + ++GN G AI+  TV +KL+ FPLA+  Y+S A M
Sbjct: 355 FVDSIDWGWYYFLTKPMFRLLHWLHAVLGNMGWAIIALTVIIKLIVFPLARTSYISMAKM 414

Query: 390 KNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISI 449
           K IQP ++ L+E+ K    Q LQ+ M++LYK   INP AGC PILLQIP+FF++YKVI +
Sbjct: 415 KEIQPAMEALKERTKDDK-QALQRGMMELYKREKINPAAGCLPILLQIPIFFSLYKVIYV 473

Query: 450 SLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLP------GFMHVGIWPIIMSLSMFI 503
           ++E+ HAP+ GWIKDL+A DP++I  LFG+LP+  P          +G+ PI++ +SM+ 
Sbjct: 474 TIELYHAPWIGWIKDLSAPDPSSILNLFGLLPYATPEPGSLLFIFSLGVLPILLGISMWF 533

Query: 504 QMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           Q K++P P D  QA I  WMP +F+F L  F +GL++YW  +NVI+ +QQ  IM +HG  
Sbjct: 534 QQKLNPAPTDPSQAAIFAWMPWIFMFMLGGFASGLVLYWIANNVITFIQQYSIMSLHGKR 593

Query: 564 IGLIDRLRSTFSKNYNSQ 581
             L   + + F K    +
Sbjct: 594 PDLFGNIIAGFRKKTAEE 611


>gi|157964113|ref|YP_001498937.1| putative inner membrane protein translocase component YidC
           [Rickettsia massiliae MTU5]
 gi|166977409|sp|A8F0F4|OXAA_RICM5 RecName: Full=Inner membrane protein oxaA
 gi|157843889|gb|ABV84390.1| Preprotein translocase subunit YidC [Rickettsia massiliae MTU5]
          Length = 560

 Score =  411 bits (1055), Expect = e-112,   Method: Composition-based stats.
 Identities = 238/562 (42%), Positives = 342/562 (60%), Gaps = 4/562 (0%)

Query: 1   MERNW-NYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLID 59
           M  N  N   AI LS+ I++ WQ F V P  ++   +    +      Q   +       
Sbjct: 1   MNNNIINLVAAIILSLSIIFGWQYFVVKPEQKKQQQQIAVQKAENLKKQQLKALVEPATG 60

Query: 60  DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNA 119
              Q  S   R+++++ SL GSI+LKG +FDDL L+ Y  D+S NSP V L SPSNT+NA
Sbjct: 61  IVVQEESQIQRIKIESESLTGSISLKGLRFDDLILKKYKQDLSKNSPEVRLFSPSNTENA 120

Query: 120 YFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYL 179
           YFAE+  VS  ++++LPN++T+WN    +IL+P  P+ L + N + + F  TI++DE+YL
Sbjct: 121 YFAEIGLVSNLSSVKLPNNDTIWN-SDSEILSPEKPVHLFWVNEDGVKFLVTITVDENYL 179

Query: 180 FKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEK 239
           F I  T+ N S  ++     G I R           + +G I  + +           +K
Sbjct: 180 FTIEQTIVNYSDKELPVQSYGLINRKYIAVEKAVNILHQGPIGCIDENLKEYSYDDIKDK 239

Query: 240 SSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILP 298
            S         W+GI+DKYW S  IP K +++ S F Y L  G  RYQ  F +    I P
Sbjct: 240 KSEKFAASKVDWIGITDKYWLSSLIPDKSSNYSSNFNYALKQGTERYQVDFISPVQIIKP 299

Query: 299 GKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVG 358
           G++ +  + +FAGAK+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY  VG
Sbjct: 300 GENFSIKSRIFAGAKKVDLLDKYEKQYDIKLFDRAIDFGWFYIITKPVFYAMNFFYGYVG 359

Query: 359 NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQL 418
           NFG++I++ TV +KLL F LA K Y S   MKN+QP+ID ++  +       L + ++ L
Sbjct: 360 NFGVSILIVTVIIKLLMFTLANKSYRSMKKMKNLQPEIDRIKNLYSDDKA-RLNQEIMAL 418

Query: 419 YKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFG 478
           YK   +NP+AGC PIL+QIPVFF+IYKV+ +++EMR  PF+GWIKDL+A DPT IF LFG
Sbjct: 419 YKKEKVNPVAGCLPILVQIPVFFSIYKVLYVTIEMRQTPFYGWIKDLSAPDPTTIFNLFG 478

Query: 479 ILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGL 538
           +LPF  P F+ +G WPI+M+++MF+Q KMSP PAD  QA ++ +MP++F+F  SSFP GL
Sbjct: 479 LLPFSPPSFLMIGAWPILMAITMFLQQKMSPEPADPMQAQVMKFMPLIFLFMFSSFPVGL 538

Query: 539 IIYWSWSNVISIVQQAVIMKMH 560
           +IYWSW+N++SI+QQ  I K +
Sbjct: 539 LIYWSWNNILSIIQQYYINKFN 560


>gi|114770125|ref|ZP_01447663.1| putative inner membrane protein translocase component YidC [alpha
           proteobacterium HTCC2255]
 gi|114548962|gb|EAU51845.1| putative inner membrane protein translocase component YidC [alpha
           proteobacterium HTCC2255]
          Length = 612

 Score =  411 bits (1055), Expect = e-112,   Method: Composition-based stats.
 Identities = 215/609 (35%), Positives = 341/609 (55%), Gaps = 37/609 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNER--------KNIQTVKQPNQVDNSY 53
           + N N  +A  LS++++  W  F+     + +   +            T         + 
Sbjct: 4   DNNKNMILASVLSMLVLLTWFYFFPQEDYQPVATNQITASENGIAAAPTAGNGIASAPAI 63

Query: 54  AAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSP 113
           +  + + R  AL  + RVE+++  + GS++L GA+ DDL L  Y++ ++  S  VTLLSP
Sbjct: 64  STTVAETREIALEKTKRVEIRSNRIKGSLSLTGARIDDLKLLDYNVKLNDTSEKVTLLSP 123

Query: 114 SNTKNAYFAELDYVSTANNI--ELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERT 171
           +   +AY+    +    +    ++P + T+W++ +G ILTP + + L + N+N ++F R 
Sbjct: 124 AGGPSAYYILHGFSPAGSLDFDDVPTATTIWSVENGNILTPNSSVTLKWDNSNGLVFYRK 183

Query: 172 ISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKP---------QTATNTFGVQEGFIA 222
           I +D+ Y+F I  +V NN+   I  +P G I +  P         +++ N   +    I 
Sbjct: 184 IEVDDDYMFTITQSVQNNTNANISLAPYGLIAQKGPIARAAYGRQESSKNGVYILHEGIV 243

Query: 223 VLGDKSLVEQKYSDIEKSSISNFHE---------SNSWLGISDKYWASVFIPSKETSFHS 273
           +    SL E  YSD+     S+               W+G + KYW +  IP   ++F +
Sbjct: 244 LQTGSSLEEIDYSDMPDEDFSSSERANLKVVDSTKKGWIGFTGKYWMTTLIPD-NSAFKA 302

Query: 274 QFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEML 333
             KY  +G  RYQA+     I IL G+     + LFAGAKE+ TI HY     +  F   
Sbjct: 303 VSKYT-EGADRYQAEARQETIQILAGQRRDVQSRLFAGAKEYATIQHYGDKEGVTDFVDS 361

Query: 334 IDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQ 393
           IDWG F+FI KPMF L+ +   L+GN G AI+  T+ +K + FPLA K +VS A MK +Q
Sbjct: 362 IDWGMFFFITKPMFALLHFLNGLIGNMGWAIIALTLIIKTILFPLAYKSFVSMARMKELQ 421

Query: 394 PKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEM 453
           P++++L+EK      Q +QKA +++Y+T  +NP AGC PILLQIP+FF++YKVI ++LE+
Sbjct: 422 PEMEKLKEKH-GEDRQAMQKATMEMYRTKKVNPAAGCLPILLQIPIFFSLYKVIFVTLEL 480

Query: 454 RHAPFWGWIKDLAAADPTNIFTLFGILPFYLPG------FMHVGIWPIIMSLSMFIQMKM 507
           RHAPF GW+KDL+  DP+++  LFG++P+  PG       + +G+WPI+M ++M++Q K+
Sbjct: 481 RHAPFIGWLKDLSVPDPSSLLNLFGLMPWDAPGPNSFFVILSIGVWPILMGITMWLQQKL 540

Query: 508 SPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLI 567
           +P P DK QAMI  WMP VF+F L  F +GL+IYW  +N ++ +QQ  IM+  G    ++
Sbjct: 541 NPAPTDKTQAMIFAWMPWVFMFMLGGFASGLVIYWVANNTLTFMQQYTIMRSQGVNPDIL 600

Query: 568 DRLRSTFSK 576
             +   F K
Sbjct: 601 GNMFKRFKK 609


>gi|85374954|ref|YP_459016.1| putative inner membrane protein translocase component YidC
           [Erythrobacter litoralis HTCC2594]
 gi|84788037|gb|ABC64219.1| preprotein translocase subunit [Erythrobacter litoralis HTCC2594]
          Length = 581

 Score =  411 bits (1055), Expect = e-112,   Method: Composition-based stats.
 Identities = 196/571 (34%), Positives = 307/571 (53%), Gaps = 18/571 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAW----QNFYVYPRIEEMNNE------RKNIQTVKQPNQVD 50
           M+   N  +A+ L  +++  W      FY  P       E         +        +D
Sbjct: 1   MDNQRNLLLAVVLCGVLIIGWDAAMNYFYPQPAEPIEAVEGSPTVASAPVAGSSTAATLD 60

Query: 51  NSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTL 110
           N  AA    + + AL+   R+ +  P + GSINL GA+ DD+ L+ +   V  +S  V +
Sbjct: 61  NGAAAQGPVELSDALATPERIRIDAPRVEGSINLVGARIDDIELKDHRATVDEDSGPVQM 120

Query: 111 LSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFER 170
            +P NT   YFA+  +V     + LP S+TVW+   G+ LT   P+ L + N     F  
Sbjct: 121 FAPQNTDAQYFAQFGWV--GEGVSLPTSDTVWS-ADGETLTQGNPVTLSWDNGAGQQFRI 177

Query: 171 TISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLV 230
             S+D++Y+     T  N     +   P   I R     +T+T+    G + V GD +  
Sbjct: 178 RFSIDDNYMITAEQTAANTGGGPVVARPFATITRTSETASTDTWIAHSGPMGVFGDSADY 237

Query: 231 EQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFS 290
              Y D+      +      WLG SD Y+    +P  +    + F+    G   ++A   
Sbjct: 238 GPDYDDLADDGPYSGEGKARWLGFSDIYFLGALVPQADADPQTGFR--PIGENLFRADVI 295

Query: 291 ANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLM 350
               T+ PG  ++ T  LFAGAKE   +  Y +D  I +F + IDWGWF +  KP+  L+
Sbjct: 296 YQPATVAPGNEVSRTTQLFAGAKESEILDQY-EDAGIDKFGLAIDWGWFRWFEKPLLWLL 354

Query: 351 SYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQV 410
           +  ++LVGNFG+AI+L TV ++ L FP+A+KQ+ S A MK +QPK+  ++EK+K    Q 
Sbjct: 355 NQLFDLVGNFGVAIILLTVIIRGLLFPIAQKQFGSMAAMKAVQPKMKAIQEKYKDDK-QK 413

Query: 411 LQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADP 470
            Q+ ++ LYK   +NPLAGC P+L+QIP+FFA+YKV+ +++EMRH PF  WI+DL+A DP
Sbjct: 414 QQQEIMALYKEEKVNPLAGCLPLLIQIPIFFALYKVLILAIEMRHQPFALWIEDLSAPDP 473

Query: 471 TNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFA 530
            +IF LFG+LPF +PG + +G   +++ ++M++  +M+P   D  Q  I N MP V +F 
Sbjct: 474 AHIFNLFGLLPFEVPGLIAIGPLAVLLGVTMWLTFQMNP-VTDPIQRQIFNIMPWVLMFI 532

Query: 531 LSSFPAGLIIYWSWSNVISIVQQAVIMKMHG 561
           ++ F AGL++YW+ SNV+++ QQ  +   H 
Sbjct: 533 MAPFAAGLLLYWNTSNVLTLAQQRYLYSKHP 563


>gi|15603927|ref|NP_220442.1| putative inner membrane protein translocase component YidC
           [Rickettsia prowazekii str. Madrid E]
 gi|38503265|sp|Q9ZE97|OXAA_RICPR RecName: Full=Inner membrane protein oxaA
 gi|3860618|emb|CAA14519.1| 60 KD INNER-MEMBRANE PROTEIN (yidC) [Rickettsia prowazekii]
 gi|292571645|gb|ADE29560.1| Preprotein translocase subunit YidC [Rickettsia prowazekii Rp22]
          Length = 560

 Score =  410 bits (1053), Expect = e-112,   Method: Composition-based stats.
 Identities = 241/562 (42%), Positives = 344/562 (61%), Gaps = 4/562 (0%)

Query: 1   MERNW-NYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLID 59
           M  N  N   A+ LS+ I++ WQ F+V P  ++        ++     Q   + A    D
Sbjct: 1   MNNNIINLIAAVVLSLSIIFGWQYFFVKPEQKKQQQRIAMHKSENLNKQKLKALAEPASD 60

Query: 60  DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNA 119
              Q  S   R+++++ SL GSI LKG +FDDL L+ Y  D+S NSP V L SP+NT+NA
Sbjct: 61  IAVQEASQVQRIKIESESLTGSIALKGLRFDDLILKKYKQDLSQNSPAVRLFSPANTENA 120

Query: 120 YFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYL 179
           YFAE+  VS  N+++LPNSNTVWN    ++L+P  P+ L + N + I F  TI++D++YL
Sbjct: 121 YFAEIGLVSNLNSVKLPNSNTVWN-SDSEVLSPEKPVNLFWINEDGIKFLVTITVDKNYL 179

Query: 180 FKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEK 239
           F I  T+ NNS  ++     G I R           + +G I  + +           +K
Sbjct: 180 FTIEQTIINNSDKELPVQSYGLINRKYISLEKAVNILHQGPIGCIDENLKEYSYDDIKDK 239

Query: 240 SSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILP 298
            S         W+GI+DKYW S  IP K + + S F Y L  G  RYQ  F +    I P
Sbjct: 240 KSTKFALSKVDWIGITDKYWLSSLIPDKSSRYSSNFNYALKQGTERYQVDFISPVQVIKP 299

Query: 299 GKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVG 358
           G++++  + +FAGAK+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY  VG
Sbjct: 300 GENLSIKSRIFAGAKKVDLLDEYEKSYDIKLFDRAIDFGWFYIITKPVFYAMNFFYGYVG 359

Query: 359 NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQL 418
           NFGI+I++ TV +KLL F LA K Y S   MKN+QP+ID ++  +       L + ++ L
Sbjct: 360 NFGISILIVTVIIKLLMFTLANKSYRSMKKMKNLQPEIDRIKNLYNNDKA-RLNQEIMAL 418

Query: 419 YKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFG 478
           YK   +NP+AGC PIL+QIPVFF+IYKV+ +++EMR APF+GWIKDL++ DPT IF LFG
Sbjct: 419 YKKEKVNPVAGCLPILVQIPVFFSIYKVLYVTIEMRQAPFFGWIKDLSSPDPTTIFNLFG 478

Query: 479 ILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGL 538
           +LPF  P F+ +G WPI+M+++MF+  KMSP  AD  QA ++ +MP++F+F  SSFP GL
Sbjct: 479 LLPFAPPSFLMIGAWPILMAITMFLHQKMSPELADPIQAQVMKFMPLIFLFMFSSFPVGL 538

Query: 539 IIYWSWSNVISIVQQAVIMKMH 560
           +IYWSW+N++SI+QQ  I K +
Sbjct: 539 LIYWSWNNILSIIQQYYINKFN 560


>gi|262277963|ref|ZP_06055756.1| 60 kDa inner membrane insertion protein [alpha proteobacterium
           HIMB114]
 gi|262225066|gb|EEY75525.1| 60 kDa inner membrane insertion protein [alpha proteobacterium
           HIMB114]
          Length = 560

 Score =  410 bits (1052), Expect = e-112,   Method: Composition-based stats.
 Identities = 207/566 (36%), Positives = 326/566 (57%), Gaps = 10/566 (1%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD- 60
             N N   A+ LS  ++  WQ +Y  P  +  N E+   Q +K       S +   ++  
Sbjct: 1   MENKNVLAAVVLSTFVIMMWQFWYGEPVPQTQNQEQVQQQQLKGDKPSAPSISQKKVETK 60

Query: 61  --RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
             R+ A++   R++++N ++ GSI L GA  DD+ L+ Y+ D + +   V LL+P     
Sbjct: 61  LTRSDAINQGDRIKIENSAVEGSIALTGALIDDVTLKNYNQDNTGDQTKVILLNPKKYDQ 120

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHY 178
           AYF E  +  T+ N  +P++ T+W     K LTP TP++L + N   + F +  ++D+ Y
Sbjct: 121 AYFLETGWA-TSGNEIVPDNQTLWTAKGNKTLTPNTPVELEWNNGQGLTFIKKFTIDDQY 179

Query: 179 LFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIE 238
           L  I + + NNS   +      +I R +     + F + EG + ++ +    E    D  
Sbjct: 180 LITINEEIKNNSNQTVNLFHYAQITRQEKPEIQDFFILHEGLLGIVDETLTEE--DYDDI 237

Query: 239 KSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILP 298
                 F+ S  W+GI+DKYW +  IP K  +F ++F Y     + Y      +  TI  
Sbjct: 238 VEKKKTFNGSQGWVGITDKYWLTAIIPEKGKNFKAEFSYDKSFKSNYII---TDATTINV 294

Query: 299 GKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVG 358
            ++ +  + LF GAKE   I  Y       +F++ IDWGWF+F  KP+F ++ Y +   G
Sbjct: 295 NQTGSNISNLFIGAKEVSVIDGYTASNGFHKFDLAIDWGWFHFFTKPLFFIIDYLFKWCG 354

Query: 359 NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQL 418
           NFGIAI+L T  V+L+FFPLA   + S A MK +QP++  L++ +K+   Q +Q  M+ L
Sbjct: 355 NFGIAIILLTAGVRLIFFPLANYSFASMAKMKALQPEMQRLKDLYKEDK-QKIQMEMMNL 413

Query: 419 YKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFG 478
           YK   +NP++GC P++LQIP FFAIYK++ +++EMRHAPF+GWI+DL+AADPT+IF LFG
Sbjct: 414 YKREKVNPISGCLPVMLQIPFFFAIYKMLFVTIEMRHAPFYGWIQDLSAADPTSIFNLFG 473

Query: 479 ILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGL 538
           ++P+  PGF+ +G WPIIM ++M+IQ K++P P D  QA I  + P      L+SFP+GL
Sbjct: 474 LIPWDPPGFLIIGAWPIIMGVTMYIQQKLNPAPPDPIQAKIFMFFPFFLTILLASFPSGL 533

Query: 539 IIYWSWSNVISIVQQAVIMKMHGAEI 564
           +IYWS +NV+++ QQ VI++    + 
Sbjct: 534 VIYWSVNNVLTMAQQYVIIRKTKVKT 559


>gi|103485502|ref|YP_615063.1| putative inner membrane protein translocase component YidC
           [Sphingopyxis alaskensis RB2256]
 gi|98975579|gb|ABF51730.1| 60 kDa inner membrane insertion protein [Sphingopyxis alaskensis
           RB2256]
          Length = 584

 Score =  408 bits (1049), Expect = e-112,   Method: Composition-based stats.
 Identities = 204/583 (34%), Positives = 313/583 (53%), Gaps = 27/583 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQN----FYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAV 56
           M+   N   AI LSV I+  W      F+  P   ++                     + 
Sbjct: 1   MDDKRNLIAAILLSVAILIGWNFVAERFFPTPDQPDVTKTVAGANGAPATAPTAQGQPSA 60

Query: 57  LID-------------DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSS 103
           L                    L+   R+ ++ P++ GSINL GA+ DD+ L  Y   +  
Sbjct: 61  LPAPTAATPAAAQAIRPVDVVLAEGQRIPIETPAIRGSINLVGARIDDITLTKYRQTIKK 120

Query: 104 NSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNA 163
           +SP V L +P  T  AYFA L +  TA  I+LP + TVW   +G  LTPTTP+ L + N 
Sbjct: 121 DSPAVRLFAPGGTPAAYFASLGW--TAQGIQLPGAGTVWT-ANGTKLTPTTPVTLSWTNT 177

Query: 164 NNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTAT---NTFGVQEGF 220
               F    S+D +YL     TV N     +  S    I R    T     +++ +  G 
Sbjct: 178 TGQTFRIEYSIDANYLITAKQTVVNAGTAPVSLSSFALIDRLGKPTDPHEVDSWTIHVGP 237

Query: 221 IAVLGDKSLVEQKYSDIEKSSISNF-HESNSWLGISDKYWASVFIPSKETSFHSQFKYLS 279
              L  KS+ +  Y D+E++   +  + S  WLG +DKYW +  +P+K     +      
Sbjct: 238 TGYLDGKSVFDIDYDDLEEAPNRSVRYTSAGWLGFTDKYWLAAIVPAKGERVTAAISSP- 296

Query: 280 DGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWF 339
                YQ  F+ +   + PG+ +T T+ +FAGAKE   +  Y+ D  I R    IDWGWF
Sbjct: 297 -ATNNYQTLFARDFTQVAPGQQLTATSRIFAGAKEVEILETYQDDQGITRLSNAIDWGWF 355

Query: 340 YFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDEL 399
            F   P+F L+ + +  VGNFG+AIM  T+ ++LL FP+A +Q+ S A M+ +QPK+  L
Sbjct: 356 EFFEVPIFKLLHWLFEKVGNFGLAIMALTLIIRLLMFPIANRQFSSMAQMRVVQPKMKAL 415

Query: 400 REKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFW 459
           +E++K   P  +Q+ +++LYK   INPLAGC PI++QIP+F+A+YKV+ +++EMRH PF 
Sbjct: 416 QERYKDDKP-RMQQELMKLYKDEKINPLAGCLPIVIQIPIFYALYKVLMLAIEMRHQPFI 474

Query: 460 GWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMI 519
            WIKDL+A DP +I  LFG+LPF  P  + +G+  +I+ ++M++Q +++P PAD  QA +
Sbjct: 475 LWIKDLSAPDPLHILNLFGLLPFTPPSILAIGLLAVILGVTMWLQFRLNPAPADPVQAQV 534

Query: 520 LNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
              MP +F+F ++ F AGL++YW  +N++SI QQ  + +   A
Sbjct: 535 FKIMPWLFMFIMAPFAAGLLLYWITNNILSIGQQQWMYRKFPA 577


>gi|83859293|ref|ZP_00952814.1| putative inner membrane protein translocase component YidC
           [Oceanicaulis alexandrii HTCC2633]
 gi|83852740|gb|EAP90593.1| putative inner membrane protein translocase component YidC
           [Oceanicaulis alexandrii HTCC2633]
          Length = 672

 Score =  407 bits (1045), Expect = e-111,   Method: Composition-based stats.
 Identities = 223/595 (37%), Positives = 347/595 (58%), Gaps = 23/595 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYP------RIEEMNNERKNIQTVKQPNQVDNSYA 54
           M  N N+ +A  +++ I++ +Q F + P        E+   E +  +T     Q  +S  
Sbjct: 1   MGENRNFLLAAVIAIGILFFYQAFILDPMARDREAAEQATAETQVQETGDDAPQATDSGF 60

Query: 55  AV----LIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTL 110
           A         R  AL+ S R+E++  +L GS++L GA+ DDL L  Y  +V S  P VTL
Sbjct: 61  AAGLGENGMSREDALARSQRIEIRTEALSGSLSLTGARIDDLQLLRYETEVDSGVP-VTL 119

Query: 111 LSPSNTKNAYFAELDYVSTANNIE-LPNSNTVWNLISGKILTPTTPIKLVFKNANNILFE 169
           +SP       FA   ++  AN  + LP  +T W L+ G +LT TTP+ L     + + F 
Sbjct: 120 MSPEGFDGYQFAASGWLGGANAPQGLPGLSTNWTLVEGDVLTETTPVVLEHAAGD-LTFR 178

Query: 170 RTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHK-PQTATNTFGVQEGFIAVLGDKS 228
           RTIS+DE+YLF + DTV NN    +   P   + +H  P    N F + EG + V+    
Sbjct: 179 RTISVDENYLFTVNDTVINNGSAAVSLRPYALVRQHGVPADLQNFFVLHEGAVGVIDGTH 238

Query: 229 LVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLS-DGHARYQA 287
             ++K+   E   +   +    W+GI+ KYW +   P  + +  +QF+ +S      +++
Sbjct: 239 F-DRKFKKWEDEGLIERNGPGGWMGITSKYWLAAVAPEGQPNVRAQFRVVSRPDRPVFES 297

Query: 288 KFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMF 347
            + ++  T+ PG ++ +T+++FAGAK+ P +  YE DL I R  M IDWG F+F+ +P F
Sbjct: 298 NYLSDAETLAPGATLESTSYVFAGAKKQPILAAYENDLGIDRLTMAIDWGMFWFLTRPFF 357

Query: 348 MLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSP 407
             + +FY ++GN+G+AIM+ T+ +KL+ FPL  + + S A M++  PK+ E+RE++K   
Sbjct: 358 AALHFFYGVLGNYGLAIMVVTLLIKLVLFPLNNRAFASMAKMRSAAPKMTEIRERYKD-D 416

Query: 408 PQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAA 467
           PQ  QKAM++LY+   INP+AGC P+L QIP+FFA+YK + ISL+ RHAPF+GWI+D++A
Sbjct: 417 PQAQQKAMMELYRKERINPVAGCLPMLPQIPIFFALYKTVFISLDARHAPFFGWIQDMSA 476

Query: 468 ADPTNIFTLFGILPFYLPG------FMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILN 521
            DPT I  LFG+LP+   G       + +G+WP++M ++M+ Q  ++PPPADK Q  I  
Sbjct: 477 PDPTMIGNLFGLLPYDPSGLPIVGPILAIGVWPLLMGVTMWAQQSLNPPPADKIQRQIFA 536

Query: 522 WMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSK 576
           +MPV+F   ++ FPA LIIYWSW+N ++I QQ +IM+  G    L        SK
Sbjct: 537 FMPVIFTIIMAPFPAALIIYWSWNNTLTIGQQYLIMRRQGVVTELDRNFFKLRSK 591


>gi|157825202|ref|YP_001492922.1| putative inner membrane protein translocase component YidC
           [Rickettsia akari str. Hartford]
 gi|166977406|sp|A8GLY9|OXAA_RICAH RecName: Full=Inner membrane protein oxaA
 gi|157799160|gb|ABV74414.1| putative inner membrane protein translocase component YidC
           [Rickettsia akari str. Hartford]
          Length = 560

 Score =  406 bits (1042), Expect = e-111,   Method: Composition-based stats.
 Identities = 231/562 (41%), Positives = 343/562 (61%), Gaps = 4/562 (0%)

Query: 1   MERNW-NYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLID 59
           M  N  N   AI LS+ I++ WQ F + P  ++   +    +      Q   +      D
Sbjct: 1   MNNNIINLIAAIVLSLSIIFGWQYFVIKPEQKKQQQQIAVQKAANLKKQQLKALVEPATD 60

Query: 60  DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNA 119
              Q  S   R+++++ SL GSI+LKG +FDDL L+ Y  D+S NS  V L SP+NT+++
Sbjct: 61  IVVQEESQVQRIKIESESLTGSISLKGLRFDDLILKKYKQDLSKNSSDVVLFSPTNTEHS 120

Query: 120 YFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYL 179
           YFAE+  VS  ++++LPN++T+W+   G+IL+P  P+ L + N + + F  TI++D++YL
Sbjct: 121 YFAEIGLVSNLSSVKLPNNDTIWS-SDGEILSPEKPVNLFWVNEDGVKFLVTITVDKNYL 179

Query: 180 FKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEK 239
           F I  T+ NNS  ++     G I R           + +G I  + +           +K
Sbjct: 180 FTIEQTIVNNSDKELPIQSYGLINRKYTAVEKAVNILHQGPIGCIDENLKEYSYDDIKDK 239

Query: 240 SSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILP 298
            S         W+GI+DKYW S  IP K +++ S F Y +  G  +YQ  F +    I P
Sbjct: 240 KSEKFAASKVDWIGITDKYWLSALIPDKSSNYSSNFNYAVKQGIEKYQVDFISPVQIIKP 299

Query: 299 GKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVG 358
           G++    + +FAGAK+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY  VG
Sbjct: 300 GENFAIKSRIFAGAKKVDLLDQYEKQYDIKLFDRAIDFGWFYIITKPVFYAMNFFYGYVG 359

Query: 359 NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQL 418
           NFG++I++ TV +KLL F LA K Y S   +KN+QP+ID ++  +       L + ++ L
Sbjct: 360 NFGVSILIVTVIIKLLMFTLANKSYRSMKKIKNLQPEIDRIKNLYSDDKA-RLNQEIMAL 418

Query: 419 YKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFG 478
           YK   +NP+AGC PIL+QIPVFF+IYKV+ +++EMR A F+GWIKDL+A DPT IF LFG
Sbjct: 419 YKKEKVNPVAGCLPILVQIPVFFSIYKVLYVTIEMRQAQFYGWIKDLSAPDPTTIFNLFG 478

Query: 479 ILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGL 538
           +LPF  P F+ +G WPI+M+++MF+Q KMSP PAD  QA ++ +MP++F+F  SSFP GL
Sbjct: 479 LLPFSPPSFLMIGAWPILMAITMFLQQKMSPEPADPMQAQVMKFMPLIFLFMFSSFPVGL 538

Query: 539 IIYWSWSNVISIVQQAVIMKMH 560
           +IYWSW+N++SI+QQ  I K +
Sbjct: 539 LIYWSWNNILSIIQQYYINKFN 560


>gi|16125020|ref|NP_419584.1| putative inner membrane protein translocase component YidC
           [Caulobacter crescentus CB15]
 gi|221233743|ref|YP_002516179.1| inner membrane protein translocase component YidC [Caulobacter
           crescentus NA1000]
 gi|38503160|sp|Q9AA40|OXAA_CAUCR RecName: Full=Inner membrane protein oxaA
 gi|254772763|sp|B8H1E8|OXAA_CAUCN RecName: Full=Inner membrane protein oxaA
 gi|13422004|gb|AAK22752.1| 60 kd inner-membrane protein [Caulobacter crescentus CB15]
 gi|220962915|gb|ACL94271.1| inner membrane protein translocase component yidC [Caulobacter
           crescentus NA1000]
          Length = 615

 Score =  406 bits (1042), Expect = e-111,   Method: Composition-based stats.
 Identities = 213/614 (34%), Positives = 330/614 (53%), Gaps = 37/614 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQV-------DNSYA 54
             N N  + I  +  I+  +Q F + P+ ++   E +  +  +Q +          N   
Sbjct: 3   NDNKNTLMFIVSAFAILIGYQFFVLGPQQKKAEAEFRAKKAAEQQSAAKAGVTLDANGNP 62

Query: 55  AVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPS 114
           A L   R  A ++SPR+E+  P+L GSI LKGA+ DDL LR Y      +SP V L  P 
Sbjct: 63  APLRLSRDAAKALSPRIEVDTPALSGSIALKGARIDDLFLRKYDETTKKDSPPVELFRPE 122

Query: 115 NTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISL 174
             ++A+FA+  +   AN   LP+S TVW    G++L P +P+ L + N   + F R I++
Sbjct: 123 GAEHAWFADFGWAG-ANLPGLPDSRTVWTAAPGQVLRPNSPVTLTYDNGLGLTFTRVIAV 181

Query: 175 DEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNT----FGVQEGFIAVLGDKSLV 230
           D+  +F + D+V NN  + ++ +P   + R     A            G +    ++ L 
Sbjct: 182 DDQAMFTVTDSVKNNGTNGLQLAPYATVQRQGISDALGKNQIVHEGAIGVLGATDEQKLE 241

Query: 231 EQKYSDIEKSS-ISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLS-DGHARYQAK 288
             KY   +K   + +F     W GI+DKYW +  IP +  +  +Q++  +  G   Y   
Sbjct: 242 MAKYGKWKKDKPLQSFDSVGGWTGITDKYWLAALIPGQNQAIKAQYRVTNVAGIDVYDVN 301

Query: 289 FSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLA---------------IPRFEML 333
           F      + PG +++ T  LFAGAK  P +  YE                   IPRF+  
Sbjct: 302 FLGPVQVLNPGATVSQTTRLFAGAKTVPLLRKYEYGATPAPAIWEFWNKTKAEIPRFDDA 361

Query: 334 IDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQ 393
           +DWG F F  +P+F ++  FY LVGNFG+AI+L TV +KL+ +P+A K Y S A MK I 
Sbjct: 362 VDWGMFRFFTRPIFNILEVFYKLVGNFGLAILLLTVVLKLVLYPMADKSYESMAKMKKIA 421

Query: 394 PKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEM 453
           P++++L+ K K  P +  Q+ M+ LY+   INP+ GC P+L+QIPVF+A+YKV+++++EM
Sbjct: 422 PEVEKLKAKHKDDPAK-QQQEMMALYQKEKINPMMGCLPMLIQIPVFYALYKVLTVTIEM 480

Query: 454 RHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVG-------IWPIIMSLSMFIQMK 506
           RHAPF+GWI+DL+A DPT +F LFG++P+       +G       +WP++   +M++   
Sbjct: 481 RHAPFFGWIQDLSAPDPTTMFNLFGLIPWDPGSLPLIGAMIAHLGVWPLLYGFTMWLTTA 540

Query: 507 MSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGL 566
           M+PP  D  Q  I  W PV+F F LS F  GL+IYW WSNV++I QQ +IM+ +  E  +
Sbjct: 541 MNPPAGDPIQQKIFQWFPVIFTFTLSGFAVGLVIYWCWSNVLTIFQQYIIMRRYKVENPI 600

Query: 567 IDRLRSTFSKNYNS 580
              +     K   +
Sbjct: 601 DQIIARLRGKTAGA 614


>gi|304322173|ref|YP_003855816.1| 60 kDa inner membrane insertion protein [Parvularcula bermudensis
           HTCC2503]
 gi|303301075|gb|ADM10674.1| 60 kDa inner membrane insertion protein [Parvularcula bermudensis
           HTCC2503]
          Length = 589

 Score =  405 bits (1039), Expect = e-110,   Method: Composition-based stats.
 Identities = 192/594 (32%), Positives = 327/594 (55%), Gaps = 24/594 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLID- 59
           M+   N  +A+ LS ++++ ++   + P+       ++  Q +              +  
Sbjct: 1   MD--RNVIIALVLSTLLLFGYEALVLGPKRAAYLEAQEKAQAIAAEQMDPADAGETFLPG 58

Query: 60  -----DRAQALSMS-PRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSP 113
                 R QAL+    R+ ++ P+L GS+NL+G  FDDL L+ Y   ++++SP + LLSP
Sbjct: 59  TERSLSREQALAEGTARLPIETPTLSGSVNLEGLLFDDLILKTYRATLAADSPPIVLLSP 118

Query: 114 SNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTIS 173
                  F             + +    W    G +LTP TP  +V +   +I +  T++
Sbjct: 119 RTATTPQFMRAGLSIGG----VSDRTARWQAPEGAVLTPKTP-VIVTRQEGDIQYRATLA 173

Query: 174 LDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHK-PQTATNTFGVQEGFIAVLGDKSLVEQ 232
           +DE ++F++   VTN S + +   P G   +   P    N   + EG I V+    L+++
Sbjct: 174 VDEQFMFRVTYEVTNGSGETVVAQPYGAAYQRGIPADLQNFMILFEGPIGVVDH-RLMDR 232

Query: 233 KYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSAN 292
           KY  +          S  W+GI+DKYW S  IP ++T F ++          ++A +   
Sbjct: 233 KYKKLLSGGGIEDRGSGGWVGITDKYWLSAAIPPQDTPFKAELDVTDGAIPLFRASYLLE 292

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
             +I PG +I T  +L+ G+KE   +  Y+  L I RF   +DWG F F+ +P+F ++++
Sbjct: 293 TQSIAPGATIRTEAYLYGGSKEVEVLRMYQDQLGIDRFVWAVDWGHFSFLTRPIFGILAF 352

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
           F  L GN+G+AI+L T+ +K + FPLA   Y S A MK +QP++ ++RE++     +  Q
Sbjct: 353 FEGLTGNWGVAILLLTLVIKAVLFPLANMSYKSMAGMKKVQPELMKIRERYTDDKTK-QQ 411

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           + M+ LYK H INP AGC P+L Q+P+F+A+YK + +++E+RH P + +I DL+  DPT+
Sbjct: 412 QEMMALYKKHKINPAAGCLPVLAQMPIFYALYKTLFVTIELRHEP-FLYIPDLSEQDPTS 470

Query: 473 IFTLFGILPFYLP------GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVV 526
           +F LFG+LPF          F+ +GI P++M  +MF+Q+K++PPP D  Q MI   MP++
Sbjct: 471 VFNLFGLLPFDPTTVPLIGSFLGIGILPLLMGAAMFVQLKLNPPPPDPTQRMIFGLMPLI 530

Query: 527 FVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNS 580
           F+F  + F AGL++YW W+  +S++QQ +IMK  GA++ ++  ++ +F K   +
Sbjct: 531 FMFIFAPFAAGLVLYWFWNTFLSVIQQYIIMKRQGADVDILGNIKQSFGKAPQA 584


>gi|238650515|ref|YP_002916367.1| putative inner membrane protein translocase component YidC
           [Rickettsia peacockii str. Rustic]
 gi|259515722|sp|C4K168|OXAA_RICPU RecName: Full=Inner membrane protein oxaA
 gi|238624613|gb|ACR47319.1| putative inner membrane protein translocase component YidC
           [Rickettsia peacockii str. Rustic]
          Length = 560

 Score =  404 bits (1037), Expect = e-110,   Method: Composition-based stats.
 Identities = 232/548 (42%), Positives = 338/548 (61%), Gaps = 3/548 (0%)

Query: 14  SVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVEL 73
           S+ I++ WQ F V P  ++   +    +      Q   +          Q  S   R+++
Sbjct: 15  SLSIIFGWQYFVVKPEQKKQQQQIAVQKAENLKKQQLKALVEPATGIVVQEESQVQRIKI 74

Query: 74  KNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNI 133
           ++ SL GS++LKG +FDDL L+ Y  D+S NSP V L SP+NT+NAYFAE+  VS  +++
Sbjct: 75  ESESLTGSVSLKGLRFDDLILKKYKQDLSKNSPEVRLFSPANTENAYFAEVGLVSNLSSV 134

Query: 134 ELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQ 193
           +LPN++T+WN    +IL+P  P+ L + N + + F  TI++DE+YLF I  T+ NNS  +
Sbjct: 135 KLPNNDTIWN-SDSEILSPEKPVHLFWVNEDGVKFLVTITVDENYLFTIEQTIVNNSDKE 193

Query: 194 IRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLG 253
           +     G I R           + +G I  + +           +K S         W+G
Sbjct: 194 LPVQSYGLINRKYIAVEKAVNILHQGPIGCIDENLKEYSYDDIKDKKSEKFAASKVDWIG 253

Query: 254 ISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILPGKSITTTNFLFAGA 312
           I+DKYW S  IP K +++ S F Y L  G  RYQ  F +    I PG++ +  + +FAGA
Sbjct: 254 ITDKYWLSSLIPDKSSNYSSNFNYALKQGTERYQVDFISPVQIIKPGENFSIKSRIFAGA 313

Query: 313 KEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVK 372
           K+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY  VGNFG++I++ TV +K
Sbjct: 314 KKVDLLDKYEKQYDIKLFDRAIDFGWFYIITKPVFYAMNFFYGYVGNFGVSILIVTVIIK 373

Query: 373 LLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWP 432
           LL F LA K Y S   MKN+QP+ID ++  +       L + ++ LYK   +NP+AGC P
Sbjct: 374 LLMFTLANKSYRSMKKMKNLQPEIDRIKNLYSDDKA-RLNQEIMALYKKEKVNPVAGCLP 432

Query: 433 ILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGI 492
           IL+QIPVFF+IYKV+ +++EMR APF+GWIKDL+A DPT IF LFG+LPF  P F+ +G 
Sbjct: 433 ILVQIPVFFSIYKVLYVTIEMRQAPFYGWIKDLSAPDPTTIFNLFGLLPFSPPSFLMIGA 492

Query: 493 WPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQ 552
           WPI+M+++MF+Q KMSP PAD  QA ++ +MP++F+F  SSFP GL+IYWSW+N++SI+Q
Sbjct: 493 WPILMAITMFLQQKMSPEPADPMQAQVMKFMPLIFLFMFSSFPVGLLIYWSWNNILSIIQ 552

Query: 553 QAVIMKMH 560
           Q  I K +
Sbjct: 553 QYYINKFN 560


>gi|157827949|ref|YP_001494191.1| putative inner membrane protein translocase component YidC
           [Rickettsia rickettsii str. 'Sheila Smith']
 gi|166977410|sp|A8GQK8|OXAA_RICRS RecName: Full=Inner membrane protein oxaA
 gi|157800430|gb|ABV75683.1| putative inner membrane protein translocase component YidC
           [Rickettsia rickettsii str. 'Sheila Smith']
          Length = 560

 Score =  404 bits (1037), Expect = e-110,   Method: Composition-based stats.
 Identities = 234/548 (42%), Positives = 338/548 (61%), Gaps = 3/548 (0%)

Query: 14  SVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVEL 73
           S+ I++ WQ F V P  ++   +    +      Q   +          Q  S   R+++
Sbjct: 15  SLSIIFGWQYFVVKPEQKKQQQQIAVQKAENLKKQQLKALVEPATGIVVQEESQVQRIKI 74

Query: 74  KNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNI 133
           ++ SL GSI+LKG +FDDL L+ Y  D+S NSP V L SP+NT+NAYFAE+  VS  +++
Sbjct: 75  ESESLTGSISLKGLRFDDLILKKYKQDLSKNSPEVRLFSPANTENAYFAEVGLVSNLSSV 134

Query: 134 ELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQ 193
           +LPN++T+WN    +IL+P  P+ L + N + + F  TI++DE+YLF I  T+ NNS  +
Sbjct: 135 KLPNNDTIWN-SDSEILSPEKPVHLFWVNEDGVKFLVTITVDENYLFTIEQTIVNNSDKE 193

Query: 194 IRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLG 253
           +     G I R           + +G I  + +           +K S         W+G
Sbjct: 194 LPVQSYGLINRKYIAVEKAVNILHQGPIGCIDENLKEYSYDDIKDKKSEKFAASKVDWIG 253

Query: 254 ISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILPGKSITTTNFLFAGA 312
           I+DKYW S  IP K +++ S F Y L  G  RYQ  F +    I PGK+ +  + +FAGA
Sbjct: 254 ITDKYWLSSLIPDKSSNYSSNFNYALKQGIERYQVDFISPVQIIKPGKNFSIKSRIFAGA 313

Query: 313 KEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVK 372
           K+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY  VGNFG++I++ TV +K
Sbjct: 314 KKVDLLDKYEKQYDIKLFDRAIDFGWFYIITKPVFYAMNFFYGYVGNFGVSILIVTVIIK 373

Query: 373 LLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWP 432
           LL F LA K Y S   MKN+QP+ID ++  +       L + ++ LYK   +NP+AGC P
Sbjct: 374 LLMFTLANKSYRSMKKMKNLQPEIDRIKNLYSDDKA-RLNQEIMALYKKEKVNPVAGCLP 432

Query: 433 ILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGI 492
           IL+QIPVFF+IYKV+ +++EMR APF+GWIKDL+A DPT IF LFG+LPF  P F+ +G 
Sbjct: 433 ILVQIPVFFSIYKVLYVTIEMRQAPFYGWIKDLSAPDPTTIFNLFGLLPFAPPSFLMIGA 492

Query: 493 WPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQ 552
           WPI+M+++MF+Q KMSP PAD  QA ++ +MP++F+F  SSFP GL+IYWSW+N++SI+Q
Sbjct: 493 WPILMAITMFLQQKMSPEPADPMQAQVMKFMPLIFLFMFSSFPVGLLIYWSWNNILSIIQ 552

Query: 553 QAVIMKMH 560
           Q  I K +
Sbjct: 553 QYYINKFN 560


>gi|121602508|ref|YP_989323.1| putative inner membrane protein translocase component YidC
           [Bartonella bacilliformis KC583]
 gi|120614685|gb|ABM45286.1| inner membrane protein, 60Kd [Bartonella bacilliformis KC583]
          Length = 612

 Score =  403 bits (1036), Expect = e-110,   Method: Composition-based stats.
 Identities = 259/610 (42%), Positives = 372/610 (60%), Gaps = 30/610 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           ME N N+F+AI LS+II  AW   Y+ P+ E + N +   Q   + N    +Y A   ++
Sbjct: 1   MEYNRNFFIAIGLSLIIFVAWHFLYIVPQHENLKNAQTIEQQALKQNPASPTYDADFSNN 60

Query: 61  ------------------RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVS 102
                             R   L+ + R+ +K   L GSINL GAQFDDL L+ YHL V 
Sbjct: 61  AQTNQSRLTADRSMTPEIRRAELAKTDRITIKTDELEGSINLVGAQFDDLFLKKYHLTVD 120

Query: 103 SNSPIVTLLSPSNTKNAYFAELDYVSTANNIE-LPNSNTVWNLIS-GKILTPTTPIKLVF 160
             SP ++LL+P+  K +Y AE  + S++   + LP SNT W + S   ILTP+TP+ LV+
Sbjct: 121 KTSPQISLLNPNGFKTSYLAEFGFTSSSLPEKALPQSNTQWQIESENTILTPSTPVTLVY 180

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGF 220
            N    +F RTIS+D+HY+F I D++ N S + +  S   R+ R  P        +    
Sbjct: 181 NNGQGQIFRRTISIDDHYMFTIEDSINNESDNPVHLSSYARVARAAPPEHAQATYLLHEG 240

Query: 221 IAVLGDKSLVEQKY---------SDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSF 271
           +  +   SL  + Y          +  + S++    +  W+GI+DKYWA   IPS+   +
Sbjct: 241 MIGIAGNSLKTETYEALSELTLNPEDGQKSLTFQKVTGGWIGITDKYWAVAVIPSQNQEY 300

Query: 272 HSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFE 331
            S+F Y    +  YQ+   +  ++I P ++ T  N+LFAGAK    I+ Y+  L I +F 
Sbjct: 301 TSRFVYFDRLNTHYQSDLQSALLSIAPRETKTIINYLFAGAKRVEIINQYQNQLQIKKFG 360

Query: 332 MLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKN 391
           +LIDWGWF FI KPMF L+   Y   GNFGIAI+LTTV +K L FPLA K Y+S A MK 
Sbjct: 361 LLIDWGWFDFITKPMFSLIHILYEQTGNFGIAILLTTVLLKTLLFPLANKSYISMARMKI 420

Query: 392 IQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISL 451
           IQP + E++EK+ +   +    A+IQLYKT  INPLAGC P+L+Q P+FFA+YKV+ I+L
Sbjct: 421 IQPMMQEIKEKYAEDRVKQQH-AIIQLYKTQKINPLAGCLPMLIQFPIFFALYKVLYITL 479

Query: 452 EMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP 511
           EMRHAPF+GWI+DLAA DPT+IF LFG LP+ +P F  +G WP++M ++MF+QM+M+PPP
Sbjct: 480 EMRHAPFFGWIQDLAAPDPTSIFNLFGFLPYAVPAFFVIGAWPLVMGITMFLQMQMNPPP 539

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLR 571
            D  QA +  W+P++F F L+SFPAGL+IYW+W+N +SI+QQ++IMK  G +I L + ++
Sbjct: 540 VDPIQATLFAWLPIIFTFMLASFPAGLVIYWAWNNTLSIIQQSIIMKRQGVKIELFNNIK 599

Query: 572 STFSKNYNSQ 581
           + + K    +
Sbjct: 600 TIWQKAPKKE 609


>gi|34580968|ref|ZP_00142448.1| 60 kD inner-membrane protein [Rickettsia sibirica 246]
 gi|28262353|gb|EAA25857.1| 60 kD inner-membrane protein [Rickettsia sibirica 246]
          Length = 560

 Score =  403 bits (1035), Expect = e-110,   Method: Composition-based stats.
 Identities = 234/548 (42%), Positives = 340/548 (62%), Gaps = 3/548 (0%)

Query: 14  SVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVEL 73
           S+ I++ WQ F V P  ++   +    +      Q   +          QA S   R+++
Sbjct: 15  SLSIIFGWQYFVVKPEQKKQQQQITVQKAENLKKQQLKALVEPATGIVVQAESQVQRIKI 74

Query: 74  KNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNI 133
           ++ SL GSI+LKG +FDDL L+ Y  D+S NSP V L SP+NT+NAYFAE+  VS  +++
Sbjct: 75  ESESLTGSISLKGLRFDDLILKKYKQDLSKNSPEVRLFSPANTENAYFAEVGLVSNLSSV 134

Query: 134 ELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQ 193
           +LPN++T+WN    +IL+P  P+ L + N + + F  TI++DE+YLF I  T+ NNS  +
Sbjct: 135 KLPNNDTIWN-SDSEILSPEKPVHLFWVNEDGVKFLVTIAVDENYLFTIEQTIVNNSNKE 193

Query: 194 IRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLG 253
           +     G I R           + +G I  + +           +K S         W+G
Sbjct: 194 LPVQSYGLINRKYIAVEKAVNILHQGPIGCIDENLKEYSYDDIKDKKSEKFAASKVDWIG 253

Query: 254 ISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILPGKSITTTNFLFAGA 312
           I+DKYW S  IP K +++ S F Y L  G  RYQ  F +    I PG++ +  + +FAGA
Sbjct: 254 ITDKYWLSSLIPDKSSNYSSNFNYALKQGTERYQVDFISPVQIIKPGENFSIKSRIFAGA 313

Query: 313 KEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVK 372
           K+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY  VGNFG++I++ TV +K
Sbjct: 314 KKVDLLDKYEKQYDIKLFDRAIDFGWFYIITKPVFYAMNFFYGYVGNFGVSILIVTVIIK 373

Query: 373 LLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWP 432
           LL F LA K Y S   MKN+QP+ID ++  +       L + ++ LYK   +NP+AGC P
Sbjct: 374 LLMFTLANKSYRSMKKMKNLQPEIDRIKNLYSDDKA-RLNQEIMALYKKEKVNPVAGCLP 432

Query: 433 ILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGI 492
           IL+QIPVFF+IYKV+ +++EMR APF+GWIKDL+A+DPT IF LFG+LPF  P F+ +G 
Sbjct: 433 ILVQIPVFFSIYKVLYVTIEMRQAPFYGWIKDLSASDPTTIFNLFGLLPFSPPSFLMIGA 492

Query: 493 WPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQ 552
           WPI+M+++MF+Q KMSP PAD  QA ++ +MP++F+F  SSFP GL+IYWSW+N++SI+Q
Sbjct: 493 WPILMAITMFLQQKMSPEPADPMQAQVMKFMPLIFLFMFSSFPVGLLIYWSWNNILSIIQ 552

Query: 553 QAVIMKMH 560
           Q  I K +
Sbjct: 553 QYYINKFN 560


>gi|229586285|ref|YP_002844786.1| putative inner membrane protein translocase component YidC
           [Rickettsia africae ESF-5]
 gi|259515719|sp|C3PM83|OXAA_RICAE RecName: Full=Membrane protein oxaA
 gi|228021335|gb|ACP53043.1| Preprotein translocase subunit YidC [Rickettsia africae ESF-5]
          Length = 560

 Score =  403 bits (1035), Expect = e-110,   Method: Composition-based stats.
 Identities = 233/548 (42%), Positives = 338/548 (61%), Gaps = 3/548 (0%)

Query: 14  SVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVEL 73
           S+ I++ WQ F V P  ++   +    +      Q   +          Q  S   R+++
Sbjct: 15  SLSIIFGWQYFVVKPEQKKQQQQIAVQKAENLKKQQLKAVVEPATGIVVQEESQVQRIKI 74

Query: 74  KNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNI 133
           ++ SL GSI+LKG +FDDL L+ Y  D+S NSP V L SP+NT+NAYFAE+  VS  +++
Sbjct: 75  ESESLTGSISLKGLRFDDLILKKYKQDLSKNSPEVRLFSPANTENAYFAEVGLVSNLSSV 134

Query: 134 ELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQ 193
           +LPN++T+WN    +IL+P  P+ L + N + + F  TI++DE+YLF I  T+ NNS  +
Sbjct: 135 KLPNNDTIWN-SDSEILSPEKPVHLFWVNEDGVKFLVTITVDENYLFTIEQTIVNNSDKE 193

Query: 194 IRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLG 253
           +     G I R           + +G I  + +           +K S         W+G
Sbjct: 194 LPVQSYGLINRKYIAVEKAVNILHQGPIGCIDENLKEYSYDDIKDKKSEKFVASKVDWIG 253

Query: 254 ISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILPGKSITTTNFLFAGA 312
           I+DKYW S  IP K +++ S F Y L  G  RYQ  F +    I PG+  +  + +FAGA
Sbjct: 254 ITDKYWLSSLIPDKSSNYSSNFNYALKQGTERYQVDFISPVQIIKPGEDFSIKSRIFAGA 313

Query: 313 KEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVK 372
           K+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY  VGNFG++I++ TV +K
Sbjct: 314 KKVDLLDKYEKQYDIKLFDRAIDFGWFYIITKPVFYAMNFFYGYVGNFGVSILIVTVIIK 373

Query: 373 LLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWP 432
           LL F LA K Y S   MKN+QP+ID ++  +       L + ++ LYK   +NP+AGC P
Sbjct: 374 LLMFTLANKSYRSMKKMKNLQPEIDRIKNLYSDDKA-RLNQEIMALYKKEKVNPVAGCLP 432

Query: 433 ILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGI 492
           IL+QIPVFF+IYKV+ +++EMR APF+GWIKDL+A+DPT IF LFG+LPF  P F+ +G 
Sbjct: 433 ILVQIPVFFSIYKVLYVTIEMRQAPFYGWIKDLSASDPTTIFNLFGLLPFSPPLFLMIGA 492

Query: 493 WPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQ 552
           WPI+M+++MF+Q KMSP PAD  QA ++ +MP++F+F  SSFP GL+IYWSW+N++SI+Q
Sbjct: 493 WPILMAITMFLQQKMSPEPADPMQAQVMKFMPLIFLFMFSSFPVGLLIYWSWNNILSIIQ 552

Query: 553 QAVIMKMH 560
           Q  I K +
Sbjct: 553 QYYINKFN 560


>gi|15891997|ref|NP_359711.1| putative inner membrane protein translocase component YidC
           [Rickettsia conorii str. Malish 7]
 gi|38503126|sp|Q92JJ3|OXAA_RICCN RecName: Full=Inner membrane protein oxaA
 gi|15619112|gb|AAL02612.1| 60 kD inner-membrane protein [Rickettsia conorii str. Malish 7]
          Length = 560

 Score =  403 bits (1035), Expect = e-110,   Method: Composition-based stats.
 Identities = 233/548 (42%), Positives = 339/548 (61%), Gaps = 3/548 (0%)

Query: 14  SVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVEL 73
           S+ I++ WQ F V P  ++   +    +      Q   +          Q  S   R+++
Sbjct: 15  SLSIIFGWQYFVVKPEQKKQQQQIAVQKAENLKKQQLKALVEPATGIVVQEESQVQRIKI 74

Query: 74  KNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNI 133
           ++ SL GSI+LKG +FDDL L+ Y  D+S NSP V L SP+NT+NAYFAE+  VS  +++
Sbjct: 75  ESESLTGSISLKGLRFDDLILKKYKQDLSKNSPEVRLFSPANTENAYFAEVGLVSNLSSV 134

Query: 134 ELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQ 193
           +LPN++T+WN    +IL+P  P+ L + N + + F  TI++DE+YLF I  T+ NNS  +
Sbjct: 135 KLPNNDTIWN-SDSEILSPEKPVHLFWVNEDGVKFLVTITVDENYLFTIEQTIVNNSDKE 193

Query: 194 IRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLG 253
           +     G I R           + +G I  + +           +K S         W+G
Sbjct: 194 LPVQSYGLINRKYIAVEKAVNILHQGPIGCIDENLKEYSYDDIKDKKSEKFAASKVDWIG 253

Query: 254 ISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILPGKSITTTNFLFAGA 312
           I+DKYW S  IP K +++ S F Y L  G  RYQ  F +    I PG++ +  + +FAGA
Sbjct: 254 ITDKYWLSSLIPDKSSNYSSNFNYALKQGTERYQVDFISPVQIIKPGENFSIKSRIFAGA 313

Query: 313 KEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVK 372
           K+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY  VGNFG++I++ TV +K
Sbjct: 314 KKVDLLDKYEKQYDIKLFDRAIDFGWFYIITKPVFYAMNFFYGYVGNFGVSILIVTVIIK 373

Query: 373 LLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWP 432
           LL F LA K Y S   MKN+QP+ID ++  +       L + ++ LYK   +NP+AGC P
Sbjct: 374 LLMFTLANKSYRSMKKMKNLQPEIDRIKNLYSDDKA-RLNQEIMALYKKEKVNPVAGCLP 432

Query: 433 ILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGI 492
           IL+QIPVFF+IYKV+ +++EMR APF+GWIKDL+A+DPT IF LFG+LPF  P F+ +G 
Sbjct: 433 ILVQIPVFFSIYKVLYVTIEMRQAPFYGWIKDLSASDPTTIFNLFGLLPFSPPSFLMIGA 492

Query: 493 WPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQ 552
           WPI+M+++MF+Q KMSP PAD  QA ++ +MP++F+F  SSFP GL+IYWSW+N++SI+Q
Sbjct: 493 WPILMAITMFLQQKMSPEPADPMQAQVMKFMPLIFLFMFSSFPVGLLIYWSWNNILSIIQ 552

Query: 553 QAVIMKMH 560
           Q  I K +
Sbjct: 553 QYYINKFN 560


>gi|239946952|ref|ZP_04698705.1| inner membrane protein OxaA [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921228|gb|EER21252.1| inner membrane protein OxaA [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 560

 Score =  403 bits (1034), Expect = e-110,   Method: Composition-based stats.
 Identities = 233/548 (42%), Positives = 339/548 (61%), Gaps = 3/548 (0%)

Query: 14  SVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVEL 73
           S+ I++ WQ F V P  ++   +    +      Q   +      D   Q  +   R+++
Sbjct: 15  SLSIIFGWQYFVVKPEQKKQQQQIAVQKAENLKKQQLKALVEPATDIVVQEENQVQRIKI 74

Query: 74  KNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNI 133
           ++ SL GSI+LKG +FDDL L+ Y  D+S NSP V L SP+NT+NAYFAE+  VS  +++
Sbjct: 75  ESESLTGSISLKGLRFDDLILKKYKQDLSKNSPEVRLFSPANTENAYFAEIGLVSNLSSV 134

Query: 134 ELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQ 193
           +LPN++T+WN  S +IL+P   + L + N + + F  TI++DE+YLF I  T+ NNS  +
Sbjct: 135 KLPNNDTIWNSNS-EILSPEKSVNLFWVNEDGVKFLVTITVDENYLFTIEQTIVNNSDKE 193

Query: 194 IRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLG 253
           +     G I R           + +G I  + +           +K S         W+G
Sbjct: 194 LPVQSYGLINRKYIAVEKAVNILHQGPIGCIDENLKEYSYDDIKDKKSEKFAAGKVDWIG 253

Query: 254 ISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILPGKSITTTNFLFAGA 312
           I+DKYW S  IP K +++ S F Y L  G  RYQ  F +    I PG++ +  + +FAGA
Sbjct: 254 ITDKYWLSSLIPDKSSNYSSNFNYALKQGAERYQVDFISPVQIIKPGENFSIKSRIFAGA 313

Query: 313 KEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVK 372
           K+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY  VGNFG++I++ TV +K
Sbjct: 314 KKVDLLDKYEKQYDIKLFDRAIDFGWFYIITKPVFYAMNFFYGYVGNFGVSILIVTVIIK 373

Query: 373 LLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWP 432
           LL F LA K Y S   MKN+QP+ID ++  +       L + ++ LYK   +NP+AGC P
Sbjct: 374 LLMFTLANKSYRSMKKMKNLQPEIDRIKNLYSDDKA-RLNQEIMALYKKEKVNPVAGCLP 432

Query: 433 ILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGI 492
           IL+QIPVFF+IYKV+ +++EMR APF+GWIKDL+A DPT IF LFG+LPF  P F+ +G 
Sbjct: 433 ILVQIPVFFSIYKVLYVTIEMRQAPFYGWIKDLSAPDPTTIFNLFGLLPFLPPSFLMIGA 492

Query: 493 WPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQ 552
           WPI+M+++MF+Q KMSP PAD  QA ++ +MP++F+F  SSFP GL+IYWSW+N++SI+Q
Sbjct: 493 WPILMAITMFLQQKMSPEPADPMQAQVMKFMPLIFLFMFSSFPVGLLIYWSWNNILSIIQ 552

Query: 553 QAVIMKMH 560
           Q  I K +
Sbjct: 553 QYYINKFN 560


>gi|51473293|ref|YP_067050.1| putative inner membrane protein translocase component YidC
           [Rickettsia typhi str. Wilmington]
 gi|81692326|sp|Q68XS4|OXAA_RICTY RecName: Full=Inner membrane protein oxaA
 gi|51459605|gb|AAU03568.1| 60 kDa inner membrane protein [Rickettsia typhi str. Wilmington]
          Length = 558

 Score =  402 bits (1032), Expect = e-110,   Method: Composition-based stats.
 Identities = 238/562 (42%), Positives = 344/562 (61%), Gaps = 6/562 (1%)

Query: 1   MERNW-NYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLID 59
           M  N  N   AI LS+ I++ WQ F + P  ++        ++     Q   + A    +
Sbjct: 1   MNNNIINLIAAIVLSLSIIFGWQYFVIKPEQKKQQQRMAIYKSENLKKQ--KALAEHTSN 58

Query: 60  DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNA 119
              Q      R+++++ SL GSI LKG +FDDL L+ Y  D+S NSP V L SP+NT+NA
Sbjct: 59  ITVQEAGQVQRIKIESESLTGSIALKGLRFDDLILKKYKQDLSQNSPAVRLFSPANTENA 118

Query: 120 YFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYL 179
           YFAE+  VS  ++++LPNSNTVWN    ++L+P  P+ L + N + I F  TI++D++YL
Sbjct: 119 YFAEIGLVSNLSSVKLPNSNTVWN-SDSEVLSPEKPVNLFWVNEDGIKFLVTITVDKNYL 177

Query: 180 FKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEK 239
           F I  T+ NNS  ++     G I R           + +G I  + +           ++
Sbjct: 178 FTIEQTIINNSDKELPVQAYGLINRKYIAVEKAVNILHQGPIGCIDENLKEYSYDDIKDQ 237

Query: 240 SSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILP 298
            S         W+GI+DKYW S  IP K +S+ + F Y L  G  RYQ  F +    I P
Sbjct: 238 KSAKFALSKVDWIGIADKYWLSSLIPDKSSSYSANFNYALKQGAERYQVDFISPVQVIKP 297

Query: 299 GKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVG 358
           GK+++  + +FAGAK+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY  VG
Sbjct: 298 GKNLSIKSRIFAGAKKVDLLDEYEKSYDIKLFDRAIDFGWFYIITKPVFYAMNFFYGYVG 357

Query: 359 NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQL 418
           NFG++I++ TV +KLL F LA K Y S   MKN+QP+ID ++  +       L + ++ L
Sbjct: 358 NFGVSILIVTVIIKLLMFTLANKSYRSMKKMKNLQPEIDRIKNLYNNDKA-RLNQEIMAL 416

Query: 419 YKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFG 478
           YK   +NP+AGC PIL+QIPVFF+IYKV+ +++EMRHAPF+GWIKDL++ DPT IF LFG
Sbjct: 417 YKKSKVNPVAGCLPILVQIPVFFSIYKVLYVTIEMRHAPFYGWIKDLSSPDPTTIFNLFG 476

Query: 479 ILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGL 538
           +LPF  P F+ +G WPI+M+++MF+  KMSP  AD  QA ++ +MP++F+F  SSFP GL
Sbjct: 477 LLPFAPPSFLMIGAWPILMAITMFLHQKMSPELADPIQAQVMKFMPLIFLFMFSSFPVGL 536

Query: 539 IIYWSWSNVISIVQQAVIMKMH 560
           +IYWSW+N++SI+QQ  I K +
Sbjct: 537 LIYWSWNNILSIIQQYYINKFN 558


>gi|165932637|ref|YP_001649426.1| membrane protein insertase [Rickettsia rickettsii str. Iowa]
 gi|189036358|sp|B0BVZ4|OXAA_RICRO RecName: Full=Inner membrane protein oxaA
 gi|165907724|gb|ABY72020.1| 60 kDa inner membrane protein [Rickettsia rickettsii str. Iowa]
          Length = 560

 Score =  402 bits (1031), Expect = e-109,   Method: Composition-based stats.
 Identities = 233/548 (42%), Positives = 337/548 (61%), Gaps = 3/548 (0%)

Query: 14  SVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVEL 73
           S+ I++ WQ F V P  ++   +    +      Q   +          Q  S   R+++
Sbjct: 15  SLSIIFGWQYFVVKPEQKKQQQQIAVQKAENLKKQQLKALVEPATGIVVQEESQVQRIKI 74

Query: 74  KNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNI 133
           ++ SL GSI+LKG +FDDL L+ Y  D+S NS  V L SP+NT+NAYFAE+  VS  +++
Sbjct: 75  ESESLTGSISLKGLRFDDLILKKYKQDLSKNSSEVRLFSPANTENAYFAEVGLVSNLSSV 134

Query: 134 ELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQ 193
           +LPN++T+WN    +IL+P  P+ L + N + + F  TI++DE+YLF I  T+ NNS  +
Sbjct: 135 KLPNNDTIWN-SDSEILSPEKPVHLFWVNEDGVKFLVTITVDENYLFTIEQTIVNNSDKE 193

Query: 194 IRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLG 253
           +     G I R           + +G I  + +           +K S         W+G
Sbjct: 194 LPVQSYGLINRKYIAVEKAVNILHQGPIGCIDENLKEYSYDDIKDKKSEKFAASKVDWIG 253

Query: 254 ISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILPGKSITTTNFLFAGA 312
           I+DKYW S  IP K +++ S F Y L  G  RYQ  F +    I PGK+ +  + +FAGA
Sbjct: 254 ITDKYWLSSLIPDKSSNYSSNFNYALKQGIERYQVDFISPVQIIKPGKNFSIKSRIFAGA 313

Query: 313 KEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVK 372
           K+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY  VGNFG++I++ TV +K
Sbjct: 314 KKVDLLDKYEKQYDIKLFDRAIDFGWFYIITKPVFYAMNFFYGYVGNFGVSILIVTVIIK 373

Query: 373 LLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWP 432
           LL F LA K Y S   MKN+QP+ID ++  +       L + ++ LYK   +NP+AGC P
Sbjct: 374 LLMFTLANKSYRSMKKMKNLQPEIDRIKNLYSDDKA-RLNQEIMALYKKEKVNPVAGCLP 432

Query: 433 ILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGI 492
           IL+QIPVFF+IYKV+ +++EMR APF+GWIKDL+A DPT IF LFG+LPF  P F+ +G 
Sbjct: 433 ILVQIPVFFSIYKVLYVTIEMRQAPFYGWIKDLSAPDPTTIFNLFGLLPFAPPSFLMIGA 492

Query: 493 WPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQ 552
           WPI+M+++MF+Q KMSP PAD  QA ++ +MP++F+F  SSFP GL+IYWSW+N++SI+Q
Sbjct: 493 WPILMAITMFLQQKMSPEPADPMQAQVMKFMPLIFLFMFSSFPVGLLIYWSWNNILSIIQ 552

Query: 553 QAVIMKMH 560
           Q  I K +
Sbjct: 553 QYYINKFN 560


>gi|67458523|ref|YP_246147.1| putative inner membrane protein translocase component YidC
           [Rickettsia felis URRWXCal2]
 gi|75537010|sp|Q4UN76|OXAA_RICFE RecName: Full=Inner membrane protein oxaA
 gi|67004056|gb|AAY60982.1| Preprotein translocase subunit YidC [Rickettsia felis URRWXCal2]
          Length = 560

 Score =  401 bits (1029), Expect = e-109,   Method: Composition-based stats.
 Identities = 232/548 (42%), Positives = 339/548 (61%), Gaps = 3/548 (0%)

Query: 14  SVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVEL 73
           S+ I++ WQ F V P  ++   +    +      Q   +      D   Q  S   R+++
Sbjct: 15  SLSIIFGWQYFVVKPEQKKQQQQIAVQKAENLKKQQLKALVEPATDIVVQEESGVQRIKI 74

Query: 74  KNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNI 133
           ++ SL GSI+LKG +FDDL L+ Y  D+S+NSP V L SP+NT+NAYFAE+  VS  +++
Sbjct: 75  ESESLTGSISLKGLRFDDLILKKYKQDLSNNSPEVRLFSPANTENAYFAEIGLVSNLSSV 134

Query: 134 ELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQ 193
           +LPN++T+WN    +IL+P  P+ L + N + + F  TI++DE+YLF I  T+ NNS  +
Sbjct: 135 KLPNNDTIWN-SDSEILSPEKPVNLFWVNEDGVKFLVTITVDENYLFTIEQTIVNNSDKE 193

Query: 194 IRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLG 253
           +     G I R           + +G I  + +           +K S         W+G
Sbjct: 194 LPIQSYGLINRKYTAVEKAVNILHQGPIGCIDENLKEYSYDDIKDKKSEKFAASKVDWIG 253

Query: 254 ISDKYWASVFIPSKETSFHSQFKY-LSDGHARYQAKFSANEITILPGKSITTTNFLFAGA 312
           I+DKYW S  IP K +++ S F Y L  G  RYQ  F +    I PG++ +  + +FAGA
Sbjct: 254 ITDKYWLSSLIPDKSSNYSSNFNYALKQGTERYQVDFISPVQIIKPGENFSIKSRIFAGA 313

Query: 313 KEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVK 372
           K+   +  YEK   I  F+  ID+GWFY I KP+F  M++FY  VGNFG++I++ TV +K
Sbjct: 314 KKVDLLDKYEKQYDIKLFDRAIDFGWFYIITKPVFYAMNFFYGYVGNFGVSILIVTVIIK 373

Query: 373 LLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWP 432
           LL F LA K Y S   MKN+QP+ID ++  +       L + ++ LYK   +NP+AGC P
Sbjct: 374 LLMFTLANKSYRSMKKMKNLQPEIDRIKNLYSDDKA-RLNQEIMALYKKEKVNPVAGCLP 432

Query: 433 ILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGI 492
           IL+QIP+FF+IYKV+ +++EMR  PF+GWIKDL+A DPT IF LFG+LPF  P F+ +G 
Sbjct: 433 ILVQIPLFFSIYKVLYVTIEMRQVPFYGWIKDLSAPDPTTIFNLFGLLPFSPPSFLMIGA 492

Query: 493 WPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQ 552
           WPI+M+++MF+Q KMSP PAD  QA ++ +MP++F+F  SSFP GL+IYWSW+N++SI+Q
Sbjct: 493 WPILMAITMFLQQKMSPEPADPMQAQVMKFMPLIFLFMFSSFPVGLLIYWSWNNILSIIQ 552

Query: 553 QAVIMKMH 560
           Q  I K +
Sbjct: 553 QYYINKFN 560


>gi|319406774|emb|CBI80407.1| translocase precursor subunit [Bartonella sp. 1-1C]
          Length = 612

 Score =  399 bits (1024), Expect = e-109,   Method: Composition-based stats.
 Identities = 252/610 (41%), Positives = 363/610 (59%), Gaps = 30/610 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQ------------------T 42
           ME N N+F+AI LS ++  AW   Y+ P+  ++   +   Q                   
Sbjct: 1   MEYNRNFFIAIGLSFVVFVAWHFLYIVPQQAKLQESKITTQKLSNHNAALPTNDPYFSHN 60

Query: 43  VKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVS 102
               + V  +   +  + R   L+ + RV +K   L GSINL G +FDDL L+ Y L V 
Sbjct: 61  ASTDDTVPVANRPITPEVRKAELAKTNRVLIKTNELEGSINLVGGKFDDLLLKKYRLKVD 120

Query: 103 SNSPIVTLLSPSNTKNAYFAELDYVSTANNIE-LPNSNTVWNLISGKIL-TPTTPIKLVF 160
             SP + LL+P+     YFAE  + S++   + LP SNT W L       TP+TPI LV+
Sbjct: 121 KKSPEIILLNPNGLPTTYFAEFGFTSSSLPAQALPQSNTKWQLEGDNTTLTPSTPITLVY 180

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGF 220
            N    +F RT S+DEHY+F I D+++N S   +  S   RI R  P   TN   +    
Sbjct: 181 NNGQGQIFHRTFSVDEHYMFTIKDSISNESSSPVYLSSYARIARAAPPEDTNATYLLHEG 240

Query: 221 IAVLGDKSLVEQKY---------SDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSF 271
           +  +   SL  +KY             + S+   + +  W+GI+DKYWA   IP ++T +
Sbjct: 241 MIGIAGDSLKTEKYTALAELSPNPQNGQKSVIFPNITRGWIGITDKYWAVAVIPPQDTEY 300

Query: 272 HSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFE 331
            S+F Y    +  YQ+   +  +T+ P ++ T TN LFAGAK    I+HY+  L I +F 
Sbjct: 301 TSRFVYFDRLNTHYQSDLQSALLTVPPHETKTITNRLFAGAKRVEIINHYQNQLKINKFS 360

Query: 332 MLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKN 391
           +LIDWGWF FI KPMF L+   Y    NFG+AI+L TV +K+L FPLA K Y S A +K 
Sbjct: 361 LLIDWGWFDFITKPMFALIDILYKYTENFGVAILLITVLLKILLFPLAHKSYKSIARLKV 420

Query: 392 IQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISL 451
           IQP + E++EK+     +  Q+A+I+LYKT  INP AGCWPIL+Q P+FFA+YKV+ I++
Sbjct: 421 IQPMMLEIKEKYADDRNK-QQQAIIELYKTKKINPFAGCWPILIQFPIFFALYKVLYITI 479

Query: 452 EMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP 511
           EMRHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G WP+IM ++MF+QM+M+P P
Sbjct: 480 EMRHAPFFGWIQDLAAPDPTSIFNLFGLLPYAVPTFLILGAWPLIMGITMFLQMQMNPLP 539

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLR 571
            D  Q ++  WMP++F   L+SFPAGL+IYW+W+N++SI+QQ++IMK  G +I   D L+
Sbjct: 540 QDPTQVVVFRWMPIIFTIMLASFPAGLVIYWAWNNILSIIQQSIIMKCQGVKIEFFDNLK 599

Query: 572 STFSKNYNSQ 581
           +   K+   +
Sbjct: 600 AIVQKDSKKE 609


>gi|302381828|ref|YP_003817651.1| membrane protein insertase, YidC/Oxa1 family [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302192456|gb|ADL00028.1| membrane protein insertase, YidC/Oxa1 family [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 614

 Score =  398 bits (1023), Expect = e-109,   Method: Composition-based stats.
 Identities = 219/613 (35%), Positives = 336/613 (54%), Gaps = 37/613 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQ--------------PN 47
           E   N  +   ++ II+  +Q F + P+ E+    ++      Q              P 
Sbjct: 4   ENTRNMVIFAVMTAIILIVYQIFVMGPQAEQRRAAQEAAAAQAQEQQAAAAGTPTAGIPA 63

Query: 48  QVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPI 107
               +     + DR +AL    R+ +  P+L GS++L+G + DDL L+ Y   +   SP 
Sbjct: 64  STGATGPVTFVTDRTKALGNVARIPVSTPTLQGSMSLQGGRIDDLFLKNYRQTIDPTSPY 123

Query: 108 VTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNIL 167
             L  P   ++AYFA+  +        +P +NTVW L +G  LTP TP+ L + N   + 
Sbjct: 124 EELFRPQGMEHAYFAQFGWTGPNVPGGVPGANTVWRLTAGSTLTPATPVTLTWDNGQGLR 183

Query: 168 FERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHK-PQTATNTFGVQEGFIAVLGD 226
           F R +S+D+ Y+F + DTV N     I  +P GR+ R   P     T  + EG I     
Sbjct: 184 FTRVLSVDDRYMFTVTDTVANLGTAPITIAPYGRVERQGVPPALGKTQILHEGGIGTFSK 243

Query: 227 KS---LVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDG-H 282
                  + KY D  K        +  WLGI+DKYW +  IP ++ +  ++F+      +
Sbjct: 244 GDGYVTSQLKYGDWAKKPRQEHESTGGWLGITDKYWMAALIPPQDEAIQAEFRVTDAATY 303

Query: 283 ARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFI 342
             ++A+      TI PG+ +T    LFAGAK    +  YEK   +PRF   IDWG+ +F+
Sbjct: 304 DIHEARMLGAARTIQPGRQVTEVQHLFAGAKRNEILADYEKQFDLPRFIYAIDWGFLFFL 363

Query: 343 AKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREK 402
            +P+F+L+ +FY LVGNFG+AI+L T+ +KL+ FPLA K Y S + M+ +QP +++++E+
Sbjct: 364 TRPIFLLVEFFYGLVGNFGVAILLLTLTIKLIMFPLANKSYESLSKMRKLQPLMEKIKEQ 423

Query: 403 FKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWI 462
            K   PQ  QKA ++LY+   INPLAGC PIL+QIPVF+A+YKV+ +++EMRHAPF+GWI
Sbjct: 424 NKD-DPQAQQKATMELYQKEKINPLAGCLPILVQIPVFYALYKVLYVTIEMRHAPFFGWI 482

Query: 463 KDLAAADPTNIFTLFGILPFYLPGFMHVG----------------IWPIIMSLSMFIQMK 506
           +DL+A DPTNI+TLFG++P+       +G                +  I+   +M++Q  
Sbjct: 483 RDLSAPDPTNIWTLFGLIPWDPSSAPLIGGLIGVHTGGGFTLALSVLAILYGFTMWLQQA 542

Query: 507 MSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGL 566
           M+PP  D  Q  I  +MP++F F ++SFPAGL++YW+W+N++SI QQ  IM   GAE  +
Sbjct: 543 MNPPAPDPVQRQIFAFMPIIFTFIMASFPAGLLVYWAWNNILSIAQQYFIMHRFGAENPI 602

Query: 567 IDRLRSTFSKNYN 579
            D +     K   
Sbjct: 603 DDFI-GKLKKAPA 614


>gi|319403768|emb|CBI77352.1| translocase precursor subunit [Bartonella rochalimae ATCC BAA-1498]
          Length = 612

 Score =  397 bits (1020), Expect = e-108,   Method: Composition-based stats.
 Identities = 252/610 (41%), Positives = 363/610 (59%), Gaps = 30/610 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQ------------------T 42
           ME N N+F+AI LS ++  AW   Y+ P+  ++   +   Q                   
Sbjct: 1   MEYNRNFFIAIGLSFVVFVAWHFLYIVPQQAKLQESKITTQKLSNHNAALPTNDPYFSHN 60

Query: 43  VKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVS 102
               + V  +   +  + R   L+ + RV +K   L GSINL G +FDDL L+ Y L V 
Sbjct: 61  ASTNDTVPVANRPITPEIRKAELAKTNRVLIKTNELEGSINLVGGKFDDLLLKKYRLKVD 120

Query: 103 SNSPIVTLLSPSNTKNAYFAELDYVSTANNIE-LPNSNTVWNLISGKIL-TPTTPIKLVF 160
             SP + LL+P+     YFAE  + S++   + LP SNT W L       TP+TPI LV+
Sbjct: 121 KKSPEIILLNPNGLPTTYFAEFGFTSSSLPAQALPQSNTKWQLEGDNTTLTPSTPITLVY 180

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGF 220
            N    +F RT S+DEHY+F I D+++N S   +  S   RI R  P   TN   +    
Sbjct: 181 NNGQGQIFHRTFSVDEHYMFTIKDSISNESNSPVYLSSYARIARAAPPEDTNATYLLHEG 240

Query: 221 IAVLGDKSLVEQKY---------SDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSF 271
           +  +   SL  +KY             + S+   + +  W+GI+DKYWA   IP ++T +
Sbjct: 241 MIGIAGDSLKTEKYTALAELSPNPQNGQKSVIFPNITRGWIGITDKYWAVAVIPPQDTEY 300

Query: 272 HSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFE 331
            S+F Y    +  YQ+   +  +T+ P ++ T TN LFAGAK    I+HY+  L I +F 
Sbjct: 301 TSRFVYFDRLNTHYQSDLQSALLTVPPHETKTITNRLFAGAKRVEIINHYQNQLKINKFS 360

Query: 332 MLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKN 391
           +LIDWGWF FI KPMF L+   Y    NFG+AI+L TV +K+L FPLA K Y S A +K 
Sbjct: 361 LLIDWGWFDFITKPMFALIDILYKYTENFGVAILLITVLLKILLFPLAHKSYKSIARLKL 420

Query: 392 IQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISL 451
           IQP + E++EK+     +  Q+A+I+LYKT  INP AGCWPIL+Q P+FFA+YKV+ I++
Sbjct: 421 IQPMMLEIKEKYADDRNK-QQQAIIELYKTKKINPFAGCWPILIQFPIFFALYKVLYITI 479

Query: 452 EMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP 511
           EMRHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G WP+IM ++MF+QM+M+P P
Sbjct: 480 EMRHAPFFGWIQDLAAPDPTSIFNLFGLLPYAVPTFLILGAWPLIMGITMFLQMQMNPLP 539

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLR 571
            D  Q ++  WMP++F   L+SFPAGL+IYW+W+N++SI+QQ++IMK  G +I   D L+
Sbjct: 540 QDPTQVIVFRWMPIIFTIMLASFPAGLVIYWAWNNILSIIQQSIIMKCQGVKIEFFDNLK 599

Query: 572 STFSKNYNSQ 581
           +   K+   +
Sbjct: 600 AIVQKDSKKE 609


>gi|295690947|ref|YP_003594640.1| membrane protein insertase [Caulobacter segnis ATCC 21756]
 gi|295432850|gb|ADG12022.1| membrane protein insertase, YidC/Oxa1 family [Caulobacter segnis
           ATCC 21756]
          Length = 618

 Score =  397 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 214/614 (34%), Positives = 324/614 (52%), Gaps = 40/614 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNE-------RKNIQTVKQPNQVDNSYA 54
             N N  + I  +  I+  +Q F + P+ ++   E       ++            N   
Sbjct: 3   NDNKNTLMFIVSAFAILIGYQFFILGPQQKKAEAEMRAKKAAQQQTAAQAGVPLDANGNP 62

Query: 55  AVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPS 114
           A L   R QA + SPR+ +  P+L GSI LKG + DDL LR Y    + NSP V L  P 
Sbjct: 63  APLRLSRDQAKAQSPRIVVDTPALSGSIALKGGRIDDLFLRKYAETTAKNSPPVELFRPE 122

Query: 115 NTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISL 174
             ++A+FA+  +   AN   LP+S TVW    G++L P +P+ L + N   + F R I++
Sbjct: 123 GAEHAWFADFGWAG-ANLPGLPDSRTVWTAAPGQVLRPNSPVTLTYDNGMGLTFTRVIAV 181

Query: 175 DEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNT-FGVQEGFIAVLGDKSLVEQ- 232
           D+  +F + D+V NN     + +P   + R            V EG I VLG     +  
Sbjct: 182 DDQAMFSVTDSVKNNGTAAFQLAPYATVQRQGITDHLGKTQIVHEGAIGVLGSGKDQKLE 241

Query: 233 --KYSDIEKSSISNFHESNS-WLGISDKYWASVFIPSKETSFHSQFKYLS-DGHARYQAK 288
             KY   +K       +S   W GI+DKYW +  IP +  +  +Q++  +  G   Y   
Sbjct: 242 LAKYQKWKKDKPLTTFDSVGGWAGITDKYWLAALIPGQTEAIKAQYRVTNVAGVDVYDVN 301

Query: 289 FSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLA---------------IPRFEML 333
           F      + PG ++T T  LFAGAK  P +  Y+   A               IPRF+  
Sbjct: 302 FVGPTQALNPGATLTQTTRLFAGAKTVPLLRKYQYGGAKPPAWWEFWSNAKAEIPRFDWA 361

Query: 334 IDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQ 393
           +DWG F    +P+F ++  FY +VGNFG+AI+  TV +KL+ +P+A K Y S A MK I 
Sbjct: 362 VDWGMFSMFTRPIFNVLEIFYKMVGNFGLAILALTVLLKLILYPMADKSYESMAKMKKIA 421

Query: 394 PKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEM 453
           P++++L+ K K  P +  Q+ M+ LY+   INP+ GC P+L+QIPVF+A+YKV+++++EM
Sbjct: 422 PEVEKLKAKHKDDPAK-QQQEMMALYQKEKINPMMGCLPMLIQIPVFYALYKVLTVTIEM 480

Query: 454 RHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGF----------MHVGIWPIIMSLSMFI 503
           RHAPF+GWI+DL+A DP+ IF LFG +P+               +H+G+WP++   +M++
Sbjct: 481 RHAPFFGWIQDLSARDPSTIFNLFGAIPWDPATAPLIGGFLGGPLHIGVWPLLYGFTMWL 540

Query: 504 QMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
              M+PP  D  Q  I    P++F F LS F  GL+IYW WSNV++IVQQ V+M+ +  E
Sbjct: 541 TTAMNPPAGDPIQQKIFQLFPIIFTFTLSQFAVGLVIYWCWSNVLTIVQQYVMMRRYKVE 600

Query: 564 IGLIDRLRSTFSKN 577
             +   +     K 
Sbjct: 601 NPIDRIIARLQGKA 614


>gi|209542536|ref|YP_002274765.1| 60 kDa inner membrane insertion protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209530213|gb|ACI50150.1| 60 kDa inner membrane insertion protein [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 589

 Score =  397 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 193/590 (32%), Positives = 311/590 (52%), Gaps = 15/590 (2%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
                + VA  LS +++  ++ F       E+  +         P     + A V     
Sbjct: 1   MDTKRFIVATLLSAMVLVGFEYFMPKQAHHEVAQQAAQTSRQTPPTDAARAPAPVAGASS 60

Query: 62  AQALSMSP----RVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTK 117
               + +P    R+ +  P + GSI+L GA+ DD+ LR YH  V+  SP V +L P + +
Sbjct: 61  QPVSTPAPQAETRLAIDAPKVAGSIDLLGARLDDMVLRDYHETVAKGSPQVRILEPGHDQ 120

Query: 118 NAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEH 177
              + E+ +++           T         LT   P+ L + N   + F+  +S+D H
Sbjct: 121 QPNYVEIGWMNLPGGQVRVPDATTVWSADAPKLTSDRPVTLSWDNGAGVTFQIVVSIDAH 180

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFI----AVLGDKSLVEQK 233
           Y+F I   + N S   +   P  R+ R    T T  + V EG I      L + S    +
Sbjct: 181 YMFGIEQRIVNRSAQPVSLYPYARVDRAYTPTETGGYLVHEGPISVIDGRLDESSYKSLR 240

Query: 234 YSDIEKSSISNFHESNS-WLGISDKYWASVFIPSKETSFHSQFKYL-SDGHARYQAKFSA 291
                  ++S        W GI+DKYW +  IP + T+    + Y  + G   YQ  F A
Sbjct: 241 TGATPPGNLSWTKGGQGGWAGITDKYWLTAVIPQQGTAVTGSYGYQANGGAGVYQVGFIA 300

Query: 292 NEITI-LPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLM 350
              T+  PG +  T + +FAGAKE   +  Y+  L IP F   +D+GWF F+ +P+F ++
Sbjct: 301 QAATVVAPGTTGATVSHVFAGAKEVNLLEQYQSSLHIPDFWKAVDFGWFAFLTRPIFYVL 360

Query: 351 SYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQV 410
            +   L+GNFG+A+M  T+ VK LFFPLA +Q+ S A M+ +QPK+ ELRE++ +S    
Sbjct: 361 DWLNTLLGNFGLALMAFTLLVKALFFPLATRQFRSMAKMRQLQPKVQELRERY-KSDQMA 419

Query: 411 LQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADP 470
           L + M+ LYK   +NP AGC P+++QIPVF+++YK + I++EMRHAPF+GWI DL+A D 
Sbjct: 420 LNQNMMALYKAEGVNPAAGCLPMVVQIPVFWSLYKDLYITIEMRHAPFFGWIHDLSAPDL 479

Query: 471 TNIFTLFGILPFYLPG---FMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVF 527
           TN+F LFG++P+       ++ +G+WPI+   +MF+Q K++P P D  Q  +   MPV+F
Sbjct: 480 TNLFNLFGLIPWDPNVLSPYLQLGVWPILFGATMFLQQKLNPAPTDPAQQRMFQMMPVLF 539

Query: 528 VFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKN 577
            F ++  PAGL+IY+ W+N++++ QQ VI +   + +  +  + +   + 
Sbjct: 540 TFFMARQPAGLVIYYCWNNLLTVAQQMVIQRRMKSAVDKVGAIPAAAGRK 589


>gi|296115059|ref|ZP_06833701.1| 60 kDa inner membrane insertion protein [Gluconacetobacter hansenii
           ATCC 23769]
 gi|295978396|gb|EFG85132.1| 60 kDa inner membrane insertion protein [Gluconacetobacter hansenii
           ATCC 23769]
          Length = 719

 Score =  397 bits (1018), Expect = e-108,   Method: Composition-based stats.
 Identities = 203/588 (34%), Positives = 306/588 (52%), Gaps = 19/588 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+      VA+A+S +++  +Q    +P  +                           D 
Sbjct: 1   MDI-KRLMVAVAMSAMVLLGFQYLVPHPDHKAATQPALGAGQDTPAAAPGADAGNGATDA 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           +       PR+ +    + GSINL+GA+ DDL L+ YH  V   SP+V +L P     + 
Sbjct: 60  KDD-----PRLAINTGRVGGSINLRGARLDDLVLKDYHETVKPGSPLVRILDPRQDPQSN 114

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF 180
             E+ +++ A         T         LT   P+ L + N    +FE  +++D++Y+F
Sbjct: 115 LVEVGWLNIAGGQVRVPDATTVWSADQASLTQDQPVTLRWDNGQGQVFELVVAIDQNYMF 174

Query: 181 KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFI----AVLGDKSLVEQKYSD 236
            +   V N +   +   P  R+ R      T  + V EG I      L + S    +   
Sbjct: 175 SVTQKVHNQAAGPVSLYPYSRVDRAYTPVETGGYLVHEGPISVIDGRLDESSYKSVRNGT 234

Query: 237 IEKSSISNFHE-SNSWLGISDKYWASVFIPSKETSFHSQFKYLSDG--HARYQAKFSA-N 292
           I   + S     +  W GI+DKYW +  IP +++     + Y+ +      YQ  F+A  
Sbjct: 235 IPPGNTSWNKPGTGGWSGITDKYWLTAVIPQQDSLVTGSYGYVPEAGHEGVYQVGFTART 294

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
              I PG    T   +FAGAKE P +  YE  L IP F   +D+GWF F+  P+F ++ +
Sbjct: 295 PEVIAPGGDGVTETHVFAGAKEVPLLEKYEASLHIPSFWKAVDFGWFAFLTHPIFTVLDW 354

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
              L+GNFG+A+M  T+ VK LFFPLA KQ+ S   M+ +QPKI  LRE++K      L 
Sbjct: 355 LNTLLGNFGLALMAFTLVVKGLFFPLATKQFRSMGKMRQLQPKIKALRERYKD-DQMALN 413

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           + MI LYK   +NP +GC P+LLQIPVF+ +YKV+ +++EMRHAPF+GWI DL+AADPTN
Sbjct: 414 QHMIALYKEEKVNPASGCLPMLLQIPVFWCLYKVLFVTIEMRHAPFFGWIHDLSAADPTN 473

Query: 473 IFTLFGILPFYL---PGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFV 528
           IFTLFG++P+       F  +G+WPI   L+MF Q K++P P AD  Q  +   MP++F 
Sbjct: 474 IFTLFGLIPWDPTHISTFFQLGLWPIAFGLTMFAQQKINPAPAADPAQQKMFQLMPILFT 533

Query: 529 FALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSK 576
           F ++  P+GL+IY+ W+N++++ QQAVI +   AE      +R    K
Sbjct: 534 FFMARQPSGLVIYYCWNNLLTMAQQAVIQRRVNAEAKAPVVIRPEKEK 581


>gi|148261132|ref|YP_001235259.1| 60 kDa inner membrane insertion protein [Acidiphilium cryptum JF-5]
 gi|326404533|ref|YP_004284615.1| inner membrane protein OxaA [Acidiphilium multivorum AIU301]
 gi|166975846|sp|A5G0F8|OXAA_ACICJ RecName: Full=Inner membrane protein oxaA
 gi|146402813|gb|ABQ31340.1| protein translocase subunit yidC [Acidiphilium cryptum JF-5]
 gi|325051395|dbj|BAJ81733.1| inner membrane protein OxaA [Acidiphilium multivorum AIU301]
          Length = 601

 Score =  393 bits (1009), Expect = e-107,   Method: Composition-based stats.
 Identities = 200/601 (33%), Positives = 303/601 (50%), Gaps = 30/601 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVY-----------PRIEEMNNERKNIQTVKQPNQVD 50
             N     +I++S++I+  +Q    Y           P  +    +  + Q         
Sbjct: 1   MDNRRLLYSISISLVILVLFQVIASYVLPPPKKAPPHPATQTAQTQPVSGQPAPGVPAPS 60

Query: 51  NSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTL 110
               A      A  +   PR+ +  P L GS++L GA+ DDL L  YH  V   SP+V L
Sbjct: 61  AVPPAAAPGGVAAKIPAGPRLAISTPLLRGSMSLVGARLDDLVLTRYHQTVKKTSPLVQL 120

Query: 111 LSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFER 170
           LS + T  +Y+ +  + +   +             SG  L+P  P+ L + N   + FE 
Sbjct: 121 LSQAGTAKSYYVQFGWDAAPGSSLKVPGPDTVWTSSGGDLSPAHPVTLSWNNGAGVTFEL 180

Query: 171 TISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLV 230
            +++D  YLF +   V N+    +   P  RI R        +F + +G I V       
Sbjct: 181 KLAVDRQYLFTVQQRVINHGAAAVEVYPWSRIRRDFLPEEPGSFTLHKGPIGVFHGTLHE 240

Query: 231 ----------EQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
                     +   +     +         W GI+ KYW +  IPS+       ++YL+D
Sbjct: 241 MGYEGVKSGGKHPAAGDAPGTAYQTTNLGGWAGITGKYWLTALIPSQGREVIGAYRYLAD 300

Query: 281 GHARYQAKF-----SANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLID 335
                   +     +A  +   PG + +TT  +FAGAK    + HYE    IP FE  ID
Sbjct: 301 PGQPEHGGYQVDYMTAKPVDAAPGATASTTTHVFAGAKVLSILSHYETQYRIPLFERAID 360

Query: 336 WGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPK 395
           +GWF+F+ KP+F+ + Y   + GN G+AI++ T+ +KL+ FPL +  Y S A M+ I PK
Sbjct: 361 FGWFFFLTKPIFIALDYLAGVFGNMGVAIIVFTIGLKLVLFPLVRTSYRSMARMRAITPK 420

Query: 396 IDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRH 455
           +  LRE++K    Q  QK ++ LYK   +NP AGC P+L QIP+FF++YKVI IS+ MRH
Sbjct: 421 VQALRERYKDDQMQ-QQKEIMALYKAEGVNPAAGCLPMLPQIPIFFSLYKVIFISIGMRH 479

Query: 456 APFWGWIKDLAAADPTNIFTLFGILPFYLPG---FMHVGIWPIIMSLSMFIQMKMSPPPA 512
           APF  WI DL+A DPTNIF LFG+LPF+      F+H+GI PIIM ++M+ Q +++PPP 
Sbjct: 480 APFVLWIHDLSAEDPTNIFNLFGLLPFHPSALSPFLHLGILPIIMGITMWGQQRLNPPPP 539

Query: 513 DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRS 572
           D  QA ++ +MPV+F F L  F AGL++Y+  +N ++I+QQ  IM+   A       L +
Sbjct: 540 DPTQAKMMQFMPVIFTFMLGRFAAGLVLYYCVNNTLTILQQWTIMRGTNAAPRAAANLNA 599

Query: 573 T 573
            
Sbjct: 600 K 600


>gi|296283114|ref|ZP_06861112.1| putative inner membrane protein translocase component YidC
           [Citromicrobium bathyomarinum JL354]
          Length = 585

 Score =  393 bits (1009), Expect = e-107,   Method: Composition-based stats.
 Identities = 201/589 (34%), Positives = 319/589 (54%), Gaps = 15/589 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQ----NFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAV 56
           M+   N  +A+ L  I++  ++     +Y  P   E  +     +     +   N   A 
Sbjct: 1   MDNQRNLILAVVLCGILILGYEAAVTYYYPTPPETEQVDRATTAEQRVTQDTAQNPAIAA 60

Query: 57  LIDDRA----QALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLS 112
              D A    +ALS   RV +  P + GSINL GA+ DD+ L+ +   V  +S  V L +
Sbjct: 61  AAIDEAVDLDEALSAGNRVAIDAPRVEGSINLVGAKIDDIELKDHRATVDKDSGPVQLFA 120

Query: 113 PSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTI 172
           P+ T    FA+  +V      ++P ++TVW   SG+ LTP TPI L + NA    F   +
Sbjct: 121 PAGTPIQNFAQFGFV--GEGTQVPGADTVWQ-ASGEALTPDTPIDLRWDNAQGQRFRIRL 177

Query: 173 SLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ 232
           S+D++Y+     TV N     +  SP   I R     + +T+    G I   G       
Sbjct: 178 SIDDNYMITAEQTVANTGDAPVVVSPFATITRTSLTASKSTWISHSGPIGTFGGTVDYGP 237

Query: 233 KYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSAN 292
            Y D+ +  + +     +WLG +D YW    IP   ++  + F+ L  G   ++A    N
Sbjct: 238 DYDDVVEQKVVSGAADPAWLGFTDIYWLGALIPEAGSAPDTGFRSL--GDNLFRADLIYN 295

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
             T+ PG+ IT T+ LFAGAKE   +  Y +D  I +F + IDWGWF +  KP+  L+  
Sbjct: 296 PATLQPGRQITRTSRLFAGAKESGVLDAY-QDAGIAQFGLAIDWGWFRWFEKPILWLLLQ 354

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
            +++VGNFG+AI+L T  V+ L FP+A+K + S A+MK IQP++ +L+EK K       Q
Sbjct: 355 IFSVVGNFGVAIILLTCIVRGLMFPIAQKGFSSMASMKAIQPEMKKLQEKHKDDKVT-QQ 413

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           + M +L+K   +NP+AGC P+LLQIPVFFA+YKV+ +++EMRH PF  WI+DL+A DP +
Sbjct: 414 QEMQKLFKERGVNPVAGCLPMLLQIPVFFALYKVLILAIEMRHQPFIFWIRDLSAPDPAH 473

Query: 473 IFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALS 532
           I  LFG+LPF +PG + +G   +++  +M++  +++P   D  Q  + + MP V +F +S
Sbjct: 474 ILNLFGMLPFEVPGMLALGPLALLLGFTMWLTFRLNPAAMDPVQQQVFSIMPWVMMFVMS 533

Query: 533 SFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNSQ 581
            F AGL++YW+ SN++++ QQ  +   H       ++ R+  +    S+
Sbjct: 534 PFAAGLLLYWNTSNILTLAQQKYLYSKHPQLREAAEKERAEKAAKAQSE 582


>gi|167644608|ref|YP_001682271.1| putative inner membrane protein translocase component YidC
           [Caulobacter sp. K31]
 gi|254772764|sp|B0T872|OXAA_CAUSK RecName: Full=Inner membrane protein oxaA
 gi|167347038|gb|ABZ69773.1| 60 kDa inner membrane insertion protein [Caulobacter sp. K31]
          Length = 630

 Score =  392 bits (1007), Expect = e-107,   Method: Composition-based stats.
 Identities = 204/627 (32%), Positives = 317/627 (50%), Gaps = 49/627 (7%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNE-----RKNIQTVKQPNQV--DNSYA 54
           + N N  + +  +  I+  +Q   + P+ ++   E         Q   QP      +   
Sbjct: 4   DSNKNTLMFLVCAFAILIGYQFLVMGPQQKQREAELRAKKAAEAQVAVQPGMTIGADGTP 63

Query: 55  AVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPS 114
             L   R +A + SPR+ +  P+L GSI LKGA+ DDL L+ Y      NSP V L  P 
Sbjct: 64  QPLKLSRDEAKAQSPRIAVDTPALSGSIALKGARIDDLWLKRYTQTADKNSPPVELFRPE 123

Query: 115 NTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISL 174
             ++A+FA+  +   A    LP   TVW    G++L PTTP+ L + N   ++F RTIS+
Sbjct: 124 GAEHAWFADFGWAGIAGMTGLPTPQTVWTAAPGQVLRPTTPVVLTYDNGQGLVFTRTISV 183

Query: 175 DEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSL----- 229
           D   +F + DTV N     +  +P   + R    T       +   +   G   L     
Sbjct: 184 DADAMFTVADTVRNQGGAAVALAPYASVQRQGIPTEGPHGLGKTQIVYEGGIGVLGGIDG 243

Query: 230 ---------VEQKYSDIEKSS--ISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYL 278
                     + KY   +K      N      W+G++DKYW +  +P +      +F+  
Sbjct: 244 VEGGKYILQNKAKYPKWKKDKPLQDNLQSKGGWIGMTDKYWLAALVPQQSEMIKGRFQVK 303

Query: 279 S-DGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLA----------- 326
              G   Y++ F+    ++  G ++T T  LFAGAK  P +  Y+               
Sbjct: 304 PVSGVDVYESAFTGAPKSLAAGATVTNTTRLFAGAKTVPLLTRYQYGGKPVVWWEFWNRP 363

Query: 327 ---IPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQY 383
              IP F+  +DWG F  I +P+F ++  FY +VGNFG+AIML TV +KL+ FPLA K Y
Sbjct: 364 ANVIPNFDKAVDWGMFEVITRPIFNVLEIFYKMVGNFGVAIMLLTVALKLILFPLADKSY 423

Query: 384 VSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAI 443
            S A MK I P++++L+ K K  P +  Q+ M+ LY    INP+ GC P+L+QIP+F+++
Sbjct: 424 ESMAKMKKIAPEVEKLKVKNKDDPAK-QQQEMMALYAKEKINPMMGCVPMLIQIPIFYSL 482

Query: 444 YKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGF----------MHVGIW 493
           YKV+++++EMRHAPF+GWI DL+A DP+    LFG++ +               +H+G+W
Sbjct: 483 YKVLTVTIEMRHAPFFGWITDLSARDPSTFMNLFGLIHWDPATAPLIGAFLSGPLHIGVW 542

Query: 494 PIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQ 553
           P++   +M++   M+PP  D  Q  I  + P+VF F LS F  GL+IYW WSNV++I+QQ
Sbjct: 543 PLLYGFTMWLTTAMNPPAGDPIQQKIFQFFPIVFTFTLSQFAVGLVIYWCWSNVLTILQQ 602

Query: 554 AVIMKMHGAEIGLIDRLRSTFSKNYNS 580
            +IM  +  +  +   +     K   +
Sbjct: 603 YIIMHRYKVDNPIDQLVNRLRGKTVEA 629


>gi|326386366|ref|ZP_08207989.1| putative inner membrane protein translocase component YidC
           [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209027|gb|EGD59821.1| putative inner membrane protein translocase component YidC
           [Novosphingobium nitrogenifigens DSM 19370]
          Length = 606

 Score =  392 bits (1006), Expect = e-107,   Method: Composition-based stats.
 Identities = 192/607 (31%), Positives = 305/607 (50%), Gaps = 34/607 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQ----NFYV----------------YPRIEEMNNERKNI 40
           ME+  N   A+ L  II+  W      FY                        + +    
Sbjct: 1   MEKQRNLIWAVVLMGIILIGWDLGLRYFYPHAGEHPHAAASSTATSASGTAPASGDAAPA 60

Query: 41  QTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLD 100
           +  ++      +  A+   D   AL+   RV +  P + GSINL G   DDL L  +   
Sbjct: 61  KPTREGGLQSPADIAIEAQDLKTALAAPTRVAIAAPGVSGSINLVGGLIDDLTLNRHRET 120

Query: 101 VSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVF 160
             + SP V L SP+ T   ++A+L +    N ++ P  NTVW       LTPTTP+ L +
Sbjct: 121 SDAGSPPVRLFSPAGTPAQHYAQLGWTG-DNGVQTPQGNTVWQ-ADRTRLTPTTPVTLRW 178

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGF 220
            NA    F    ++DE+Y+     +VTN     +   P   I R     + +T+ V  G 
Sbjct: 179 TNATGQTFAIRYAIDENYMISAQQSVTNAGTAPVSVKPFALINRTDRTASLDTWQVHSGP 238

Query: 221 IAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
           I            Y D+  +         +W+G +D YW S  +P   T     F+ L +
Sbjct: 239 IGAFDGSVDFASHYKDVNAAGEVAPAGQTNWIGFTDIYWLSALVPDAGTKPSGSFRALGN 298

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
           G   ++A       T+ PG++++ +  LFAGAKE   +  Y +   I  F + IDWGWF 
Sbjct: 299 GF--FRADLIYPAATVAPGQTVSQSLRLFAGAKENRVLEAY-EAQGISNFSLAIDWGWFR 355

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           +  KP+F L+   ++ V NFGIAI+L T+ V+ + FP+A++Q+ S A M+ IQPK+  ++
Sbjct: 356 WFEKPIFWLLDSLFHAVKNFGIAIILLTLIVRGIMFPVAQRQFASMAAMRAIQPKMKAIQ 415

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E++K   P   Q+ ++ LYK   +NPLAGC P+ LQIPVFFA+YKV+ +++EMRH PF  
Sbjct: 416 ERYKDDKP-RQQQEIMALYKEEGVNPLAGCLPMFLQIPVFFALYKVLVLTIEMRHQPFAL 474

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMIL 520
           WI DL++ DPT++  LFG+LPF   G   +G+  +++  +M++Q K+ P   D  Q  ++
Sbjct: 475 WIHDLSSPDPTHLLNLFGLLPFTPTGMFGIGVLALLLGATMWLQFKLQPAAMDPSQQQVM 534

Query: 521 NWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHG--------AEIGLIDRLRS 572
             MP + +F +S+F +GL+IYW  SN+++I QQ  +   H          ++ +  +++ 
Sbjct: 535 AIMPWMMMFVMSTFASGLLIYWITSNLLTIAQQRYLYSRHPQLKAQATKDQVDIDRQVKR 594

Query: 573 TFSKNYN 579
                 N
Sbjct: 595 ERKPAPN 601


>gi|85709448|ref|ZP_01040513.1| putative inner membrane protein translocase component YidC
           [Erythrobacter sp. NAP1]
 gi|85688158|gb|EAQ28162.1| putative inner membrane protein translocase component YidC
           [Erythrobacter sp. NAP1]
          Length = 595

 Score =  392 bits (1006), Expect = e-107,   Method: Composition-based stats.
 Identities = 190/577 (32%), Positives = 296/577 (51%), Gaps = 25/577 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQ----NFYVYPRIEEMNNERKNIQTVKQPNQV------- 49
           M+   N  +A+ LS +++ +W      FY    +   +       +              
Sbjct: 1   MDNQRNILLAVVLSGLLILSWDMGMRYFYPQSDVPAPSEVMSGAASDPADADTVTSSTDG 60

Query: 50  -----DNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
                  + A V   D   AL+   RV +  P + GSINL GA+ DDL L+ Y       
Sbjct: 61  PAGDLGEAAAEVGPVDLGTALASENRVIIDAPRVAGSINLVGARVDDLVLKDYDETTQEG 120

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           S  V +L+P  T   ++AE  +V     +             G+ LTP TP+ L   + N
Sbjct: 121 SDPVRILAPDRTDEQHYAEFGFVVGGQRMSSRAIWE----ADGERLTPETPVTLSRTDEN 176

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVL 224
            I +    S+D++Y+     TV N S +     P   I R     + + F    G   V 
Sbjct: 177 GITYRVAFSIDDNYMVSAQQTVENGSENAAIVQPFALIKRTSETASPDQFIAHAGPTGVF 236

Query: 225 GDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR 284
           G        Y ++ +    N   + SWLG +D YWAS  IP +  +  + ++ L  G   
Sbjct: 237 GGSLYDPNSYEELAELGRDNPAGAVSWLGFTDNYWASALIPGEGEADSAGWRSL--GDQL 294

Query: 285 YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAK 344
           ++A    +  T+  G S+T    LFAGAKE   +  Y +D  I  F   I WGWF +  K
Sbjct: 295 FRADLIYDAQTVPAGGSLTRGTQLFAGAKESAILDQY-EDAGITYFGKAISWGWFEWFEK 353

Query: 345 PMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK 404
           P+  L+     LVGNFG+AI+L TV ++ L FP+A+KQ+ S A MK +QPK+  ++E++K
Sbjct: 354 PLLWLLRTLNGLVGNFGVAIILLTVIIRGLLFPIAQKQFASMAQMKAVQPKMKAIQERYK 413

Query: 405 QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKD 464
               Q  Q+ +++LYK   +NPLAGC P+L+QIP+FFA+YKV+ +++EMRH P + ++ D
Sbjct: 414 DDK-QTQQQKIMELYKEEKVNPLAGCLPLLIQIPIFFALYKVLYLAIEMRHEP-FLYMSD 471

Query: 465 LAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMP 524
           L+A DP  I  LFG+LP+ +PGF+ +GI  +++ ++M++  K++P   D  Q  I N MP
Sbjct: 472 LSAPDPAKILNLFGLLPYDVPGFLGIGILAVLLGVTMWLTFKLNPSAMDPVQQQIFNLMP 531

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHG 561
              +F ++ F AGL+IYW  SNV+++ QQ+ +   H 
Sbjct: 532 WFLMFVMAPFAAGLLIYWVTSNVLTLAQQSYLYSRHP 568


>gi|87198602|ref|YP_495859.1| putative inner membrane protein translocase component YidC
           [Novosphingobium aromaticivorans DSM 12444]
 gi|87134283|gb|ABD25025.1| protein translocase subunit yidC [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 600

 Score =  391 bits (1004), Expect = e-106,   Method: Composition-based stats.
 Identities = 193/575 (33%), Positives = 305/575 (53%), Gaps = 21/575 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQ----NFYVYPRIEEMNNERKNIQTVKQPNQV------- 49
           M+   N  +A+ L+ I++  W      FY  P  +       + +               
Sbjct: 1   MQNQRNLIMAVVLTGILLLGWDVAMRWFYPQPAQKPKVEAAASAEPANGEKPKRTREGGL 60

Query: 50  -DNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIV 108
            +    A+   D AQ L+   R+ +  P L GSINLKGA  DD+ L  +   V  NS  V
Sbjct: 61  QNAGDIALEKKDLAQELAAGHRIAIDAPGLKGSINLKGALVDDVTLARHREGVDRNSAPV 120

Query: 109 TLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILF 168
            L SP+ T   +FA++ +V     +  P++NT+W    G  LTP TP+ L + NA+   +
Sbjct: 121 RLFSPAGTPAQHFAQIGWV--GEGVAAPDANTMWQ-ADGAKLTPQTPVTLRWTNASGQTY 177

Query: 169 ERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKS 228
               ++D  Y+      V N     +   P   + R     + +T+ V  G I       
Sbjct: 178 SIRYAIDGDYMITATQGVANTGPAPVVVRPFALVNRTDKTASLDTWNVHSGPIGAFDGSV 237

Query: 229 LVEQKYSDIEKSS--ISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQ 286
             +  YS + ++      F  + +W+G +D YW S  IP       + F+ L  G   Y+
Sbjct: 238 NFDNNYSTVAEAEGGAIPFKGTANWIGFTDIYWLSALIPDANAKAEAAFRSL--GQGVYR 295

Query: 287 AKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPM 346
           A      ++I PGK+++ T  LFAG KE   +  Y +   +  F + IDWGWF +  KP+
Sbjct: 296 ADLIYPSVSIAPGKALSQTVRLFAGGKENAVLEKY-EAAGVTNFSLSIDWGWFRWFEKPI 354

Query: 347 FMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQS 406
           F L+   +  VGNFG+AI+L T+ V+ + FP+A++Q+ S A M+ +QPK+  ++E++K  
Sbjct: 355 FWLLDSIFKKVGNFGVAIILLTLIVRGVMFPIAQRQFASMAAMRALQPKMKAIQERYKDD 414

Query: 407 PPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLA 466
             Q  Q+ +++LYK   +NPLAGC PI LQIPVFFA+YKV+ +++EMRH PF  WIKDL+
Sbjct: 415 K-QKQQQEIMELYKREKVNPLAGCLPIFLQIPVFFALYKVLVLTIEMRHQPFALWIKDLS 473

Query: 467 AADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVV 526
           A DP ++  LFG+LPF  P F+ +G+  I++ ++M++Q K+ P   D  Q  +  +MP +
Sbjct: 474 APDPLHVLNLFGLLPFDPPSFLGIGVLAILLGITMWLQFKLQPAAMDPAQQQVFAFMPWI 533

Query: 527 FVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHG 561
            +F ++ F AGL+IYW  SN+++I QQ  +   H 
Sbjct: 534 MMFVMAPFAAGLLIYWITSNLLTIAQQKYLYSRHP 568


>gi|319405206|emb|CBI78811.1| translocase precursor subunit [Bartonella sp. AR 15-3]
          Length = 612

 Score =  390 bits (1002), Expect = e-106,   Method: Composition-based stats.
 Identities = 253/610 (41%), Positives = 361/610 (59%), Gaps = 30/610 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQ------------------T 42
           ME N N+F+AI LS ++  AW   YV P+  ++   +   Q                   
Sbjct: 1   MEYNRNFFIAIGLSFVVFVAWHFLYVIPQQAKLQESKIIAQKLSNHNAALPTNDMHFSNN 60

Query: 43  VKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVS 102
               + V  +   +  + R   L+ + R+ +K   L GSINL G +FDDL L+ Y L V 
Sbjct: 61  ALTDDTVPVTNRPITPEMRKAELAKTDRILIKTNELEGSINLVGGKFDDLLLKKYRLKVD 120

Query: 103 SNSPIVTLLSPSNTKNAYFAELDYVSTANNIE-LPNSNTVWNLISGKIL-TPTTPIKLVF 160
             SP + LL+PS    AYFAE  + S++   + LP SNT W L     + TP+TPI LV+
Sbjct: 121 KKSPEIILLNPSGLPTAYFAEFGFTSSSLPAKALPQSNTKWQLEGYNTILTPSTPITLVY 180

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGF 220
            N    +F RT S+D+HY+F I D+++N S   I  S   R+ R  P   TN   +    
Sbjct: 181 NNGQGQIFHRTFSVDDHYMFTIKDSISNESSSPIYISSYARVARTAPPEDTNATYLLHEG 240

Query: 221 IAVLGDKSLVEQKY---------SDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSF 271
           +  +   SL  +KY             + SI   + +  W+GI+DKYWA   IP ++  +
Sbjct: 241 MIGIAGNSLKTEKYTALAELSPNPQNGQKSIIFPNITGGWIGITDKYWAVAVIPPQDKEY 300

Query: 272 HSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFE 331
            S+F Y    +  YQ+   +  +T+ P ++ T  N  FAGAK    I+HY+  L I +F 
Sbjct: 301 TSRFVYFDRLNTHYQSDLQSALLTVSPHETKTIINRFFAGAKRVEIINHYQNQLKINKFS 360

Query: 332 MLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKN 391
           +LIDWGWF FI KPMF L+   Y    NFGIAI+L TV +K+L FPLA K Y S A +K 
Sbjct: 361 LLIDWGWFDFITKPMFTLIDILYKYTENFGIAILLITVLLKILLFPLAHKSYKSMARIKL 420

Query: 392 IQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISL 451
           IQP + E++EK+     +  Q+A+I+LYKT  INP AGCWPIL+Q P+FFA+YKV+ I++
Sbjct: 421 IQPMMLEIKEKYANDRNK-QQQAIIELYKTKKINPFAGCWPILVQFPIFFALYKVLYITI 479

Query: 452 EMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP 511
           EMRHAPF+GWI+DLAA DPT+IF LFG+LP+ +P F+ +G WP+IM ++MF+QM+M+P P
Sbjct: 480 EMRHAPFFGWIQDLAAPDPTSIFNLFGLLPYAVPTFLILGAWPLIMGITMFLQMQMNPLP 539

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLR 571
            D  Q ++  WMPV+F   L+SFPAGL+IYW+W+N++SI+QQ++IMK  G +I   D L+
Sbjct: 540 QDPTQVIVFRWMPVIFTVMLASFPAGLVIYWAWNNILSIIQQSIIMKCQGVKIEFFDNLK 599

Query: 572 STFSKNYNSQ 581
           +   K    +
Sbjct: 600 AIVQKKSKKE 609


>gi|149186358|ref|ZP_01864671.1| putative inner membrane protein translocase component YidC
           [Erythrobacter sp. SD-21]
 gi|148829947|gb|EDL48385.1| putative inner membrane protein translocase component YidC
           [Erythrobacter sp. SD-21]
          Length = 579

 Score =  390 bits (1001), Expect = e-106,   Method: Composition-based stats.
 Identities = 185/566 (32%), Positives = 299/566 (52%), Gaps = 14/566 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQN----FYVYPRIEEMNNERKNIQTVKQPNQVDN-SYAA 55
           ME + N+ + + LS+ ++  WQ     FY  P    +  E  +               +A
Sbjct: 1   MENSRNFVLVLTLSLAVLIGWQWAMDHFYPQPDNVPVTAETVDTPAEAAAAASGEIGESA 60

Query: 56  VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSN 115
               D   +L  + R+ + +P + GSI + GA  DD+ L+ Y      +S  V + +P  
Sbjct: 61  ATSVDLESSLGAAERIRIDSPKVAGSIAVGGAMIDDIVLKDYAASPDGDSEPVRIFAPRG 120

Query: 116 TKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD 175
           T    +A+  ++     I             G  L+   P+ L     N +L E+T S+D
Sbjct: 121 TDVQQYAQFGFLVNGAKISDDVLWE----SDGDTLSVGNPVTLRHDAGNGVLLEQTYSID 176

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
           E+Y+  +   V+N   + I   P G + R     + + F    G I   G        YS
Sbjct: 177 ENYMITVEQAVSNRGENGIVAQPFGLVGRTSTTMSDDFFIAHSGPIGSFGQAVEYGYDYS 236

Query: 236 DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
           D+E+    +   +  WLG +D YW +  +P   T   + F+ L  G   Y+A    + + 
Sbjct: 237 DVEEERKVSPSGTTDWLGFTDIYWLAALVPQAGTDPDATFRSL--GGDLYRADMIYDPVR 294

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           +  G+ +TTT+ LFAGAK+   +  Y +D  IP+F + IDWGWF +  KP   L+   + 
Sbjct: 295 VEAGRKVTTTSRLFAGAKDSEILDAY-QDAGIPQFGLAIDWGWFRWFEKPFLWLLKNIFA 353

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
           LVGNFG+AI++ T+ V+ L FP+A+KQ+ S A MK IQPK+ +L+E+ K    +  Q+ M
Sbjct: 354 LVGNFGVAIIILTIIVRGLMFPIAQKQFASMAAMKAIQPKMKKLQERHKDDKVK-QQQEM 412

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
            +L+K   +NPLAGC P++LQIP+FFA+YKV+ +++EMRH   + WI+DL+A DP  I  
Sbjct: 413 QKLFKEEQVNPLAGCLPLILQIPIFFALYKVLYLAIEMRHQ-NFLWIEDLSAPDPATILN 471

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFP 535
           LFG+LPF  P F+ +GI  +++ ++M++  K++P   D  Q  + + MP V +F ++ F 
Sbjct: 472 LFGLLPFTPPSFLAIGILAVLLGVTMWLTFKLNPSAMDPVQQQVFSIMPWVLMFIMAPFA 531

Query: 536 AGLIIYWSWSNVISIVQQAVIMKMHG 561
           AGL++YW  SNV+++ QQ  +   H 
Sbjct: 532 AGLLLYWVTSNVLTLAQQKYLYSKHP 557


>gi|296535613|ref|ZP_06897793.1| inner membrane protein OxaA [Roseomonas cervicalis ATCC 49957]
 gi|296264068|gb|EFH10513.1| inner membrane protein OxaA [Roseomonas cervicalis ATCC 49957]
          Length = 524

 Score =  390 bits (1000), Expect = e-106,   Method: Composition-based stats.
 Identities = 198/499 (39%), Positives = 300/499 (60%), Gaps = 12/499 (2%)

Query: 69  PRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVS 128
            R+ +++P + GS+ L+GA+ DDL L+ Y    +++SP+V + +P      YFA+  + S
Sbjct: 8   QRLRVESPRVSGSLLLRGARLDDLVLKDYRETTAASSPLVRMFAPREELQPYFAQWGWSS 67

Query: 129 TANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTN 188
                 +P++ T W   SG  L P +P+ L ++N     F+  +SLD +Y+F+    V N
Sbjct: 68  ADGRTRVPDNETDWT-ASGGPLGPDSPVTLSWENGQGQTFQIVLSLDRNYMFQAEQRVIN 126

Query: 189 NSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSIS----- 243
           ++ D +   P  R+ R +       + + EGF+ VL    L E  Y   +          
Sbjct: 127 SAADPVLVLPWSRVRRERTPHVAGFYILHEGFVGVLN-GRLNELTYKSAKDDGARTRGVA 185

Query: 244 -NFHESNSWLGISDKYWASVFIP-SKETSFHSQFKYL-SDGHARYQAKFSAN-EITILPG 299
                S  W G +DKYW +   P        + ++++  +G  R+Q  F+     T+  G
Sbjct: 186 LEQETSGGWAGFTDKYWLAAIAPVDAAQPLRAAWRHVAENGEDRWQVDFATPQPQTVASG 245

Query: 300 KSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGN 359
            + +    LFAGAKE   +  Y  +L I  F+  ID+GWFYF+ KP F  + Y + L GN
Sbjct: 246 ATGSIATRLFAGAKEVHLLDAYRDNLGITDFDKAIDFGWFYFLTKPFFYALDYLFKLFGN 305

Query: 360 FGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLY 419
           FGIAI++ TV +KL FFPLA K Y S A MK + PK+ E+RE++K  P +     M+ LY
Sbjct: 306 FGIAILVFTVALKLAFFPLANKAYKSMARMKVLTPKMQEIRERYKDDPAKAQS-EMMALY 364

Query: 420 KTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGI 479
           ++  +NP +GC PIL+QIPVFFA+YKV+ +++EMRHAPF+GWI+DL+A DPTN+F LFG+
Sbjct: 365 RSEKVNPASGCLPILIQIPVFFALYKVLFVTIEMRHAPFFGWIRDLSAPDPTNLFNLFGL 424

Query: 480 LPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLI 539
           +P+  P  +H+ +W IIM ++MF+Q K++P PAD  QA I  WMP++F F L+SFPAGL+
Sbjct: 425 IPWDPPALLHMPVWAIIMGVTMFVQQKLNPAPADPIQAKIFTWMPIIFTFMLASFPAGLV 484

Query: 540 IYWSWSNVISIVQQAVIMK 558
           IYWSW+N++S+ QQ  IM+
Sbjct: 485 IYWSWNNLLSVAQQWYIMR 503


>gi|319898441|ref|YP_004158534.1| translocase precursor subunit [Bartonella clarridgeiae 73]
 gi|319402405|emb|CBI75946.1| translocase precursor subunit [Bartonella clarridgeiae 73]
          Length = 612

 Score =  389 bits (998), Expect = e-106,   Method: Composition-based stats.
 Identities = 248/610 (40%), Positives = 361/610 (59%), Gaps = 30/610 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAA----- 55
           ME N N+F+AI LS ++  AW   Y+ P+  ++   +     +   N    +        
Sbjct: 1   MEYNRNFFIAIGLSFVVFVAWHFLYIVPQQAKLQESKIIAHKLSNHNSTFPANDMHFSNH 60

Query: 56  -------------VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVS 102
                        V  + R   L+ + RV +K   L GSINL G +FDDL L+ Y L V 
Sbjct: 61  GLKDEIVSITNHHVTPEIRKAELAKTNRVLIKTNELEGSINLVGGKFDDLLLKKYRLTVD 120

Query: 103 SNSPIVTLLSPSNTKNAYFAELDYVSTANNIE-LPNSNTVWNLISGKIL-TPTTPIKLVF 160
             SP + LL+P+     YFAE  ++S++   + LP SNT W +     + TP+TPI L++
Sbjct: 121 KTSPEIILLNPNGLTTTYFAEFSFISSSLPAKALPQSNTKWQIEGNNTILTPSTPITLIY 180

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGF 220
            N    +F R  S+D HY+F I D+++N S   I  S   RI R  P   TN        
Sbjct: 181 NNGQGQIFRRIFSVDNHYMFTIKDSISNESSSPIHLSSYARIARAAPPEDTNATYFLHEG 240

Query: 221 IAVLGDKSLVEQKY---------SDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSF 271
           +  +   SL  +KY             + S+   + +  W+GI+DKYWA   IP ++  +
Sbjct: 241 MIGIAGDSLKTEKYTALAELNPNPKNGQKSVIFSNVTGGWVGITDKYWAVAVIPPQDKEY 300

Query: 272 HSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFE 331
            S+F Y    +  YQ+   +  +T+ P ++ T TN LFAGAK    I+HY+  L I +F 
Sbjct: 301 TSRFVYFDQLNTHYQSDLQSALLTVSPHETKTITNRLFAGAKRVEIINHYQNQLKINKFS 360

Query: 332 MLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKN 391
           +LIDWGWF FI KPMF  +   Y   GNFG+ I+L TV +K+L FPLA K Y S A++K 
Sbjct: 361 LLIDWGWFDFITKPMFAFIDILYKYTGNFGVTILLITVLLKILLFPLAHKSYKSMAHIKL 420

Query: 392 IQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISL 451
           IQP + E++EK+     +  Q+A+I+LYKT  INPLAGCWP+L+Q P+FFA+YKV+ I++
Sbjct: 421 IQPMMLEIKEKYAHDRNK-QQQAIIELYKTKKINPLAGCWPVLIQFPIFFALYKVLYITI 479

Query: 452 EMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP 511
           EMRHAPF+GWIKDLAA DPT+IF LFG+LP+ +P F+ +G WP+IM ++MF+QM+M+P P
Sbjct: 480 EMRHAPFFGWIKDLAAPDPTSIFNLFGLLPYTVPVFLTLGAWPLIMGITMFLQMQMNPLP 539

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLR 571
            D  Q ++  W+PV+F   L+SFPAGL+IYW+W+N++SI+QQ++IMK  G +I   D L+
Sbjct: 540 QDPTQVIVFRWIPVIFTVMLASFPAGLVIYWAWNNILSIIQQSIIMKCQGVKIEFFDNLK 599

Query: 572 STFSKNYNSQ 581
           +   K+   +
Sbjct: 600 AIVQKDTKKE 609


>gi|254421078|ref|ZP_05034802.1| 60Kd inner membrane protein [Brevundimonas sp. BAL3]
 gi|196187255|gb|EDX82231.1| 60Kd inner membrane protein [Brevundimonas sp. BAL3]
          Length = 599

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 214/599 (35%), Positives = 332/599 (55%), Gaps = 23/599 (3%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIE-----EMNNERKNIQTVKQPNQVDNSYAAV 56
           E + N  + I  S +I+  +    + P+ E     +     ++           +     
Sbjct: 4   ENSRNTIIFIVCSALILGVYWFAVLRPQAERRAVQQQAQAEQSQTAENAARTALSPQGPT 63

Query: 57  LIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNT 116
            + DR+QALS + RV +++ +L GS++L+G + DDL L  Y        P V L  P   
Sbjct: 64  FVTDRSQALSTAARVPIQSGTLKGSLSLQGGRIDDLFLTDYKETQDKPEP-VELFRPQGM 122

Query: 117 KNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE 176
           +NAYFA+  +        +P  NTVW L +G  LTPTTP+ L + N   + F R +S+D+
Sbjct: 123 QNAYFAQFGWTGPNVVGGVPGPNTVWRLTAGSTLTPTTPVTLTWDNGQGLRFTRLVSVDD 182

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHK-PQTATNTFGVQEGFIAVLG---DKSLVEQ 232
            Y+F I+DTV N     I  +P G + R   P  A ++  V EG I   G   D    ++
Sbjct: 183 RYVFSILDTVQNLGTQSITIAPYGSVQRQGVPPLAGSSHIVHEGAIGTFGKPGDYRTEQK 242

Query: 233 KYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLS-DGHARYQAKFSA 291
           KY D  K        +  WLGI+DKYW +  +P +  +  ++F+    +G  + +A    
Sbjct: 243 KYKDWLKEPRIENASTGGWLGITDKYWLAALLPQQNEAVETEFRVRDVNGGQQLEANILG 302

Query: 292 NEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMS 351
              TI PG + T T  LFAG K    +  YE+ L +PRF   IDWG F+F+ +P+F ++ 
Sbjct: 303 AARTIQPGGTATETQRLFAGVKRAEVLKTYEETLHLPRFVYAIDWGMFWFLTRPIFWILE 362

Query: 352 YFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVL 411
             Y LVG+FG+AI+  TV VKL+ FPLA   Y S + M+N+QPK++E+++KFK   PQ  
Sbjct: 363 NVYGLVGSFGVAILALTVIVKLVMFPLANNAYASMSKMRNLQPKMEEIKKKFKD-DPQKQ 421

Query: 412 QKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPT 471
           Q+  + LY+   INP+AGC P++LQIPVF+A+YKV+++++EMRH PF G+I DL+A DP+
Sbjct: 422 QQETMALYQKEKINPVAGCLPLVLQIPVFYALYKVLTVTIEMRHQPFLGFIHDLSARDPS 481

Query: 472 NIFTLFGILPFYLPGFMHVGIW----------PIIMSLSMFIQMKMSPPPADKGQAMILN 521
            ++ LFG++P+       +G             +   L+M++Q  M+PP AD  Q  I  
Sbjct: 482 VVWNLFGLIPWNPATLPLLGGLLVGPLGIGLLAVAYGLTMWLQTAMNPPAADPVQRQIFQ 541

Query: 522 WMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNS 580
           +MP+VF F ++ F AGL++YW+WSN+++I+QQ  IM  + AE  + D + +   K   +
Sbjct: 542 FMPLVFTFIMAPFAAGLLVYWAWSNILTILQQYYIMHRYKAENPIDDFI-ARIRKTKAA 599


>gi|332186329|ref|ZP_08388074.1| Inner membrane protein translocase component YidC, long form
           [Sphingomonas sp. S17]
 gi|332013697|gb|EGI55757.1| Inner membrane protein translocase component YidC, long form
           [Sphingomonas sp. S17]
          Length = 565

 Score =  382 bits (980), Expect = e-104,   Method: Composition-based stats.
 Identities = 189/564 (33%), Positives = 295/564 (52%), Gaps = 13/564 (2%)

Query: 2   ERNWNYFVAIALSVIIVYAW----QNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           E   N+ V   ++ +I++ W      F+          + K +  V        +     
Sbjct: 3   EDRKNFVVFAVIAALILFGWPLIQSKFFPSNPPATKIVDGKQVP-VANSTANPTATTPSA 61

Query: 58  IDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTK 117
           I DR   L+ +PRV +  P L GSINLKGA+ DDL L  Y   V+ +SP + LLSP+  +
Sbjct: 62  IRDRRVVLAETPRVAIDTPRLKGSINLKGARIDDLVLLDYKETVAKDSPPIRLLSPAGAE 121

Query: 118 NAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEH 177
            AYFA   + +   N    ++       S  +L P  P+ L   NA    F+ T+S+D+ 
Sbjct: 122 GAYFAGFGWRTDGLNPPAADTV---WTASAPVLRPGQPVTLTAANATGQRFQITLSVDKD 178

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           Y+F +  TV N     +  +  G + R       +            G            
Sbjct: 179 YMFTVQQTVANGGNAPVPVAAYGYVNRGISADPDSWTIHVGPMSVNDGTAHY--GPNWKD 236

Query: 238 EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITIL 297
              + + F  +  WLG +DKYW +  IP +  +F  QF+  +     YQA ++    T+ 
Sbjct: 237 LDKAPTRFTTTGGWLGFTDKYWLATLIPDQSKAFDGQFR--AGAGQTYQADYTLQPQTLA 294

Query: 298 PGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLV 357
           PG+ +T T   FAGAKE   +  Y       + +  +DWG+   + KP+F  + + + LV
Sbjct: 295 PGRQVTQTTRFFAGAKEVALLDRYTDKEGATKLDYALDWGYLRVLEKPIFYYLDWLFRLV 354

Query: 358 GNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQ 417
           GNFG+AI+L TV ++ L FP+A++Q+ S A M+ +QPK+  L+E++K      +Q+ ++ 
Sbjct: 355 GNFGVAIILLTVTIRALMFPIAQRQFASMAAMRAVQPKMKALQERYKDDKV-RMQQEVMA 413

Query: 418 LYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLF 477
           LYK   +NPLAGC P L+QIP+F+A+YKV+ +++EMRH PF  WIKDL+A DP     LF
Sbjct: 414 LYKQEKVNPLAGCLPTLIQIPIFYALYKVLMLTIEMRHQPFVAWIKDLSAPDPLTPVNLF 473

Query: 478 GILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAG 537
           G+LPF  P F+ +G+ PI++ +SM+ Q KM+P P D  Q  +   +P V +F ++ F  G
Sbjct: 474 GLLPFTPPHFIAIGVVPILLGISMYFQFKMNPQPMDDAQKQVFAILPWVLMFVMAPFAVG 533

Query: 538 LIIYWSWSNVISIVQQAVIMKMHG 561
           L +YW  +N ISI+QQ ++   H 
Sbjct: 534 LQVYWITTNCISILQQRLLYARHP 557


>gi|254293247|ref|YP_003059270.1| hypothetical protein Hbal_0879 [Hirschia baltica ATCC 49814]
 gi|254041778|gb|ACT58573.1| 60 kDa inner membrane insertion protein [Hirschia baltica ATCC
           49814]
          Length = 600

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 201/597 (33%), Positives = 323/597 (54%), Gaps = 24/597 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNER------KNIQTVKQPNQVDNSYAA 55
           +   ++ + I L + ++   Q F   P+ +     R        I      +   ++ A+
Sbjct: 6   QDQKSFMIGIGLVLCVMALSQFFIWGPQQKAQEQARLEAQAQAAIAAPSVSSGSVDTTAS 65

Query: 56  VLIDDRAQAL---SMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLS 112
               DRA+ L   S   R++    S+ GSI+LKGA+ DDL+++ +   +      V LLS
Sbjct: 66  AAPVDRAEILTDTSNGGRIDFDASSVDGSISLKGARLDDLSMKRHFETIEKTEE-VHLLS 124

Query: 113 PSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTI 172
           P  +K AY+A L +   A+   LP  +T+W   +G  LTP+TPI L ++    + F R I
Sbjct: 125 PQGSKGAYYAALGWRGDAD--RLPGVSTLWKQTAGSTLTPSTPITLGYETTQ-LSFSRKI 181

Query: 173 SLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQ 232
            +D++Y+F   DTVTNNS + +   P G + +         F +       +    L  Q
Sbjct: 182 EVDDNYMFTYTDTVTNNSSETLSIRPFGFMRQFGMPDDWKPFYILHEGAVGMAGNKLKLQ 241

Query: 233 KYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDG-HARYQAKFSA 291
           KY +++K     +     W+G++ KYW + FIP++  +   Q K + DG    Y A    
Sbjct: 242 KYKNLDKGKALAYTSQGGWIGLTQKYWMTAFIPAQTENVAVQSKVVMDGLRPTYVASIEG 301

Query: 292 NEITILPGKSITTTNFLFAGAKEFPTIHHYEK----DLAIPRFEMLIDWGWFYFIAKPMF 347
            +  I PG++ + +  +FAGAK    +  Y++      AIPRF   +DWG F+F  KP F
Sbjct: 302 TDRAIEPGQTASYSQRIFAGAKRVEVLDAYQQGATGQEAIPRFTDAVDWGNFWFFTKPFF 361

Query: 348 MLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSP 407
            L+S+F +  GNFG+AI+  TV VKL FFP+  K Y S A M+ + P+++E+++K+    
Sbjct: 362 WLLSHFNSWFGNFGLAILALTVIVKLAFFPIQNKAYASMAKMRKLMPQMEEIKKKWADDK 421

Query: 408 PQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAA 467
               QK  ++LYK    NP +GC P++ Q+ VF+ +YK + ++LEMRH PF+GWIKDL+A
Sbjct: 422 E-RQQKETMELYKREKANPFSGCLPLIPQMFVFYGLYKTLFVTLEMRHEPFFGWIKDLSA 480

Query: 468 ADPTNIFTLFGILPFYLPGF-----MHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNW 522
            DPT+   LFG LPF          + +G+ PI+   +M++   ++ PP D  Q M++ +
Sbjct: 481 PDPTSFLNLFGALPFDPSSLPLIGALSIGVLPILYGFTMWLLQNLNAPPPDPTQRMMMQF 540

Query: 523 MPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYN 579
           +P+VF F  + F AGL+IYW+WSN++SI QQ  IM+ +G E      +++ F K+  
Sbjct: 541 LPIVFTFIFAGFAAGLVIYWTWSNILSIAQQYYIMRKNGVETQFDKFIKAKFGKSEE 597


>gi|148284763|ref|YP_001248853.1| putative inner membrane protein translocase component YidC
           [Orientia tsutsugamushi str. Boryong]
 gi|146740202|emb|CAM80485.1| 60 kD inner-membrane protein, preprotein translocase subunit
           [Orientia tsutsugamushi str. Boryong]
          Length = 567

 Score =  375 bits (962), Expect = e-101,   Method: Composition-based stats.
 Identities = 203/570 (35%), Positives = 329/570 (57%), Gaps = 11/570 (1%)

Query: 1   ME-RNW-NYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDN---SYAA 55
           M+  N  N  +AI LS+ I+  W  FY  PR+ +M+N +K      + +  +      +A
Sbjct: 1   MDSDNRLNLILAITLSLAIILGWHFFYEKPRLIKMSNAQKEKIEYNKRSSTNQYLLHESA 60

Query: 56  VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSN 115
           + I D+   +  S RV++    L GSI+LKG +FDDL L GY  DV  NSP V LLSPS 
Sbjct: 61  LKIKDKVDIIDYSTRVKIMTNKLHGSISLKGLRFDDLILVGYKQDVLENSPDVELLSPSE 120

Query: 116 TKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD 175
           T  AYFAE+ +    N      ++         IL         + N +N+ F  ++S+D
Sbjct: 121 TATAYFAEVGWYCAKNADSDFPNSDTLWQTDKSILQANDTTTFTWTNKHNVQFIVSVSID 180

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
           ++Y+F I  ++ NNS  Q+     G I R+  +   +    Q    ++     L E  Y+
Sbjct: 181 DNYMFTINQSIVNNSKQQLAVQFHGLIHRNLAENENSANIFQGPIASIDSY--LNEVTYN 238

Query: 236 DIEKSSISNFHESN-SWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSAN-E 293
            +++    +++ +   WLGISDKYW + FIP  +  + + F Y   G  +YQ  F +  E
Sbjct: 239 KLKEKKHIDYNLNVVHWLGISDKYWLTSFIPDVKYRYSTSFMYGKAGFEKYQVSFLSPKE 298

Query: 294 ITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYF 353
           +    G S++  + LF GAKE   + +Y +   I  F+  ID+GWFY + KP+F  +S+F
Sbjct: 299 VVNSDGGSLSVVHHLFLGAKEVKLLDYYAEKYNIKLFDRAIDFGWFYILTKPLFYTLSFF 358

Query: 354 YNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQK 413
           Y   GNFG++I++ T+ +K++ F  + + Y S   M+++QP+I  L+E +     + L +
Sbjct: 359 YKYCGNFGVSILIVTILIKIMMFSFSNRSYSSMKKMRDLQPRIQRLQELYGDDKIK-LHQ 417

Query: 414 AMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNI 473
            ++ LYK   ++        L+Q+P+FF++YKV+ +++EMRHAPF  WIKDL+A DPT I
Sbjct: 418 EIMALYKKEKVSLAGSFLQSLIQLPIFFSLYKVLHVTIEMRHAPFLSWIKDLSALDPTCI 477

Query: 474 FTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPA-DKGQAMILNWMPVVFVFALS 532
           F LFG+LPF++PGF+++G  P++ S +M +Q K++P P  D  QA +L +MP++ +   +
Sbjct: 478 FNLFGLLPFHVPGFLNIGALPVLTSATMILQQKINPAPTADPAQAQVLKFMPLILLIVFN 537

Query: 533 SFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           +FPAGL+IYW+W+N++SIVQQ +I K++  
Sbjct: 538 NFPAGLLIYWTWNNILSIVQQFIINKINNK 567


>gi|329848429|ref|ZP_08263457.1| membrane protein insertase, YidC/Oxa1 family, N-terminal
           domain-containing protein [Asticcacaulis biprosthecum
           C19]
 gi|328843492|gb|EGF93061.1| membrane protein insertase, YidC/Oxa1 family, N-terminal
           domain-containing protein [Asticcacaulis biprosthecum
           C19]
          Length = 624

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 200/620 (32%), Positives = 320/620 (51%), Gaps = 42/620 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVD------NSYAA 55
           +   N    +  S+++++ +Q F   P+ ++   +R         +             A
Sbjct: 6   QDTRNMIYFLIASMVLLFGYQYFVTGPQQKKAQEQRAVAAAQASASSSSAVAAGLPVTGA 65

Query: 56  VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSN 115
             +  R QA++ +PRV++  PSL GS++LKGA  DDL L+ Y     + SP V LL P+ 
Sbjct: 66  AAVMTREQAIAAAPRVKIDTPSLRGSLSLKGALVDDLYLKSYKETTKAGSPDVELLRPAG 125

Query: 116 TKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD 175
           +  AY+ +  Y+   N   LP++NT+WNL SG +L+P  P+ L   N   ++F RT+S+D
Sbjct: 126 SDRAYYVQSGYIGQ-NIPGLPDANTMWNLQSGNVLSPGKPVVLTHDNGAGLMFTRTLSID 184

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFG----------VQEGFIAVLG 225
           ++Y+  + + V N     + FSP   ++R       +  G            +     + 
Sbjct: 185 DNYMITVAEAVANTGAGPVAFSPYSTVIRFDMPAGLDRTGVVHEGAIATFPNKIEAGKID 244

Query: 226 DKSLVEQKYSDIEKSSISNFHESN----SWLGISDKYWASVFIPSKETSFHSQFKYL-SD 280
                  KY D+ K       +       W G++DKYW +  IP+++       +    +
Sbjct: 245 RYKTQSLKYKDMAKEPEKKVFKDVASVGGWFGLTDKYWMAAVIPAQDQPVRFTTQANVQN 304

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
               Y+A +    +T+ PG++  + + +FAGAK    +  YE DL IPRF    DWG   
Sbjct: 305 NKPIYRAGYLDETVTVAPGQTWQSQSHIFAGAKLNSQLQAYENDLKIPRFGYATDWGSLQ 364

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           F+  PM+ L+   Y  +GNFG AI+  TV VK++F+PLA K Y S   MK +Q ++    
Sbjct: 365 FLTYPMYWLLDKLYGFLGNFGFAILALTVIVKIVFYPLAHKAYESMTKMKQVQDRLKPKL 424

Query: 401 EKFKQS---PPQVLQKAMIQLYKTHNINPLAG---CWPILLQIPVFFAIYKVISISLEMR 454
           +  K      PQ  Q+A ++LY+   +NP+AG   C P+LLQIPVF+A+YKV+ +++EMR
Sbjct: 425 DAIKSRFPDDPQKQQEATMKLYQDEKVNPMAGLGGCLPMLLQIPVFWALYKVLILAIEMR 484

Query: 455 HAPFWGWIKDLAAADPTNIFTLFGILPFYLPGF----------MHVGIWPIIMSLSMFIQ 504
           HAPF+GWIKDL+A DPT+   LFG+LPF               +H+G+  I+  LSM++ 
Sbjct: 485 HAPFFGWIKDLSAPDPTSFVNLFGLLPFEPATVPLIGGILAGPLHLGVVAILYGLSMWLS 544

Query: 505 MKMSPPPA-DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
            +M+P    D  Q  +L +MPV+  F ++    GLIIYW WSN+++I QQ  IM     E
Sbjct: 545 QQMTPTANVDPMQKKMLAFMPVILTFFMAQVAVGLIIYWIWSNILTIFQQWTIMHRLKVE 604

Query: 564 IGLI---DRLRSTFSKNYNS 580
             +     ++R+   +   +
Sbjct: 605 NPIDTGIGKVRALLDRKKAA 624


>gi|56552522|ref|YP_163361.1| putative inner membrane protein translocase component YidC
           [Zymomonas mobilis subsp. mobilis ZM4]
 gi|59803051|sp|Q9RNL5|OXAA_ZYMMO RecName: Full=Inner membrane protein oxaA
 gi|56544096|gb|AAV90250.1| YidC translocase/secretase [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 579

 Score =  372 bits (955), Expect = e-101,   Method: Composition-based stats.
 Identities = 174/585 (29%), Positives = 297/585 (50%), Gaps = 11/585 (1%)

Query: 1   MER---NWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           M+      N  +   LS +I++ W  F     +       +  +   +            
Sbjct: 1   MDDKHQQRNLVIVTILSALILFGWS-FVTKHWLSTPPAPTQQGKNQPKAELTAEESGDKP 59

Query: 58  IDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTK 117
           +    Q L  +PR+ +   S+ GS+NLKG + DDL L  +   ++ NSP V L SP+ T+
Sbjct: 60  LKPVDQVLQETPRLPILTESVEGSVNLKGLRLDDLTLIRHRETLAKNSPAVRLFSPAGTE 119

Query: 118 NAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEH 177
           NA+F    +  T  N+ LPN++++W   S K+     P+   + N    +F  T+S+D  
Sbjct: 120 NAWFTSFGW--TGENVALPNADSLWKADSDKLTADH-PVNFYWNNQQGQIFRITLSVDHD 176

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           Y+F   ++V N     +   P             +++ +  G I V          ++DI
Sbjct: 177 YMFNATESVINRGNSPVIVQPYVLTNHQGVFKTASSWTLHTGPIGVFNGSVNYHVDFADI 236

Query: 238 EKSSISNFHESN--SWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
           +K++ ++   +    W+G SDKYW +   P           + S  +  YQA F+   + 
Sbjct: 237 DKATNNSIRNNTQGGWIGFSDKYWLTALAP-HNQKIAIDTDFRSSSNHHYQADFTVAPVV 295

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           +  GK+ +T+  +FAGAKE   +  Y   L +P F+  IDWGWF  I K  F  + + + 
Sbjct: 296 VAAGKTASTSVDVFAGAKEVRVLDRYRDQLHLPHFDKAIDWGWFAIIEKVFFYYLDWLFL 355

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
            VGN+G+AI+L    ++ L FP+A KQY S A+M+ +QPK+  +RE++K      +++ +
Sbjct: 356 HVGNYGLAIILMVFTIRALIFPIANKQYASMASMRRLQPKMQAVRERYKNDEA-RMRQEL 414

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           + LY+   +NP AGC P+ +Q P+F A+YK + +++E RH PF  WIKDL+A DP   F 
Sbjct: 415 VTLYQKEKVNPFAGCLPMFIQFPIFIALYKTLLVTIESRHQPFILWIKDLSAPDPLTPFN 474

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFP 535
           LFG+L F  P F+ +G+ PII+ ++M++Q + SP   +  Q  I++++P++ V  ++   
Sbjct: 475 LFGLLHFTPPHFLMIGVLPIILGITMWLQFRASPQQLEPAQQQIMSFLPLISVIFMAPLA 534

Query: 536 AGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNS 580
           AGL +Y+ ++N+IS+ Q   +   H       DR          +
Sbjct: 535 AGLQVYYIFNNLISLAQMMWLQHRHSTPEERQDRAERKRPSKKKA 579


>gi|162147919|ref|YP_001602380.1| inner membrane protein oxaA [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161786496|emb|CAP56078.1| putative inner membrane protein oxaA [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 572

 Score =  372 bits (953), Expect = e-100,   Method: Composition-based stats.
 Identities = 188/560 (33%), Positives = 300/560 (53%), Gaps = 15/560 (2%)

Query: 32  EMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQALSMSP----RVELKNPSLIGSINLKGA 87
           E+  +         P     + A V         + +P    R+ +  P + GSI+L GA
Sbjct: 14  EVAQQAAQTSRQTPPTDAARAPAPVAGASSQPVSTPAPQAETRLAIDAPKVAGSIDLLGA 73

Query: 88  QFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISG 147
           + DD+ LR YH  V+  SP V +L P + +   + E+ +++           T       
Sbjct: 74  RLDDMVLRDYHETVAKGSPQVRILEPGHDQQPNYVEIGWMNLPGGQVRVPDATTVWSADA 133

Query: 148 KILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKP 207
             LT   P+ L + N   + F+  +S+D HY+F I   + N S   +   P  R+ R   
Sbjct: 134 PKLTSDRPVTLSWDNGAGVTFQIVVSIDAHYMFGIEQRIVNRSAQPVSLYPYARVDRAYT 193

Query: 208 QTATNTFGVQEGFI----AVLGDKSLVEQKYSDIEKSSISNFHESN-SWLGISDKYWASV 262
            T T  + V EG I      L + S    +       ++S        W GI+DKYW + 
Sbjct: 194 PTETGGYLVHEGPISVIDGRLDESSYKSLRTGATPPGNLSWTKGGQGGWAGITDKYWLTA 253

Query: 263 FIPSKETSFHSQFKYL-SDGHARYQAKFSANEIT-ILPGKSITTTNFLFAGAKEFPTIHH 320
            IP + T+    + Y  + G   YQ  F A   T + PG +  T + +FAGAKE   +  
Sbjct: 254 VIPQQGTAVTGSYGYQANGGAGVYQVGFIAQAATVVAPGTTGATVSHVFAGAKEVNLLEQ 313

Query: 321 YEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAK 380
           Y+  L IP F   +D+GWF F+ +P+F ++ +   L+GNFG+A+M  T+ VK LFFPLA 
Sbjct: 314 YQSSLHIPDFWKAVDFGWFAFLTRPIFYVLDWLNTLLGNFGLALMAFTLLVKALFFPLAT 373

Query: 381 KQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVF 440
           +Q+ S A M+ +QPK+ ELRE++ +S    L + M+ LYK   +NP AGC P+++QIPVF
Sbjct: 374 RQFRSMAKMRQLQPKVQELRERY-KSDQMALNQNMMALYKAEGVNPAAGCLPMVVQIPVF 432

Query: 441 FAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPG---FMHVGIWPIIM 497
           +++YK + I++EMRHAPF+GWI DL+A D TN+F LFG++P+       ++ +G+WPI+ 
Sbjct: 433 WSLYKDLYITIEMRHAPFFGWIHDLSAPDLTNLFNLFGLIPWDPNVLSPYLQLGVWPILF 492

Query: 498 SLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIM 557
             +MF+Q K++P P D  Q  +   MPV+F F ++  PAGL+IY+ W+N++++ QQ VI 
Sbjct: 493 GATMFLQQKLNPAPTDPAQQRMFQMMPVLFTFFMARQPAGLVIYYCWNNLLTVAQQMVIQ 552

Query: 558 KMHGAEIGLIDRLRSTFSKN 577
           +   + +  +  + +   + 
Sbjct: 553 RRMKSAVDKVGAIPAAAGRK 572


>gi|88607700|ref|YP_505133.1| putative inner membrane protein translocase component YidC
           [Anaplasma phagocytophilum HZ]
 gi|88598763|gb|ABD44233.1| inner membrane protein, 60 kDa [Anaplasma phagocytophilum HZ]
          Length = 568

 Score =  372 bits (953), Expect = e-100,   Method: Composition-based stats.
 Identities = 188/579 (32%), Positives = 310/579 (53%), Gaps = 22/579 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M    N  +A+  SV I+  W+  Y      +   E       +  + +      V    
Sbjct: 1   MSEVRNLILAVVASVAIMLGWKYIYGEFFAVKTVPEG----VQESESLIPEVDDIVDYAS 56

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
            + AL   PRVELKN  L  S++L+GA  DD +L  Y + +  NS  V L+SP  T +  
Sbjct: 57  YSDALKQVPRVELKNSKLAASVSLRGALIDDASLVKYRVSLDKNSENVLLMSPEGTVSDS 116

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF 180
             E  +V   + +++P  +TVW L  G   +      + + N   ++F    S+D+ Y+ 
Sbjct: 117 MVEFGWVDPKHVLKVPGRDTVWALEDG---SDEQNFTIRWDNGEGLIFRLKFSVDQDYML 173

Query: 181 KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS 240
            +   V NN+   +  +  GRI R   +++ + +   EG I   G   L E  Y ++E++
Sbjct: 174 TVAQEVINNTDVNVHLAHYGRINRAHSKSSKSFWISHEGAIGSFGHG-LKEWTYKNLEEA 232

Query: 241 S------ISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLS---DGHARYQAKFSA 291
                  ++      SW+G +DKYW +  IPS        F+      +G +R+Q  +S 
Sbjct: 233 GSIRLSGVTREDGGRSWIGFADKYWFTALIPSASEQGKLAFRTQRVYREGASRFQVDYSK 292

Query: 292 NEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMS 351
           +  TI     +     LF GAKE   +  Y+  L IP F+  +D+G  YFI KP+F+L+ 
Sbjct: 293 SHGTIGAHDKVEAVTHLFMGAKELELLDQYKDTLNIPMFDKAVDFGMLYFITKPVFLLLQ 352

Query: 352 YFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVL 411
           YF+ L+GNFG+AI++ TV +KL+ FPL+ + YVS   +K +QP++  ++E +K      +
Sbjct: 353 YFHKLLGNFGLAIVMLTVAIKLVAFPLSMRSYVSMFKLKRLQPEVLRIKELYKTDDL-RI 411

Query: 412 QKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPT 471
            K +  L+K H ++PL+G  P+L+QIP+FFA+YKV+ +++EMRHAP +GWI+DL++ D  
Sbjct: 412 SKEIASLFKKHKVSPLSGFLPVLIQIPIFFALYKVLFVTIEMRHAPLFGWIRDLSSQDTA 471

Query: 472 NIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMK-MSPPPADKGQAMILNWMPVVFVFA 530
           N   LFG++P   P    +G+ P+++ L+M +Q K M    A   +  ++ ++P +FVF 
Sbjct: 472 NFLNLFGLIPLEPPF--CIGVLPVVLGLTMVLQQKVMQKDQATPDRYGVMKFLPYIFVFV 529

Query: 531 LSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDR 569
            SSFP+GL++YW  SNVI+I+QQ ++++       L   
Sbjct: 530 FSSFPSGLVLYWICSNVITILQQ-IVIRYFVCRKELGAN 567


>gi|241762238|ref|ZP_04760320.1| 60 kDa inner membrane insertion protein [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241373285|gb|EER62904.1| 60 kDa inner membrane insertion protein [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 579

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 174/585 (29%), Positives = 297/585 (50%), Gaps = 11/585 (1%)

Query: 1   MER---NWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           M+      N  +   LS +I++ W  F     +       +  +   +            
Sbjct: 1   MDDKHQQRNLVIVTILSALILFGWS-FVTKHWLSTPPAPTQQGKNQLKAELTAEESGDKP 59

Query: 58  IDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTK 117
           +    Q L  +PR+ +   S+ GS+NLKG + DDL L  +   ++ NSP V L SP+ T+
Sbjct: 60  LKPVDQVLQETPRLPILTESVEGSVNLKGLRLDDLTLIRHRETLAKNSPAVRLFSPAGTE 119

Query: 118 NAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEH 177
           NA+F    +  T  N+ LPN++++W   S K+     P+   + N    +F  T+S+D  
Sbjct: 120 NAWFTSFGW--TGENVALPNADSLWKADSDKLTADH-PVNFYWNNQQGQIFRITLSVDHD 176

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           Y+F   ++V N     +   P             +++ +  G I V          ++DI
Sbjct: 177 YMFNATESVINRGNSPVIVQPYVLTNHQGVFKTASSWTLHTGPIGVFNGSVNYHVDFADI 236

Query: 238 EKSSISNFHESN--SWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
           +K++ ++   +    W+G SDKYW +   P           + S  +  YQA F+   + 
Sbjct: 237 DKATNNSIRNNTQGGWIGFSDKYWLTALAP-HNQKIAIDTDFRSSSNHHYQADFTVAPVV 295

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           +  GK+ +T+  +FAGAKE   +  Y   L +P F+  IDWGWF  I K  F  + + + 
Sbjct: 296 VAAGKTASTSVDVFAGAKEVRVLDRYRDQLHLPHFDKAIDWGWFAIIEKVFFYYLDWLFL 355

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
            VGN+G+AI+L    ++ L FP+A KQY S A+M+ +QPK+  +RE++K      +++ +
Sbjct: 356 HVGNYGLAIILMVFTIRALIFPIANKQYASMASMRRLQPKMQAVRERYKNDEA-RMRQEL 414

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           + LY+   +NP AGC P+ +Q P+F A+YK + +++E RH PF  WIKDL+A DP   F 
Sbjct: 415 VTLYQKEKVNPFAGCLPMFIQFPIFIALYKTLLVTIESRHQPFILWIKDLSAPDPLTPFN 474

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFP 535
           LFG+L F  P F+ +G+ PII+ ++M++Q + SP   +  Q  I++++P++ V  ++   
Sbjct: 475 LFGLLHFTPPHFLMIGVLPIILGITMWLQFRASPQQLEPAQQQIMSFLPLISVIFMAPLA 534

Query: 536 AGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNS 580
           AGL +Y+ ++N+IS+ Q   +   H       DR          +
Sbjct: 535 AGLQVYYIFNNLISLAQMMWLQHRHSTPEERQDRAERKRLSKKKA 579


>gi|5932359|gb|AAD56912.1|AF180145_4 60KD inner-membrane protein yidC [Zymomonas mobilis subsp. mobilis
           ZM4]
          Length = 579

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 172/585 (29%), Positives = 295/585 (50%), Gaps = 11/585 (1%)

Query: 1   MER---NWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           M+      N  +   LS +I++ W  F     +       +  +   +            
Sbjct: 1   MDDKHQQRNLVIVTILSALILFGWS-FVTKHWLSTPPAPTQQGKNQPKAELTAEESGDKP 59

Query: 58  IDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTK 117
           +    Q L  +PR+ +   S+ GS+NLKG + DDL L  +   ++ NSP V L SP+ T+
Sbjct: 60  LKPVDQVLQETPRLPILTESVEGSVNLKGLRLDDLTLIRHRETLAKNSPAVRLFSPAGTE 119

Query: 118 NAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEH 177
           NA+F    +  T  N+ LPN++++W   S K+     P+   + N    +   T+ +D  
Sbjct: 120 NAWFTSFGW--TGENVALPNADSLWKADSDKLTADH-PVNFYWNNQQGQILRITLCVDHD 176

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           Y+F   ++V N     +   P             +++ +  G I V          ++DI
Sbjct: 177 YMFNATESVINRGNSPVIVQPYVLTNHQGVFKTASSWTLHTGPIGVFNGSVNYHVDFADI 236

Query: 238 EKSSISNFHESN--SWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
           +K++ ++   +    W+G SDKYW +   P           + S  +  YQA F+   + 
Sbjct: 237 DKATNNSIRNNTQGGWIGFSDKYWLTALAP-HNQKIAIDTDFRSSSNHHYQADFTVAPVV 295

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           +  GK+ +T+  +FAGAKE   +  Y   L +P F+  IDWGWF  I K  F  + + + 
Sbjct: 296 VAAGKTASTSVDVFAGAKEVRVLDRYRDQLHLPHFDKAIDWGWFAIIEKVFFYYLDWLFL 355

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
            VGN+G+AI+L    ++ L FP+A KQY S A+M+ +QPK+  +RE++K      +++ +
Sbjct: 356 HVGNYGLAIILMVFTIRALIFPIANKQYASMASMRRLQPKMQAVRERYKNDEA-RMRQEL 414

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           + LY+   +NP AGC P+ +Q P+F A+YK + +++E RH PF  WIKDL+A DP   F 
Sbjct: 415 VTLYQKEKVNPFAGCLPMFIQFPIFIALYKTLLVTIESRHQPFILWIKDLSAPDPLTPFN 474

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFP 535
           LFG+L F  P F+ +G+ PII+ ++M++Q + SP   +  Q  I++++P++ V  ++   
Sbjct: 475 LFGLLHFTPPHFLMIGVLPIILGITMWLQFRASPQQLEPAQQQIMSFLPLISVIFMAPLA 534

Query: 536 AGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNS 580
           AGL +Y+ ++N+IS+ Q   +   H       DR          +
Sbjct: 535 AGLQVYYIFNNLISLAQMMWLQHRHSTPEERQDRAERKRPSKKKA 579


>gi|260753817|ref|YP_003226710.1| inner membrane protein translocase component YidC [Zymomonas
           mobilis subsp. mobilis NCIMB 11163]
 gi|258553180|gb|ACV76126.1| 60 kDa inner membrane insertion protein [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 579

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 175/585 (29%), Positives = 297/585 (50%), Gaps = 11/585 (1%)

Query: 1   MER---NWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           M+      N  +   LS +I++ W  F     +       +  +   +            
Sbjct: 1   MDDKHQQRNLVIVTILSALILFGWS-FVTKHWLSTPPAPTQQGKNQPKAELTAEESGDKP 59

Query: 58  IDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTK 117
           +    Q L  +PR+ +   S+ GS+NLKG + DDL L  +   ++ NSP V L SP+ T+
Sbjct: 60  LKPVDQVLQETPRLPILTESVEGSVNLKGLRLDDLTLIRHRETLAKNSPAVRLFSPAGTE 119

Query: 118 NAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEH 177
           NA+F    +  T  N+ LPN++++W   S K+     P+   + N    +F  T+S+D  
Sbjct: 120 NAWFTSFGW--TGENVALPNADSLWKADSDKLTAEH-PVNFYWNNQQGQIFRITLSVDHD 176

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           Y+F   ++V N     +   P             +++ +  G I V          ++DI
Sbjct: 177 YMFNATESVINRGNSPVIVQPYVLTNHQGVFKTASSWTLHTGPIGVFNGSVNYHVDFADI 236

Query: 238 EKSSISNFHESN--SWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
           +K++ ++   S    W+G SDKYW +   P           + S  +  YQA F+   + 
Sbjct: 237 DKATNNSIRNSTQGGWIGFSDKYWLTALAP-HNQKIAIDTDFRSSSNHHYQADFTVAPVM 295

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           +  GK+ +T+  +FAGAKE   +  Y   L +P F+  IDWGWF  I K  F  + + + 
Sbjct: 296 VAAGKTASTSVDVFAGAKEVRVLDRYRDQLHLPHFDKAIDWGWFAIIEKVFFYYLDWLFL 355

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
            VGN+G+AI+L    ++ L FP+A KQY S A+M+ +QPK+  +RE++K      +++ +
Sbjct: 356 HVGNYGLAIILMVFTIRALIFPIANKQYASMASMRRLQPKMQAVRERYKNDEA-RMRQEL 414

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           + LY+   +NP AGC P+ +Q P+F A+YK + +++E RH PF  WIKDL+A DP   F 
Sbjct: 415 VTLYQKEKVNPFAGCLPMFIQFPIFIALYKTLLVTIESRHQPFILWIKDLSAPDPLTPFN 474

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFP 535
           LFG+L F  P F+ +G+ PII+ ++M++Q + SP   +  Q  I++++P++ V  ++   
Sbjct: 475 LFGLLHFTPPHFLMIGVLPIILGITMWLQFRASPQQLEPAQQQIMSFLPLISVIFMAPLA 534

Query: 536 AGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNS 580
           AGL +Y+ ++N+IS+ Q   +   H       DR          +
Sbjct: 535 AGLQVYYIFNNLISLAQMMWLQHRHSTPEERQDRAERKRLSKKKA 579


>gi|330993393|ref|ZP_08317328.1| Inner membrane protein oxaA [Gluconacetobacter sp. SXCC-1]
 gi|329759423|gb|EGG75932.1| Inner membrane protein oxaA [Gluconacetobacter sp. SXCC-1]
          Length = 578

 Score =  370 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 187/568 (32%), Positives = 304/568 (53%), Gaps = 23/568 (4%)

Query: 9   VAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQALSMS 68
           VA ALS +++  ++ F             K ++      +   +   V     + +    
Sbjct: 2   VATALSAVVLVGFEYFLP-------QQNHKTVEQQAPAPEAPPASTPVTAAAPSASDQPD 54

Query: 69  PRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVS 128
           PRV +    + GS++L+GA+ DDL L+ YH  V + SP+V +L P   +     E+ + +
Sbjct: 55  PRVAIDADRVHGSLDLRGARLDDLVLKNYHETVQNGSPLVRVLEPRGQEQPNLVEVGWAN 114

Query: 129 TANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTN 188
            +                   LT   P+ L + N    +F  T+++D++Y+F +   VTN
Sbjct: 115 VSGGHVAVPDANTLWTADHDSLTQARPVTLSWDNGQGQVFSITVAIDQNYMFSVTQKVTN 174

Query: 189 NSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHE- 247
           +  + +   P  R+ R      T  + V EG I+V+    L E  Y  + K ++   +  
Sbjct: 175 HGGEPVSLYPFSRVERGYTPVETGGYLVHEGPISVIDH-RLDESSYKSLRKGAVPPGNIA 233

Query: 248 -----SNSWLGISDKYWASVFIPSKETSFHSQFKYL---SDGHARYQAKFSANEIT-ILP 298
                   W GI+DKYW +  IP +++     + Y    +     Y   F+A     +  
Sbjct: 234 WTKAGQGGWAGITDKYWLAAVIPQQDSDVAGTYAYQGAGNGDKGTYDVGFTARAPLVVAA 293

Query: 299 GKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVG 358
           G   +T + +FAGAKE P +  YE  L IP F   +D+GWF F+ +P+F ++ +   ++G
Sbjct: 294 GGEASTASHVFAGAKEVPLLEKYESSLHIPDFWKAVDFGWFAFLTRPIFTVLDWLNTMLG 353

Query: 359 NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQL 418
           NFG+A+M  T+ VK LFFPLA KQ+ S   M+ +QPKI  LRE++K      L + MI L
Sbjct: 354 NFGLALMAFTLLVKALFFPLATKQFHSMGKMRQLQPKIKALRERYKD-DQMALNQQMIGL 412

Query: 419 YKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFG 478
           YK   +NP +GC P+LLQIPVF+ +YK + +++EMRHAPF+GWI DL+A DPTN+FTLFG
Sbjct: 413 YKQEGVNPASGCLPMLLQIPVFWCLYKDLYVTIEMRHAPFFGWIHDLSAFDPTNLFTLFG 472

Query: 479 ILPFYLPGF---MHVGIWPIIMSLSMFIQMKMSPPPA-DKGQAMILNWMPVVFVFALSSF 534
           ++P+        + +G+WPI   L+MF QM+++P P  D  Q  +  +MP++F F ++  
Sbjct: 473 LIPWNPSVISPMLQLGLWPIAFGLTMFAQMRLNPTPTADPAQQKMFQFMPIIFTFFMARQ 532

Query: 535 PAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           P+GL+IY+ W+N++++ QQ +I +    
Sbjct: 533 PSGLVIYYCWNNLLTMAQQTLIQRRMNK 560


>gi|226947217|ref|YP_002802290.1| putative inner membrane protein translocase component YidC
           [Azotobacter vinelandii DJ]
 gi|259515637|sp|C1DNF7|OXAA_AZOVD RecName: Full=Inner membrane protein oxaA
 gi|226722144|gb|ACO81315.1| inner membrane protein, translocase subunit YidC [Azotobacter
           vinelandii DJ]
          Length = 557

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 141/578 (24%), Positives = 246/578 (42%), Gaps = 50/578 (8%)

Query: 1   MERNWNYFVAIAL---SVIIVYAWQNFYVYPRIEEMNNERKNIQTV---------KQPNQ 48
           M+      + +AL   S ++V  W   Y    +   N   ++                  
Sbjct: 1   MDI-KRSILLVALAVVSYLLVLQWNQDYGQAALPPQNAVAQSASPALPETVPGDSSTSAD 59

Query: 49  VDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIV 108
           V  + +   + D A + + S  ++++   L  +I+ +G     L L  +           
Sbjct: 60  VPTAGSGNQVPDSAASTAGSDLIQVRTDVLEVAIDPRGGDIVQLKLPKFPRRQDHPEIPF 119

Query: 109 TLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNAN 164
            L   + ++  Y A+     T       +   ++              +  + L F +  
Sbjct: 120 QLF-DNGSERLYLAQSGLTGTNGPDARADGRPLYVSEQRSYQLADGQDSLVVDLKFSDGG 178

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT----ATNTFGVQEGF 220
               +R       Y  ++   + N+S      +   ++ R                  G 
Sbjct: 179 VDYVKRFTFKRGAYDLEVRHQIANHSEQPWSGNLFAQLKRDASADPSSTTATGTATYLGA 238

Query: 221 IAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
                ++   +    D++  ++        W+     Y+ + ++P+K+ +     +   D
Sbjct: 239 ALWTSEEPYRKVSMGDMDDKNLRET-VQGGWVAWLQHYFVTAWVPNKDDTNLVATR--KD 295

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
               Y   F+ + + I  G +  T   L+AG K+   +         P  E+ +D+G+ +
Sbjct: 296 SQGNYIIGFTGSTLNIPAGATGETVTRLYAGPKDQNQLEALS-----PGLELTVDYGFLW 350

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           FIA+P+F L+   + L+GN+G +I++ TV +KL FFPL+   Y S   M+ + PK+  L+
Sbjct: 351 FIAQPIFWLLELIHALLGNWGWSIIVLTVIIKLAFFPLSAASYRSMGRMRAVAPKLQALK 410

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E+      Q L +AM++LYK   INPL GC PIL+Q+PVF A+Y V+  S+EMR AP+ G
Sbjct: 411 EQH-GEDRQKLSQAMMELYKKEKINPLGGCLPILVQMPVFLALYWVLLESVEMRQAPWLG 469

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMIL 520
           WI DL+  DP                     I PIIM  +MF Q  ++P P D  QA ++
Sbjct: 470 WITDLSVKDPYF-------------------ILPIIMGATMFFQQTLNPTPPDPMQARVM 510

Query: 521 NWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
             MP++F F    FPAGL++YW  +NV+SI QQ  I +
Sbjct: 511 KLMPIIFTFFFLWFPAGLVLYWVVNNVLSIGQQWYITR 548


>gi|92115431|ref|YP_575359.1| putative inner membrane protein translocase component YidC
           [Chromohalobacter salexigens DSM 3043]
 gi|91798521|gb|ABE60660.1| protein translocase subunit yidC [Chromohalobacter salexigens DSM
           3043]
          Length = 575

 Score =  368 bits (945), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 146/582 (25%), Positives = 247/582 (42%), Gaps = 50/582 (8%)

Query: 2   ERNWNYFVAI---ALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
                  + I    L+ ++V  W   Y    +E          T    +  +   A    
Sbjct: 13  MDVKRLLLVIPLAVLAYLLVIQWNADYGQNNVEHSAPTSVAQGTTDSDDASEGLSAPSAS 72

Query: 59  DDRAQALSMSP-------------RVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNS 105
           +    A   S               ++++   L   I+ +G       L  +   + S+ 
Sbjct: 73  NAGNNASPDSAGMPGEKSQTDANGLIQVRTDVLDLRIDPRGGDVVYAALPKHKASLDSDQ 132

Query: 106 PIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANN 165
           P V L    N   +Y A+       +   +  +        G+    +  + L  +    
Sbjct: 133 PFVLL--SDNNVRSYVAKSGLQLEGHEGRITYTPEQTEYTLGE-DQDSLTVDLKAEVNGV 189

Query: 166 ILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT----ATNTFGVQEGFI 221
            + +R +     Y   +   + N S   +     G++ R          +       G  
Sbjct: 190 NVIKRFVFDRNAYAVHVEYRLDNESQTPVSARFIGQLARDDSDDPSQGVSMGMKSFLGAT 249

Query: 222 AVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDG 281
               + +  +  + DI     +N      W+ +   Y+ S ++P +       +    D 
Sbjct: 250 FSTQESNYEKISFEDIRDGEFNNVESEGGWVAMIQHYFTSAWVPEQNQEN--LYYANIDS 307

Query: 282 HARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYF 341
             R  A F+     I PG++      L+ G K    +         P  E+ +D+GW +F
Sbjct: 308 RDRNVAAFAGPSQQIAPGETTRMAATLYMGPKIQDRLEAIA-----PHLELTVDFGWLWF 362

Query: 342 IAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELRE 401
           IA P+F L++  ++L+GN+G +I+L TV VK++ FPL+ K Y S A M+ + P++  ++E
Sbjct: 363 IANPLFWLLAKIHSLIGNWGWSIVLLTVIVKIVLFPLSAKAYKSMAKMRKMGPEMKRIKE 422

Query: 402 KFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGW 461
           ++     Q + + M++ Y+   INPL GC PI++Q+PVF A+Y ++  S+E+RHAPF  W
Sbjct: 423 QYGD-DRQKMSQEMMKFYQKEKINPLGGCLPIVVQMPVFIALYWMLLESVELRHAPFILW 481

Query: 462 IKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILN 521
           I DL+A DP                     I PIIM  SMF+Q  ++P P D  QA I+ 
Sbjct: 482 INDLSAQDPYF-------------------ILPIIMGASMFVQQLLNPTPPDPMQAKIMK 522

Query: 522 WMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
            +PVVF F    FPAGL+IYW  +NVISI+QQ +I +   A+
Sbjct: 523 MLPVVFTFFFLWFPAGLVIYWICNNVISILQQWIITRKIEAD 564


>gi|301064543|ref|ZP_07204939.1| putative membrane protein [delta proteobacterium NaphS2]
 gi|300441291|gb|EFK05660.1| putative membrane protein [delta proteobacterium NaphS2]
          Length = 551

 Score =  367 bits (941), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 143/566 (25%), Positives = 253/566 (44%), Gaps = 24/566 (4%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNE------RKNIQTVKQPNQVDNSYA 54
           M+      +A ALS +I+  W  F+     +E   E      +   +             
Sbjct: 1   MD--KKTILAFALSFVILVGWSLFFAPQPKKEPPKESSPESVQPEHEKSSVTISPAAPSK 58

Query: 55  AVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPS 114
            +   ++        R+++  P      +  G       L+ Y   V+  SP V +++  
Sbjct: 59  TIAAVEQPTVQQEEKRIKIDTPLYSAVFSNVGPTIKSFKLKKYRQTVNPESPFVEMVTLE 118

Query: 115 NTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISL 174
                Y   L   S   + +    +     ++ +  +    I     N N I   +T   
Sbjct: 119 EGMGDYLTILFDDSIDASTQNIAFSADKESLTLQQGSEPATIVFRGTNRNGIAITQTYRF 178

Query: 175 DEHYL-FKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQK 233
                   +  T  N +   +    R  +    P+     +      + +      +E +
Sbjct: 179 HPDRYGIDLAVTAVNPNTVTVNGVFRTTLRALPPKDKGGYYAYVGFALFLDDKLDELEVE 238

Query: 234 YSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANE 293
                     +   +  W+   D Y+ S  +P          K+LS G       +    
Sbjct: 239 D----PGETKSATGTIGWICYEDNYFISAVVPEVPAKGSFTGKHLSSGVFEGV--YLPAA 292

Query: 294 ITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYF 353
           +++ P    T+   L+ G ++   +  + K+      +  I++GW   IAKP+  ++ +F
Sbjct: 293 VSLPPSAQATSEYELYLGPRDLSILKKFGKN-----LDKAINFGWTDIIAKPLLYVLKFF 347

Query: 354 YNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQK 413
              + N+G++I+L T+ VK+LF+PL  K Y S   M+ +QP++ +LREK+K    Q L +
Sbjct: 348 DAYLHNYGVSIILLTILVKILFWPLTHKSYKSMKEMQKLQPRMAKLREKYKGDK-QKLNQ 406

Query: 414 AMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNI 473
            M+ LYKT+ +NP+ GC P+++QIPVFFA+++V+   +E+RHAPF  WI DL+A D    
Sbjct: 407 EMMALYKTYKVNPMGGCLPMVVQIPVFFALFRVLGACIELRHAPFIFWINDLSAPDRLFH 466

Query: 474 FTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSS 533
           F+    +PF  P +  + +  ++M  SMFIQ KM+P P D  QA I+ ++PV+F F   +
Sbjct: 467 FS--FQIPFMAPPY-GIPVLTLLMGASMFIQQKMTPSPGDPAQAKIMMFLPVIFTFMFIN 523

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMKM 559
           FP+GL++YW  +N++SI QQ  I K 
Sbjct: 524 FPSGLVLYWLVNNLLSIGQQYRIYKK 549


>gi|26986751|ref|NP_742176.1| putative inner membrane protein translocase component YidC
           [Pseudomonas putida KT2440]
 gi|60392875|sp|P0A140|OXAA_PSEPK RecName: Full=Inner membrane protein oxaA
 gi|60392876|sp|P0A141|OXAA_PSEPU RecName: Full=Inner membrane protein oxaA
 gi|24981341|gb|AAN65640.1|AE016190_6 inner membrane protein, 60 kDa [Pseudomonas putida KT2440]
 gi|45709|emb|CAA44417.1| unnamed protein product [Pseudomonas putida]
 gi|313496415|gb|ADR57781.1| OxaA [Pseudomonas putida BIRD-1]
          Length = 560

 Score =  364 bits (934), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 147/582 (25%), Positives = 247/582 (42%), Gaps = 49/582 (8%)

Query: 1   MERNWNYFVAI--ALSVIIVYAWQNFYVYPRIEEMNNERKNIQ----------TVKQPNQ 48
           M+      +A    +S ++V  W + Y    +   N     +                  
Sbjct: 1   MDIKRTILIAALAVVSYVMVLKWNDDYGQAALPTQNTAASTVAPGLPDGVPAGNNGASAD 60

Query: 49  VDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIV 108
           V ++ A     + A        + +K   L  +I+  G     LNL  Y       +   
Sbjct: 61  VPSANAESSPAELAPVALSKDLIRVKTDVLELAIDPVGGDIVQLNLPKYPRRQDHPNIPF 120

Query: 109 TLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKL----VFKNAN 164
            L   +  +  Y A+     T       +   ++              +L     F +  
Sbjct: 121 QLF-DNGGERVYLAQSGLTGTDGPDARASGRPLYAAEQKSYQLADGQEQLVVDLKFSDNG 179

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGV----QEGF 220
               +R       Y   +   + N S      +   ++ R      +++         G 
Sbjct: 180 VNYIKRFSFKRGEYDLNVSYLIDNQSGQAWNGNMFAQLKRDASGDPSSSTATGTATYLGA 239

Query: 221 IAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
                 +   +    DI+K S+     S  W+     Y+ + +IP+K  +   Q +   D
Sbjct: 240 ALWTASEPYKKVSMKDIDKGSLKEN-VSGGWVAWLQHYFVTAWIPAKSDNNVVQTR--KD 296

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
               Y   ++   I++  G  + T+  L+AG K    +         P  E+ +D+G+ +
Sbjct: 297 SQGNYIIGYTGPVISVPAGGKVETSALLYAGPKIQSKLKELS-----PGLELTVDYGFLW 351

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           FIA+P+F L+ + ++L+GN+G +I++ T+ +K LFFPL+   Y S A M+ + PK+  L+
Sbjct: 352 FIAQPIFWLLQHIHSLLGNWGWSIIVLTMLIKGLFFPLSAASYRSMARMRAVAPKLAALK 411

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E+F     Q + +AM++LYK   INPL GC PIL+Q+PVF A+Y V+  S+EMR AP+  
Sbjct: 412 ERFGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLALYWVLLESVEMRQAPWIL 470

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMIL 520
           WI DL+  DP                     I PIIM  +MFIQ +++P P D  QA ++
Sbjct: 471 WITDLSIKDPFF-------------------ILPIIMGATMFIQQRLNPTPPDPMQAKVM 511

Query: 521 NWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
             MP++F F    FPAGL++YW  +N +SI QQ  I +   A
Sbjct: 512 KMMPIIFTFFFLWFPAGLVLYWVVNNCLSISQQWYITRRIEA 553


>gi|148550509|ref|YP_001270611.1| putative inner membrane protein translocase component YidC
           [Pseudomonas putida F1]
 gi|166977400|sp|A5WBB7|OXAA_PSEP1 RecName: Full=Inner membrane protein oxaA
 gi|148514567|gb|ABQ81427.1| protein translocase subunit yidC [Pseudomonas putida F1]
          Length = 560

 Score =  364 bits (934), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 147/582 (25%), Positives = 247/582 (42%), Gaps = 49/582 (8%)

Query: 1   MERNWNYFVAI--ALSVIIVYAWQNFYVYPRIEEMNNERKNIQ----------TVKQPNQ 48
           M+      +A    +S ++V  W + Y    +   N     +                  
Sbjct: 1   MDIKRTILIAALAVVSYVMVLKWNDDYGQAALPTQNTAASTVAPGLPDGVPAGNNGASAD 60

Query: 49  VDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIV 108
           V ++ A     + A        + +K   L  +I+  G     LNL  Y       +   
Sbjct: 61  VPSANAESSPAELAPVALSKDLIRVKTDVLELAIDPVGGDIVQLNLPKYPRRQDHPNIPF 120

Query: 109 TLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKL----VFKNAN 164
            L   +  +  Y A+     T       +   ++              +L     F +  
Sbjct: 121 QLF-DNGGERVYLAQSGLTGTDGPDARASGRPLYAAEQKSYQLADGQEQLVVDLKFSDNG 179

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGV----QEGF 220
               +R       Y   +   + N S      +   ++ R      +++         G 
Sbjct: 180 VNYIKRFSFKRGEYDLNVSYLIDNQSGQAWSGNMFAQLKRDASGDPSSSTATGTATYLGA 239

Query: 221 IAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
                 +   +    DI+K S+     S  W+     Y+ + +IP+K  +   Q +   D
Sbjct: 240 ALWTASEPYKKVSMKDIDKGSLKEN-VSGGWVAWLQHYFVTAWIPAKSDNNVVQTR--KD 296

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
               Y   ++   I++  G  + T+  L+AG K    +         P  E+ +D+G+ +
Sbjct: 297 SQGNYIIGYTGPVISVPAGGKVETSALLYAGPKIQSKLKELS-----PGLELTVDYGFLW 351

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           FIA+P+F L+ + ++L+GN+G +I++ T+ +K LFFPL+   Y S A M+ + PK+  L+
Sbjct: 352 FIAQPIFWLLQHIHSLLGNWGWSIIVLTMLIKGLFFPLSAASYRSMARMRAVAPKLAALK 411

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E+F     Q + +AM++LYK   INPL GC PIL+Q+PVF A+Y V+  S+EMR AP+  
Sbjct: 412 ERFGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLALYWVLLESVEMRQAPWIL 470

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMIL 520
           WI DL+  DP                     I PIIM  +MFIQ +++P P D  QA ++
Sbjct: 471 WITDLSIKDPFF-------------------ILPIIMGATMFIQQRLNPTPPDPMQAKVM 511

Query: 521 NWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
             MP++F F    FPAGL++YW  +N +SI QQ  I +   A
Sbjct: 512 KMMPIIFTFFFLWFPAGLVLYWVVNNCLSISQQWYITRRIEA 553


>gi|167036430|ref|YP_001671661.1| putative inner membrane protein translocase component YidC
           [Pseudomonas putida GB-1]
 gi|189036357|sp|B0KRC1|OXAA_PSEPG RecName: Full=Inner membrane protein oxaA
 gi|166862918|gb|ABZ01326.1| 60 kDa inner membrane insertion protein [Pseudomonas putida GB-1]
          Length = 560

 Score =  363 bits (931), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 145/582 (24%), Positives = 244/582 (41%), Gaps = 49/582 (8%)

Query: 1   MERNWNYFVAI--ALSVIIVYAWQNFYVYPRIEEMNNERKNIQ----------TVKQPNQ 48
           M+      +A    +S ++V  W + Y    +   N     +                  
Sbjct: 1   MDIKRTILIAALAVVSYVMVLKWNDDYGQAALPTQNTAASTVAPGLPDGVPAGNNGASAD 60

Query: 49  VDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIV 108
           V ++ A     + A        + +K   L  +I+  G     LNL  Y           
Sbjct: 61  VPSANAESSPAELAPVALSKDLIRVKTDVLELAIDPVGGDIVQLNLPKYPRRQDHPDIPF 120

Query: 109 TLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKL----VFKNAN 164
            L   +  +  Y A+             +   ++              +L     F +  
Sbjct: 121 QLF-DNGGERVYLAQSGLTGANGPDARASGRPLYAAEQKSYQLADGQEQLVVDLKFSDNG 179

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGV----QEGF 220
               +R       Y   +   + N S      +   ++ R      +++         G 
Sbjct: 180 VNYIKRFSFKRGEYDLNVSYLIDNQSGQAWSGNMFAQLKRDASGDPSSSTATGTATYLGA 239

Query: 221 IAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
                 +   +    DI+K  +     S  W+     Y+ + +IP+K  +   Q +   D
Sbjct: 240 ALWTASEPYKKVSMKDIDKGGLKEN-VSGGWVAWLQHYFVTAWIPAKSDNNVVQTR--KD 296

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
               Y   ++   I++  G  + T+  L+AG K    +         P  E+ +D+G+ +
Sbjct: 297 SQGNYIIGYTGPVISVPAGGKVETSAMLYAGPKIQSKLKELS-----PGLELTVDYGFLW 351

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           FIA+P+F L+ + ++L+GN+G +I++ T+ +K LFFPL+   Y S A M+ + PK+  L+
Sbjct: 352 FIAQPIFWLLQHIHSLLGNWGWSIIVLTMLIKGLFFPLSAASYRSMARMRAVAPKLAALK 411

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E+F     Q + +AM++LYK   INPL GC PIL+Q+PVF A+Y V+  S+EMR AP+  
Sbjct: 412 ERFGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLALYWVLLESVEMRQAPWML 470

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMIL 520
           WI DL+  DP                     I PIIM  +MFIQ +++P P D  QA ++
Sbjct: 471 WITDLSIKDPFF-------------------ILPIIMGATMFIQQRLNPTPPDPMQAKVM 511

Query: 521 NWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
             MP++F F    FPAGL++YW  +N +SI QQ  I +   A
Sbjct: 512 KMMPIIFTFFFLWFPAGLVLYWVVNNCLSISQQWYITRRIEA 553


>gi|152983547|ref|YP_001351680.1| putative inner membrane protein translocase component YidC
           [Pseudomonas aeruginosa PA7]
 gi|166975880|sp|A6VF45|OXAA_PSEA7 RecName: Full=Inner membrane protein oxaA
 gi|150958705|gb|ABR80730.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 578

 Score =  363 bits (931), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 142/602 (23%), Positives = 242/602 (40%), Gaps = 69/602 (11%)

Query: 1   MERNWNYFV--AIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           M+   +  +     +S ++V  W   Y  P +   +      Q +        + + V  
Sbjct: 1   MDIQRSILIVALAVVSYLLVLQWNKDYGQPELPAASASMNTTQGLPDTPSAAGTSSDVPT 60

Query: 59  DDRAQALSMS---------PRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVT 109
                A S +           +++K   L  +I+ +G     L L  Y   +        
Sbjct: 61  AQSGAAGSEAADKPVAVSDKLIQVKTDVLDLAIDPRGGDIVQLGLLQYPRRLDRPDVPFP 120

Query: 110 LLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKL----VFKNANN 165
           L   +  +  Y A+                 +++   G         +L     F     
Sbjct: 121 LF-DNGRERTYLAQSGLTGADGPDASSAGRPLFHSAQGSYQLADGQNELVVDLSFSRDGV 179

Query: 166 ILFERTIS---------------------LDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR 204
              +R                         +  Y   +   + N S      +   ++ R
Sbjct: 180 NYIKRFTFHRGLKADCSDKEKAQKKIECINENAYQVGVSYLIDNQSGKTWSGNLFAQLKR 239

Query: 205 HKPQTATNT----FGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWA 260
                 ++T         G      D    +    D++K           W+     Y+ 
Sbjct: 240 DGSADPSSTTATGVSTYLGAAVWTPDSPYKKISTKDMDKEQFKE-SVQGGWVAWLQHYFV 298

Query: 261 SVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHH 320
           + ++P+K        +   DG   Y   F+   +++  G  + T   L+AG K    +  
Sbjct: 299 TAWVPTKGEQHQVMTR--KDGQGNYIVGFTGPTLSVPAGGKVETDLTLYAGPKLQKHLKE 356

Query: 321 YEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAK 380
                  P  E+ +D+G+ +FIA+P+F L+ + ++L+GN+G +I+  TV +KL FFPL+ 
Sbjct: 357 LS-----PGLELTVDYGFLWFIAQPIFWLLQHIHSLIGNWGWSIIALTVLIKLAFFPLSA 411

Query: 381 KQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVF 440
             Y S A M+ + PK+  ++E+      Q + +AM++LYK   INPL GC PIL+Q+PVF
Sbjct: 412 ASYRSMARMRAVSPKMQAIKEQHGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVF 470

Query: 441 FAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLS 500
            ++Y V+  S+EMR AP+ GWI DL+  DP                     I PI+M  +
Sbjct: 471 LSLYWVLLESVEMRQAPWLGWITDLSVKDPFF-------------------ILPIVMGGT 511

Query: 501 MFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMH 560
           M IQ  ++P P D  QA ++  MP++F F    FPAGL++YW  +NV+SI QQ  I +  
Sbjct: 512 MLIQQMLNPTPPDPMQAKVMKLMPIIFTFFFLWFPAGLVLYWVVNNVLSIAQQWYITRKI 571

Query: 561 GA 562
            A
Sbjct: 572 EA 573


>gi|170724369|ref|YP_001752057.1| putative inner membrane protein translocase component YidC
           [Pseudomonas putida W619]
 gi|254773014|sp|B1JFV4|OXAA_PSEPW RecName: Full=Inner membrane protein oxaA
 gi|169762372|gb|ACA75688.1| 60 kDa inner membrane insertion protein [Pseudomonas putida W619]
          Length = 560

 Score =  362 bits (928), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 146/582 (25%), Positives = 242/582 (41%), Gaps = 49/582 (8%)

Query: 1   MERNWNYFVAI--ALSVIIVYAWQNFYVYPRIEEMNNERKN----------IQTVKQPNQ 48
           M+      +A    +S ++V  W + Y    +   N                        
Sbjct: 1   MDIKRTILIAALAIVSYVMVLKWNDDYGQAALPTQNTAASTVAPGLPDGVPAANNGASAD 60

Query: 49  VDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIV 108
           V ++ A     + A        + +K   L  +I+  G     LNL  Y           
Sbjct: 61  VPSANAESSPAELAPVALSKDLIRVKTDVLELAIDPVGGDIVQLNLPKYPRRQDHPDIPF 120

Query: 109 TLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKL----VFKNAN 164
            L   +  +  Y A+                 ++              +L     F +  
Sbjct: 121 QLF-DNGGERVYLAQSGLTGANGPDARSTGRPLYAAEQKSFQLADGQEQLVVDLKFSDNG 179

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGV----QEGF 220
               +R       Y   +   + N S      +   ++ R      +++         G 
Sbjct: 180 VNYIKRFSFKRGEYDLSVSYLIDNQSGQAWSGNMFAQLKRDASGDPSSSTATGTATYLGA 239

Query: 221 IAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
                 +   +    DI+K S+     S  W+     Y+ + +IP+K  +   Q +   D
Sbjct: 240 ALWTAGEPYKKVSMKDIDKGSLKEN-VSGGWVAWLQHYFVTAWIPAKSDNNVVQTR--KD 296

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
               Y   ++   I++  G    T+  L+AG K    +         P  E+ +D+G+ +
Sbjct: 297 SQGNYIIGYTGPAISVPAGGKAETSAMLYAGPKIQSKLKELS-----PGLELTVDYGFLW 351

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           FIA+P+F L+ + ++L+GN+G +I++ T+ +K LFFPL+   Y S A M+ + PK+  L+
Sbjct: 352 FIAQPIFWLLQHIHSLLGNWGWSIIVLTMLIKGLFFPLSAASYRSMARMRAVAPKLAALK 411

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E+F     Q + +AM++LYK   INPL GC PIL+Q+PVF A+Y V+  S+EMR AP+  
Sbjct: 412 ERFGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLALYWVLLESVEMRQAPWML 470

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMIL 520
           WI DL+  DP                     I PIIM  +MFIQ +++P P D  QA ++
Sbjct: 471 WITDLSIKDPFF-------------------ILPIIMGATMFIQQRLNPTPPDPMQAKVM 511

Query: 521 NWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
             MP++F F    FPAGL++YW  +N +SI QQ  I +   A
Sbjct: 512 KMMPIIFTFFFLWFPAGLVLYWVVNNCLSISQQWYITRRIEA 553


>gi|269958897|ref|YP_003328686.1| inner membrane protein translocase component YidC [Anaplasma
           centrale str. Israel]
 gi|269848728|gb|ACZ49372.1| inner membrane protein translocase component YidC [Anaplasma
           centrale str. Israel]
          Length = 572

 Score =  362 bits (928), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 187/580 (32%), Positives = 308/580 (53%), Gaps = 21/580 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M    N  +A+  SV ++  W+  Y       +  E    + V   + +           
Sbjct: 1   MSEARNLVLAVVASVAVMVGWRFVYDK----VLTKESPQQREVASESLIPEVVDVAEYRP 56

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           RA A++  PRV L N +++ SI+LKGA  DD++L+ Y +    +S  V L+SP  T+   
Sbjct: 57  RADAVNSVPRVGLGNSNVLASISLKGALVDDVSLKKYQVSTDKHSENVVLMSPEGTQEDS 116

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGK--ILTPTTPIKLVFKNANNILFERTISLDEHY 178
             E  ++   +++++P+ +T+W +           +   L + N   ++F    SLD  Y
Sbjct: 117 IVEFGWIDPKHSVKVPDKSTLWEVEQNSAADGDGESHTTLRWDNGQGLVFRLKFSLDRAY 176

Query: 179 LFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIE 238
           +F +   V N++ + +  +  GRI +       + +   EG I   G + L E  Y D++
Sbjct: 177 MFSVSQEVENSTGEDLHLAYYGRINKAHAPDGKSYWISHEGAIGSFG-RGLQEWTYKDLQ 235

Query: 239 KSSISNFHESN----SWLGISDKYWASVFIPSKET-SFHSQFKYLS-DGHARYQAKFSAN 292
           K +             W+G++DKYW +  +PS        + K++  D    +Q  FS +
Sbjct: 236 KENSIRVAAHEVAGSHWIGLADKYWFAALVPSSGGGKLAFRAKHIPRDDVDHFQVDFSRS 295

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
              +  G     T  LF GAKE   +  Y   L IP F+  +D+G  YFI KP+F L+ Y
Sbjct: 296 YGLVPAGGKAEATTQLFIGAKELAVLDDYRSKLNIPLFDKAVDFGILYFITKPVFRLLQY 355

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
           F+ +VGNFG+AI++ T+ +KL+ FPLA K YVS   +K +QP+I  ++E +K      + 
Sbjct: 356 FHKVVGNFGLAIIMLTISIKLVVFPLASKSYVSMFKLKKLQPEISRIKELYKTDDV-RIG 414

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           K +  L++ H ++P++G  PIL+QIPVFFA+YKV+ +++EMRHAP   WI+DL++ D  N
Sbjct: 415 KEISSLFRKHGVSPVSGFLPILVQIPVFFALYKVLFVTIEMRHAPLCAWIQDLSSQDTAN 474

Query: 473 IFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMS---PPPADKGQAMILNWMPVVFVF 529
           +  LFG+L F  P  + +G+ PII+ ++M +Q K++       D     I+ ++P VFVF
Sbjct: 475 LLNLFGLLQFDPP--VCIGVLPIILGVTMVLQQKLNQQDQAAHDPY--GIMKFLPYVFVF 530

Query: 530 ALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDR 569
             SSFPAGL++YW  SNVI+I+QQ  + +       L++ 
Sbjct: 531 IFSSFPAGLVLYWICSNVITILQQLFVRRFIFDRRDLVNN 570


>gi|325275325|ref|ZP_08141278.1| membrane protein insertase [Pseudomonas sp. TJI-51]
 gi|324099573|gb|EGB97466.1| membrane protein insertase [Pseudomonas sp. TJI-51]
          Length = 560

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 143/582 (24%), Positives = 244/582 (41%), Gaps = 49/582 (8%)

Query: 1   MERNWNYFVAI--ALSVIIVYAWQNFYVYPRIEEMNNERKNIQ----------TVKQPNQ 48
           M+      +A    +S ++V  W + Y    +   N     +                  
Sbjct: 1   MDIKRTILIAALAVVSYVMVLKWNDDYGQAALPTQNTAASTVAPGLPDGVPAGNNGASAD 60

Query: 49  VDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIV 108
           V ++ A     + A        + +K   L  +I+  G     LNL  Y           
Sbjct: 61  VPSANADSSPAELAPVALSKDLIRVKTDVLELAIDPVGGDIVQLNLPKYPRRQDHPDIPF 120

Query: 109 TLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKL----VFKNAN 164
            L   +  +  Y A+             +   ++              +L     F +  
Sbjct: 121 QLF-DNGGERVYLAQSGLTGANGPDARASGRPLYAAEQKSYQLADGQQQLVVDLKFSDNG 179

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGV----QEGF 220
               +R       Y   +   + N S      +   ++ R      +++         G 
Sbjct: 180 VNYIKRFSFKRGEYDLNVSYLIDNQSSQPWSGNMFAQLKRDASGDPSSSTATGTATYLGA 239

Query: 221 IAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
                 +   +    D++K ++     S  W+     Y+ + +IP+K  +   Q +   D
Sbjct: 240 ALWTASEPYKKVSMKDMDKGNLKEN-VSGGWVAWLQHYFVTAWIPAKSDNNVVQTR--KD 296

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
               Y   ++   + +  G  + T+  L+AG K    +         P  E+ +D+G+ +
Sbjct: 297 SQGNYIIGYTGPALNVPAGGKVETSAMLYAGPKIQSKLKELS-----PGLELTVDYGFLW 351

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           FIA+P+F L+ + ++L+GN+G +I++ T+ +K LFFPL+   Y S A M+ + PK+  L+
Sbjct: 352 FIAQPIFWLLQHIHSLLGNWGWSIIVLTMLIKGLFFPLSAASYRSMARMRAVAPKLAALK 411

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E+F     Q + +AM++LYK   INPL GC PIL+Q+PVF A+Y V+  S+EMR AP+  
Sbjct: 412 ERFGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLALYWVLLESVEMRQAPWML 470

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMIL 520
           WI DL+  DP                     I PIIM  +MFIQ +++P P D  QA ++
Sbjct: 471 WITDLSIKDPFF-------------------ILPIIMGATMFIQQRLNPTPPDPMQAKVM 511

Query: 521 NWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
             MP++F F    FPAGL++YW  +N +SI QQ  I +   A
Sbjct: 512 KMMPIIFTFFFLWFPAGLVLYWVVNNCLSISQQWYITRRIEA 553


>gi|107104669|ref|ZP_01368587.1| hypothetical protein PaerPA_01005748 [Pseudomonas aeruginosa PACS2]
          Length = 578

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 140/602 (23%), Positives = 242/602 (40%), Gaps = 69/602 (11%)

Query: 1   MERNWNYFV--AIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           M+   +  +     +S ++V  W   Y  P +   +      Q +        + + V  
Sbjct: 1   MDIQRSILIVALAVVSYLLVLQWNKDYGQPELPAASASMNTTQGLPDTPSASGTSSDVPT 60

Query: 59  DDRAQALSMS---------PRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVT 109
              + A S +           +++K   L  +I+ +G     L L  Y   +        
Sbjct: 61  AQSSAAGSEAADKPVAVSGKLIQVKTDVLDLAIDPRGGDIVQLGLLQYPRRLDRPDVPFP 120

Query: 110 LLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKL----VFKNANN 165
           L   +  +  Y A+                 +++             +L     F +   
Sbjct: 121 LF-DNGRERTYLAQSGLTGADGPDASSAGRPLFHSAQSSYQLADGQNELVVDLSFSHDGV 179

Query: 166 ILFERTIS---------------------LDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR 204
              +R                         +  Y   +   + N S      +   ++ R
Sbjct: 180 NYIKRFTFHRGLKADCSDKEKAQKKIECINENAYQVGVSYLIDNQSGKTWSGNLFAQLKR 239

Query: 205 HKPQTATNT----FGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWA 260
                 ++T         G      D    +    D++K           W+     Y+ 
Sbjct: 240 DGSADPSSTTATGVSTYLGAAVWTPDSPYKKISTKDMDKEQFKE-SVQGGWVAWLQHYFV 298

Query: 261 SVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHH 320
           + ++P+K        +   DG   Y   F+   +++  G  + T   L+AG K    +  
Sbjct: 299 TAWVPTKGEQHQVMTR--KDGQGNYIVGFTGPTLSVPAGSKVETDLTLYAGPKLQKHLKE 356

Query: 321 YEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAK 380
                  P  E+ +D+G+ +FIA+P+F L+ + ++L+GN+G +I+  TV +KL FFPL+ 
Sbjct: 357 LS-----PGLELTVDYGFLWFIAQPIFWLLQHIHSLIGNWGWSIIALTVLIKLAFFPLSA 411

Query: 381 KQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVF 440
             Y S A M+ + PK+  ++E+      Q + +AM++LYK   INPL GC PIL+Q+PVF
Sbjct: 412 ASYRSMARMRAVSPKMQAIKEQHGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVF 470

Query: 441 FAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLS 500
            ++Y V+  S+EMR AP+ GWI DL+  DP                     I PI+M  +
Sbjct: 471 LSLYWVLLESVEMRQAPWLGWITDLSVKDPFF-------------------ILPIVMGGT 511

Query: 501 MFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMH 560
           M IQ  ++P P D  QA ++  MP++F F    FPAGL++YW  +N +SI QQ  I +  
Sbjct: 512 MLIQQMLNPTPPDPMQAKVMKLMPIIFTFFFLWFPAGLVLYWVVNNCLSIAQQWYITRKI 571

Query: 561 GA 562
            A
Sbjct: 572 EA 573


>gi|222475049|ref|YP_002563464.1| 60kD inner-membrane protein (yidC) [Anaplasma marginale str.
           Florida]
 gi|255004151|ref|ZP_05278952.1| putative inner membrane protein translocase component YidC
           [Anaplasma marginale str. Virginia]
 gi|56387916|gb|AAV86503.1| 60 kD inner-membrane protein [Anaplasma marginale str. St. Maries]
 gi|222419185|gb|ACM49208.1| 60kD inner-membrane protein (yidC) [Anaplasma marginale str.
           Florida]
          Length = 647

 Score =  361 bits (926), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 192/579 (33%), Positives = 317/579 (54%), Gaps = 19/579 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M    N  +A+  SV ++  W+  Y    ++E   +++    V   + +  +        
Sbjct: 76  MSEARNLVLAVVASVAVMVGWRFVYERVLVKEYPQQQRE---VVSESLIPEAMDVAEYRP 132

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           R  A++  PRV L N S+  SI+LKGA  DD++L  Y +    +S  V L+SP  T+   
Sbjct: 133 RVDAINSVPRVRLGNTSVRASISLKGALVDDVSLTKYQVSTDKHSENVVLMSPEGTREDS 192

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF 180
             E  ++   +  ++P+ NT+W +  G   +      L + N   ++F    S+D  Y+F
Sbjct: 193 IVEFGWIDPEHKTKVPDKNTLWEVEQGSEASGEGSATLRWDNGQGLVFRLRFSIDRAYMF 252

Query: 181 KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS 240
            +   V N++ + +R S  GRI +   Q   + +   EG I   G   L E  Y D++K 
Sbjct: 253 SVSQEVENSTGEDLRLSYYGRINKAHAQDGKSYWISHEGAIGSFGH-GLQEWTYKDMQKG 311

Query: 241 SISNFHESN-----SWLGISDKYWASVFIPSKET-SFHSQFKYLS-DGHARYQAKFSANE 293
           S +    +N      W+G++DKYW +  +PS +      + K++  +    +Q  FS + 
Sbjct: 312 SGARVGATNEGTGSHWIGLADKYWFTALVPSSDKGKLAFRAKHVPRNDVDHFQVDFSRSY 371

Query: 294 ITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYF 353
            TI  G    +T  LF GAKE   + +Y   L IP F+  +D+G  YFI KP+F L+ YF
Sbjct: 372 GTIPAGGKAESTTQLFIGAKELAVLDNYRSGLNIPLFDKAVDFGVLYFITKPVFQLLQYF 431

Query: 354 YNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQK 413
           + +VGNFG+AI++ T+ +KL+ FPL+ K YVS   +K +QP+I  +RE   ++    + K
Sbjct: 432 HKVVGNFGLAIVMLTIAIKLVVFPLSSKSYVSMFKLKKLQPEISRIRE-LHKTDDVRISK 490

Query: 414 AMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNI 473
            +  L++ H ++P++G  PIL+QIPVFFA+YKV+ +++EMRHAP + WI+DL++ D  N+
Sbjct: 491 EISALFRKHGVSPMSGFLPILVQIPVFFALYKVLFVTIEMRHAPLFAWIQDLSSHDTANL 550

Query: 474 FTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMS---PPPADKGQAMILNWMPVVFVFA 530
             LFG+L F  P  + VG+ PII+ ++M +Q K++       D     ++ ++P VFVF 
Sbjct: 551 LNLFGLLRFEPP--ICVGVLPIILGITMVLQQKINQQDQATQDPY--GVMKFLPYVFVFI 606

Query: 531 LSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDR 569
            SSFPAGL++YW  SNVI+++QQ  + +       L++ 
Sbjct: 607 FSSFPAGLVLYWICSNVITMLQQLFVRRFIFDRRDLVNN 645


>gi|116053719|ref|YP_794046.1| putative inner membrane protein translocase component YidC
           [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218894670|ref|YP_002443540.1| putative inner membrane protein translocase component YidC
           [Pseudomonas aeruginosa LESB58]
 gi|296392435|ref|ZP_06881910.1| putative inner membrane protein translocase component YidC
           [Pseudomonas aeruginosa PAb1]
 gi|313111480|ref|ZP_07797281.1| putative inner membrane protein, 60 kDa [Pseudomonas aeruginosa
           39016]
 gi|122256261|sp|Q02DE0|OXAA_PSEAB RecName: Full=Inner membrane protein oxaA
 gi|254773013|sp|B7V7A5|OXAA_PSEA8 RecName: Full=Inner membrane protein oxaA
 gi|115588940|gb|ABJ14955.1| putative inner membrane protein, 60 kDa [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218774899|emb|CAW30718.1| putative inner membrane protein, 60 kDa [Pseudomonas aeruginosa
           LESB58]
 gi|310883783|gb|EFQ42377.1| putative inner membrane protein, 60 kDa [Pseudomonas aeruginosa
           39016]
          Length = 578

 Score =  361 bits (926), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 140/602 (23%), Positives = 242/602 (40%), Gaps = 69/602 (11%)

Query: 1   MERNWNYFV--AIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           M+   +  +     +S ++V  W   Y  P +   +      Q +        + + V  
Sbjct: 1   MDIQRSILIVALAVVSYLLVLQWNKDYGQPELPAASASMNTTQGLPDTPSASGTSSDVPT 60

Query: 59  DDRAQALSMS---------PRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVT 109
              + A S +           +++K   L  +I+ +G     L L  Y   +        
Sbjct: 61  AQSSAAGSEAADKPVAVSDKLIQVKTDVLDLAIDPRGGDIVQLGLLQYPRRLDRPDVPFP 120

Query: 110 LLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKL----VFKNANN 165
           L   +  +  Y A+                 +++             +L     F +   
Sbjct: 121 LF-DNGRERTYLAQSGLTGADGPDASSAGRPLFHSAQSSYQLADGQNELVVDLSFSHDGV 179

Query: 166 ILFERTIS---------------------LDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR 204
              +R                         +  Y   +   + N S      +   ++ R
Sbjct: 180 NYIKRFTFHRGLKADCSDKEKAQKKIECINENAYQVGVSYLIDNQSGKTWSGNLFAQLKR 239

Query: 205 HKPQTATNT----FGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWA 260
                 ++T         G      D    +    D++K           W+     Y+ 
Sbjct: 240 DGSADPSSTTATGVSTYLGAAVWTPDSPYKKISTKDMDKEQFKE-SVQGGWVAWLQHYFV 298

Query: 261 SVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHH 320
           + ++P+K        +   DG   Y   F+   +++  G  + T   L+AG K    +  
Sbjct: 299 TAWVPTKGEQHQVMTR--KDGQGNYIVGFTGPTLSVPAGSKVETDLTLYAGPKLQKHLKE 356

Query: 321 YEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAK 380
                  P  E+ +D+G+ +FIA+P+F L+ + ++L+GN+G +I+  TV +KL FFPL+ 
Sbjct: 357 LS-----PGLELTVDYGFLWFIAQPIFWLLQHIHSLIGNWGWSIIALTVLIKLAFFPLSA 411

Query: 381 KQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVF 440
             Y S A M+ + PK+  ++E+      Q + +AM++LYK   INPL GC PIL+Q+PVF
Sbjct: 412 ASYRSMARMRAVSPKMQAIKEQHGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVF 470

Query: 441 FAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLS 500
            ++Y V+  S+EMR AP+ GWI DL+  DP                     I PI+M  +
Sbjct: 471 LSLYWVLLESVEMRQAPWLGWITDLSVKDPFF-------------------ILPIVMGGT 511

Query: 501 MFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMH 560
           M IQ  ++P P D  QA ++  MP++F F    FPAGL++YW  +N +SI QQ  I +  
Sbjct: 512 MLIQQMLNPTPPDPMQAKVMKLMPIIFTFFFLWFPAGLVLYWVVNNCLSIAQQWYITRKI 571

Query: 561 GA 562
            A
Sbjct: 572 EA 573


>gi|56477030|ref|YP_158619.1| preprotein translocase subunit yidC [Aromatoleum aromaticum EbN1]
 gi|81677486|sp|Q5P4P4|OXAA_AZOSE RecName: Full=Inner membrane protein oxaA
 gi|56313073|emb|CAI07718.1| preprotein translocase subunit yidC [Aromatoleum aromaticum EbN1]
          Length = 550

 Score =  361 bits (926), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 140/578 (24%), Positives = 248/578 (42%), Gaps = 44/578 (7%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQT-----VKQPNQVDNSYAAV 56
                  + +  S+ +V  W  +    +                           +  AV
Sbjct: 1   MDQRRLVLFLVFSLSLVMLWNAWLKQSQPAPTAVTATAGVEGAGVPTPTTGVAPGATTAV 60

Query: 57  LIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNT 116
                A   S +PR+ ++   ++  ++ +G     L L  +          V  L    T
Sbjct: 61  PGVPGAATASTAPRMVVRTDLMVAEVSAQGGDIVRLELAQHKATADKTKNFV--LFDDGT 118

Query: 117 KNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD- 175
            + Y A+   +                    K       ++L     + +   + ++   
Sbjct: 119 IHLYAAQSGLIGEDLPTHKTTFALPQGEQVLKEGEDRLVVRLEAPEQDGVKVTKVMTFHR 178

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNT---FGVQEGFIAVLGDKSLVEQ 232
            +YL  +   + N+S   +      ++ R      +          G       +   + 
Sbjct: 179 GNYLVDVAYEIVNSSERTLSPHAYYQLTRDGKPAESVEAFGVTTFTGPAFYTDAEKFQKV 238

Query: 233 KYSDIEKSSISNFHE-SNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSA 291
           ++ +I +       + S+ W+ +   Y+ S ++P   T    +F     G+  Y A    
Sbjct: 239 QFEEIAEGKAKFVKKASDGWIAMVQHYFVSAWLPQGGTER--EFFAQKVGNDLYSAGVIV 296

Query: 292 NEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMS 351
               I PG+S      L+AG +E   +         P  ++++D+GW   IA P+F ++S
Sbjct: 297 PVAAIQPGQSGRVEASLYAGPQEQDKLEDIA-----PGLDLVVDYGWLTVIAAPLFWVLS 351

Query: 352 YFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVL 411
           + + +VGN+G AI++ T+ +KL+FFPL+   Y S A M+ + P++  L+E +     ++ 
Sbjct: 352 WIHGVVGNWGWAIIIVTILIKLMFFPLSAASYKSMAKMRVLGPRMQRLKELYGNDKAKM- 410

Query: 412 QKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPT 471
           Q+ M+++Y+   INPL GC PIL+QIPVF ++Y V+  S+EMR AP+ GWI+DL+A DP 
Sbjct: 411 QQEMMEMYRKEKINPLGGCLPILVQIPVFISLYWVLLGSVEMRQAPWLGWIQDLSAKDPY 470

Query: 472 NIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFAL 531
                               I P+IM +SM IQMK++P P D  QA ++  MPV+F F  
Sbjct: 471 F-------------------ILPVIMGVSMLIQMKLNPTPPDPIQAKVMMAMPVIFTFMF 511

Query: 532 SSFPAGLIIYWSWSNVISIVQQAVIMK-----MHGAEI 564
             FP+GL++YW  +N++SI QQ  I +       GA+ 
Sbjct: 512 LWFPSGLVLYWVVNNILSIAQQWQITRMIESEKSGAKP 549


>gi|255003028|ref|ZP_05277992.1| putative inner membrane protein translocase component YidC
           [Anaplasma marginale str. Puerto Rico]
          Length = 647

 Score =  361 bits (926), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 192/579 (33%), Positives = 317/579 (54%), Gaps = 19/579 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M    N  +A+  SV ++  W+  Y    ++E   +++    V   + +  +        
Sbjct: 76  MSEARNLVLAVVASVAVMVGWRFVYERVLVKEYPQQQRE---VVSESLIPEAMDVAEYRP 132

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           R  A++  PRV L N S+  SI+LKGA  DD++L  Y +    +S  V L+SP  T+   
Sbjct: 133 RVDAINSVPRVRLGNTSVRASISLKGALVDDVSLTKYQVSTDKHSENVVLMSPEGTREDS 192

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF 180
             E  ++   +  ++P+ NT+W +  G   +      L + N   ++F    S+D  Y+F
Sbjct: 193 IVEFGWIDPEHKTKVPDKNTLWEVEQGSEASGEGSATLRWDNGQGLVFRLRFSIDRAYMF 252

Query: 181 KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS 240
            +   V N++ + +R S  GRI +   Q   + +   EG I   G   L E  Y D++K 
Sbjct: 253 SVSQEVENSTGEDLRLSYYGRINKAHAQDGKSYWISHEGAIGSFGH-GLQEWTYKDMQKG 311

Query: 241 SISNFHESN-----SWLGISDKYWASVFIPSKET-SFHSQFKYLS-DGHARYQAKFSANE 293
           S +    +N      W+G++DKYW +  +PS +      + K++  +    +Q  FS + 
Sbjct: 312 SGARVGATNEGTGSHWIGLADKYWFTALVPSSDKGKLAFRAKHVPRNDVDHFQVDFSRSY 371

Query: 294 ITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYF 353
            TI  G    +T  LF GAKE   + +Y   L IP F+  +D+G  YFI KP+F L+ YF
Sbjct: 372 GTIPAGGKAESTTQLFIGAKELAVLDNYRSGLNIPLFDKAVDFGVLYFITKPVFQLLQYF 431

Query: 354 YNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQK 413
           + +VGNFG+AI++ T+ +KL+ FPL+ K YVS   +K +QP+I  +RE   ++    + K
Sbjct: 432 HKVVGNFGLAIVMLTIAIKLVVFPLSSKSYVSMFKLKKLQPEISRIRE-LHKTDDVRISK 490

Query: 414 AMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNI 473
            +  L++ H ++P++G  PIL+QIPVFFA+YKV+ +++EMRHAP + WI+DL++ D  N+
Sbjct: 491 EISALFRKHGVSPMSGFLPILVQIPVFFALYKVLFVTIEMRHAPLFAWIQDLSSHDTANL 550

Query: 474 FTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMS---PPPADKGQAMILNWMPVVFVFA 530
             LFG+L F  P  + VG+ PII+ ++M +Q K++       D     ++ ++P VFVF 
Sbjct: 551 LNLFGLLRFEPP--ICVGVLPIILGITMVLQQKINQQDQATQDPY--GVMKFLPYVFVFI 606

Query: 531 LSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDR 569
            SSFPAGL++YW  SNVI+++QQ  + +       L++ 
Sbjct: 607 FSSFPAGLVLYWICSNVITMLQQLFVRRFIFDRRDLVNN 645


>gi|15600761|ref|NP_254255.1| inner membrane protein translocase component YidC [Pseudomonas
           aeruginosa PAO1]
 gi|38503188|sp|Q9HT06|OXAA_PSEAE RecName: Full=Inner membrane protein oxaA
 gi|9951909|gb|AAG08953.1|AE004968_7 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
          Length = 578

 Score =  361 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 140/602 (23%), Positives = 241/602 (40%), Gaps = 69/602 (11%)

Query: 1   MERNWNYFV--AIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           M+   +  +     +S ++V  W   Y  P +   +      Q +        + + V  
Sbjct: 1   MDIQRSILIVALAVVSYLLVLQWNKDYGQPELPAASASMNTTQGLPDTPSASGTSSDVPT 60

Query: 59  DDRAQALSMS---------PRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVT 109
              + A S +           +++K   L  +I+ +G     L L  Y   +        
Sbjct: 61  AQSSAAGSEAADKPVAVSDKLIQVKTDVLDLAIDPRGGDIVQLGLLQYPRRLDRPDVPFP 120

Query: 110 LLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKL----VFKNANN 165
           L   +  +  Y A+                 ++              +L     F +   
Sbjct: 121 LF-DNGRERTYLAQSGLTGADGPDASSAGRPLFRSAQSSYQLADGQNELVVDLSFSHDGV 179

Query: 166 ILFERTIS---------------------LDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR 204
              +R                         +  Y   +   + N S      +   ++ R
Sbjct: 180 NYIKRFTFHRGLKADCSDKEKAQKKIECINENAYQVGVSYLIDNQSGKTWSGNLFAQLKR 239

Query: 205 HKPQTATNT----FGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWA 260
                 ++T         G      D    +    D++K           W+     Y+ 
Sbjct: 240 DGSADPSSTTATGVSTYLGAAVWTPDSPYKKISTKDMDKEQFKE-SVQGGWVAWLQHYFV 298

Query: 261 SVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHH 320
           + ++P+K        +   DG   Y   F+   +++  G  + T   L+AG K    +  
Sbjct: 299 TAWVPTKGEQHQVMTR--KDGQGNYIVGFTGPTLSVPAGSKVETDLTLYAGPKLQKHLKE 356

Query: 321 YEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAK 380
                  P  E+ +D+G+ +FIA+P+F L+ + ++L+GN+G +I+  TV +KL FFPL+ 
Sbjct: 357 LS-----PGLELTVDYGFLWFIAQPIFWLLQHIHSLIGNWGWSIIALTVLIKLAFFPLSA 411

Query: 381 KQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVF 440
             Y S A M+ + PK+  ++E+      Q + +AM++LYK   INPL GC PIL+Q+PVF
Sbjct: 412 ASYRSMARMRAVSPKMQAIKEQHGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVF 470

Query: 441 FAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLS 500
            ++Y V+  S+EMR AP+ GWI DL+  DP                     I PI+M  +
Sbjct: 471 LSLYWVLLESVEMRQAPWLGWITDLSVKDPFF-------------------ILPIVMGGT 511

Query: 501 MFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMH 560
           M IQ  ++P P D  QA ++  MP++F F    FPAGL++YW  +N +SI QQ  I +  
Sbjct: 512 MLIQQMLNPTPPDPMQAKVMKLMPIIFTFFFLWFPAGLVLYWVVNNCLSIAQQWYITRKI 571

Query: 561 GA 562
            A
Sbjct: 572 EA 573


>gi|58040258|ref|YP_192222.1| putative inner membrane protein translocase component YidC
           [Gluconobacter oxydans 621H]
 gi|58002672|gb|AAW61566.1| 60 kD inner membrane protein OxaA [Gluconobacter oxydans 621H]
          Length = 575

 Score =  361 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 180/575 (31%), Positives = 293/575 (50%), Gaps = 13/575 (2%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
                   A  LS +I+  +  F   P  ++ +          Q +    +         
Sbjct: 1   MDTKRIIAATLLSALILIGFDYFMPKPHQDDPHPVTHAPAAQVQNSAPTTAAPPAEAATE 60

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
            QA   + R+ +  P + GS+NLKGA  DDL L  Y   ++ +SP+V LL  + + +  F
Sbjct: 61  TQA--TARRIPVTGPDVQGSLNLKGAVLDDLILMKYRETLAKDSPLVRLLDKAGSAHPTF 118

Query: 122 AELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFK 181
             + + +   +             S + LTP  P+ L + N   ++F   I+LDEHY+F 
Sbjct: 119 VVIGWTNAPGSNARLPDLNTVWESSDETLTPDHPVTLHWDNGQGLVFSIQIALDEHYMFA 178

Query: 182 IVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSS 241
           +  TV N+S   +   P  R+ R            +     + G       K        
Sbjct: 179 VSQTVENHSGQPVALVPFERVQRDYDAPEGAFTAHEGPIAVIGGRMQDESYKNLRKGADH 238

Query: 242 ISNF----HESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKF-SANEITI 296
             +       +N W GISDK+W +   P+  T   + F Y+      YQ    + N   I
Sbjct: 239 PDHVSWSSTGTNGWDGISDKFWLTAVAPADGTPVAASFAYVPGTPGSYQVGMSTQNAQQI 298

Query: 297 LPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNL 356
           +P  SIT  + +FAGAK    +  Y K L IP  +  ID+GWF F+ +P+  L+ + Y  
Sbjct: 299 MPNGSITEKSHVFAGAKVVSLLQGYSKQLGIPDLDKAIDFGWFSFLTRPLLTLLHWLYLH 358

Query: 357 VGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMI 416
           +GNFG+A+M  T+ VK++ FPLA K   S+A M+ + PK+ E+REK K   P  + + ++
Sbjct: 359 LGNFGLALMALTLIVKIVLFPLASKAAQSSARMRLLAPKVKEIREKNKD-DPMAMNQKVM 417

Query: 417 QLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTL 476
            LY+   ++P +GC P+L+Q P+FF +YK+++IS++ RHAPF+GWI DL+  DPTN+F L
Sbjct: 418 ALYREEKVSPASGCLPMLIQAPIFFCLYKILNISIDARHAPFFGWIHDLSMPDPTNVFNL 477

Query: 477 FGILPFYL---PGFMHVGIWPIIMSLSMFIQMKMSPPPA--DKGQAMILNWMPVVFVFAL 531
           FG+LPF       F+HV IW   + L+ ++  + +   A  D  QA ++ +MP+V+VF +
Sbjct: 478 FGLLPFDPTHYSSFLHVSIWGTALGLTFWLLQRQTSSTASLDPAQARMMQFMPLVYVFFM 537

Query: 532 SSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGL 566
           S FPA L++Y++W+N++++ QQ  I +  G  + +
Sbjct: 538 SGFPASLLVYYTWNNLLTVAQQMFIQRRTGLPVPV 572


>gi|121998020|ref|YP_001002807.1| 60 kDa inner membrane insertion protein [Halorhodospira halophila
           SL1]
 gi|166975869|sp|A1WWE3|OXAA_HALHL RecName: Full=Inner membrane protein oxaA
 gi|121589425|gb|ABM62005.1| protein translocase subunit yidC [Halorhodospira halophila SL1]
          Length = 550

 Score =  360 bits (924), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 149/568 (26%), Positives = 256/568 (45%), Gaps = 36/568 (6%)

Query: 1   MERNWNYFVAIAL---SVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           ME      + IAL   S+++ +AW+   + P  E +  E+++    + P+    +     
Sbjct: 1   MENQR-LILLIALAGISLLLYFAWEREQMDPA-EPVVEEQESEVDQEAPDAPSRAEEPDA 58

Query: 58  IDDRAQAL-----SMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLS 112
            D  A+ +       + RV +K   +   I+ +G     L+L  +       +P   L  
Sbjct: 59  GDPMAEGVVDPDDEDAKRVRVKTDLIEAEISTQGGDIRQLDLLKHQKASDDPTPYRLLRD 118

Query: 113 PSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTI 172
                    A L     A   +             +    T  + L+++     + +   
Sbjct: 119 EGEPLFVAQAGLGGDGPAPGRDARYEVDQDEFELAEGE-DTLEVPLIWEEDGVKVRKVYT 177

Query: 173 SLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIA--VLGDKSLV 230
              + YL  +   V NN+ D        ++ R      T  + +           +    
Sbjct: 178 FRRDSYLVDVRHEVENNAEDDWAGFQYVQLRRRPDPAGTTPWYIHSFTGGSLYTQEDRFS 237

Query: 231 EQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFS 290
              +SD+E S +S   E + W  +   Y+  V IP +  ++    + L      Y    S
Sbjct: 238 RISFSDMEDSDLSQ-DERDGWAAMLQHYFLGVMIPERGETYRYYTRALP--QETYLLGMS 294

Query: 291 ANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLM 350
           +  + +  G+S   TN LF G KE   +      L +    + +D+G+   +A P+F  +
Sbjct: 295 SPWLQVAAGESGQKTNHLFVGPKEQDRLTAVGSALDVDDLRLTVDYGFLTILANPLFWAL 354

Query: 351 SYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQV 410
               NLV N+G+AI++ T+ +K+ F+ L+   Y S A M+ +QPK+ ++RE++     Q+
Sbjct: 355 DQIENLVKNWGVAILILTLLIKIAFYKLSAISYRSMAKMRKVQPKMQQIRERYSDDRQQM 414

Query: 411 LQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADP 470
             +A+++LYK   INPL GC PIL+QIPVF A+Y V+  S+E+RHAPF  WI+DL++ DP
Sbjct: 415 -NQALMELYKKEKINPLGGCLPILVQIPVFIALYWVLVESVELRHAPFMLWIQDLSSRDP 473

Query: 471 TNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFA 530
                                I P++M  SM +QMK++PPP D  Q  ++  +P VF   
Sbjct: 474 YF-------------------ILPLLMGASMLVQMKLNPPPMDPIQKRVMQVLPFVFTGF 514

Query: 531 LSSFPAGLIIYWSWSNVISIVQQAVIMK 558
              FPAGL++YW  +N++SI QQ  I++
Sbjct: 515 FMLFPAGLVLYWLTNNILSIAQQWYILR 542


>gi|260912766|ref|ZP_05919252.1| YidC/Oxa1 family membrane protein insertase [Pasteurella dagmatis
           ATCC 43325]
 gi|260633144|gb|EEX51309.1| YidC/Oxa1 family membrane protein insertase [Pasteurella dagmatis
           ATCC 43325]
          Length = 541

 Score =  360 bits (923), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 150/570 (26%), Positives = 254/570 (44%), Gaps = 43/570 (7%)

Query: 1   MERNWNY--FVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           M+   +      + +S ++   WQ  Y  P+           + VK  + V  S  +   
Sbjct: 1   MDSRRSLLVIALLFISFLVYQQWQLDYHTPKPV-------VTEQVKVSSDVPASSTSSTS 53

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
           D    A      + L+N  L   ++  G       L  +  ++ SN+P   L +  N  +
Sbjct: 54  DIATTAQIQGRVITLENDVLRLKVDTLGGDVIHSELLKHDAELDSNTPFTLLTNKQN--H 111

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFK---NANNILFERTISLD 175
            Y A+   V     I+       + +            +LV       + + F +   L 
Sbjct: 112 VYIAQSGLVGKDG-IDTKAGRASYQVEGDAFKLAEGQNELVVPLVFEKDGVTFRKVFVLK 170

Query: 176 EH-YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKY 234
            + Y   +   + N S   I   P G++     +   N         A    ++  ++  
Sbjct: 171 RNAYDISVNFEIDNQSEKAIEVEPYGQLRHTLVEDTGNVAMPTYTGGAYSSSETNYKKYS 230

Query: 235 SDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
            D  + +         W+ +   Y+ S +IP+++      +      +      +     
Sbjct: 231 FDEMQKANLAVSTKAGWVAVLQHYFVSAWIPNQDADNQL-YSLTDKANNLASIGYRGPTT 289

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
            I  G   T T+ L+ G K    +            ++ +D+GW +FIAKP+F L+++  
Sbjct: 290 VISAGAKETITSSLWTGPKLQDQMAAVAN-----HLDLTVDYGWAWFIAKPLFWLLTFIQ 344

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
           ++V N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + 
Sbjct: 345 SIVHNWGLAIIGVTLVVKAILYPLTKAQYTSMAKMRMLQPKLQEMRERF-GEDRQRMSQE 403

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           M++LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A DP    
Sbjct: 404 MMKLYKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQDPYY-- 461

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSS 533
                            I PI+M  SMF+  KMSP P AD  Q  I+N+MP++F+     
Sbjct: 462 -----------------ILPILMGASMFLLQKMSPTPVADPMQQKIMNFMPLIFMVFFLW 504

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           FP+GL++YW  SN+I+I QQ +I +    +
Sbjct: 505 FPSGLVLYWLVSNLITIAQQQLIYRGLEKK 534


>gi|262166780|ref|ZP_06034517.1| OxaI/YidC membrane insertion protein [Vibrio mimicus VM223]
 gi|262026496|gb|EEY45164.1| OxaI/YidC membrane insertion protein [Vibrio mimicus VM223]
          Length = 541

 Score =  360 bits (922), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 142/570 (24%), Positives = 249/570 (43%), Gaps = 41/570 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL+++    +Q + V         ++             +        +
Sbjct: 1   MDSQRN-ILLIALALVSFLLFQQWQVAKNPAPQATQQAQSTGAAPAPSFSDELDPTPAQN 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
              A++ +  + + +  L  SI+  G       L  Y  ++ S+ P V L +     + +
Sbjct: 60  ---AVAQAKTITVTSDVLTLSIDTLGGDIVSAKLNQYSEELDSSEPFVLLQNTQG--HQF 114

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDE 176
            A+   V         N+   + + +             I + ++       +  I    
Sbjct: 115 IAQSGLVGPQGIDVTSNNRPAYQVNADSFSLAEGQDELRIPMTYQANGIDYTKTFILKRG 174

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYS 235
            Y   +V  V NNS +         + ++   +  N       G      D    +  + 
Sbjct: 175 SYAVDVVFDVANNSGNAATLGMYAHLRQNLLDSGGNLAMPTYRGGAYSTSDVRYKKYSFD 234

Query: 236 DIEKSSIS-NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
           D++  ++S     + +W+ +   Y+AS +IP  E       + +++              
Sbjct: 235 DMKDRNLSVPNDVTVNWVAMIQHYFASAWIPRDEPQAQLYSRVINNLGD---MGIRTPNK 291

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
           TI  G        L+ G K    +         P  ++++D+GW +FIAKP+  L+S+  
Sbjct: 292 TIANGDKAEFEATLWVGPKLQDQMAAVA-----PNLDLVVDYGWLWFIAKPLHWLLSFIQ 346

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
           + VGN+G+AI+  T  V+   +PL K QY S A M+ +QPK+  +RE+      Q + + 
Sbjct: 347 SFVGNWGVAIICLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLQAMRERIGD-DRQRMSQE 405

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           M++LYK   +NPL GC PILLQ+P+F A+Y  +  S+E+RH+PF+GWI DL+A DP    
Sbjct: 406 MMELYKKEKVNPLGGCLPILLQMPIFIALYWALMESVELRHSPFFGWIHDLSAQDPYY-- 463

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSS 533
                            I P++M  SMF+  KMSP    D  Q  I+ +MPV+F F    
Sbjct: 464 -----------------ILPLLMGASMFVIQKMSPTTITDPMQQKIMTFMPVMFTFFFLW 506

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           FP+GL++YW  SN+++++QQ +I K    +
Sbjct: 507 FPSGLVLYWLVSNIVTLIQQTLIYKALEKK 536


>gi|262172772|ref|ZP_06040450.1| OxaI/YidC membrane insertion protein [Vibrio mimicus MB-451]
 gi|261893848|gb|EEY39834.1| OxaI/YidC membrane insertion protein [Vibrio mimicus MB-451]
          Length = 541

 Score =  360 bits (922), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 142/570 (24%), Positives = 248/570 (43%), Gaps = 41/570 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL+++    +Q + V         ++             +        +
Sbjct: 1   MDSQRN-ILLIALALVSFLLFQQWQVAKNPAPQATQQAQSTGAAPAPSFSDELDPTPAQN 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
              A + +  + + +  L  SI+  G       L  Y  ++ S+ P V L +     + +
Sbjct: 60  ---AAAQAKTITVTSDVLTLSIDTLGGDIVSAKLNQYSEELDSSEPFVLLQNTQG--HQF 114

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDE 176
            A+   V         N+   + + +             I + ++       +  I    
Sbjct: 115 IAQSGLVGPQGIDVTSNNRPAYQVNADSFSLAEGQDELRIPMTYQANGIDYTKTFILKRG 174

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYS 235
            Y   +V  V NNS +         + ++   +  N       G      D    +  + 
Sbjct: 175 SYAVDVVFDVANNSGNAATLGMYAHLRQNLLDSGGNLAMPTYRGGAYSTSDVRYKKYSFD 234

Query: 236 DIEKSSIS-NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
           D++  ++S     + +W+ +   Y+AS +IP  E       + +++              
Sbjct: 235 DMKDRNLSVPNDVTVNWVAMIQHYFASAWIPRDEPQAQLYSRVINNLGD---MGIRTPNK 291

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
           TI  G        L+ G K    +         P  ++++D+GW +FIAKP+  L+S+  
Sbjct: 292 TIANGDKAEFEATLWVGPKLQDQMAAVA-----PNLDLVVDYGWLWFIAKPLHWLLSFIQ 346

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
           + VGN+G+AI+  T  V+   +PL K QY S A M+ +QPK+  +RE+      Q + + 
Sbjct: 347 SFVGNWGVAIICLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLQAMRERIGD-DRQRMSQE 405

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           M++LYK   +NPL GC PILLQ+P+F A+Y  +  S+E+RH+PF+GWI DL+A DP    
Sbjct: 406 MMELYKKEKVNPLGGCLPILLQMPIFIALYWALMESVELRHSPFFGWIHDLSAQDPYY-- 463

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSS 533
                            I P++M  SMF+  KMSP    D  Q  I+ +MPV+F F    
Sbjct: 464 -----------------ILPLLMGASMFVIQKMSPTTITDPMQQKIMTFMPVMFTFFFLW 506

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           FP+GL++YW  SN+++++QQ +I K    +
Sbjct: 507 FPSGLVLYWLVSNIVTLIQQTLIYKALEKK 536


>gi|330831724|ref|YP_004394676.1| inner membrane protein oxaA [Aeromonas veronii B565]
 gi|328806860|gb|AEB52059.1| Inner membrane protein oxaA [Aeromonas veronii B565]
          Length = 548

 Score =  359 bits (921), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 138/573 (24%), Positives = 245/573 (42%), Gaps = 41/573 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           ME   N  + I L  +    WQ +                QT     +   +     + +
Sbjct: 1   MESQRNLLL-IGLLFVSFLLWQQW--ESDKAPKPAPTTVAQTEHFVPEAGQTGDIPQVSE 57

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           +A A +    + + +  L  +++ +G       L  + L+   + P V L   S  ++ Y
Sbjct: 58  QANATAARKLITVSSDVLKLTLDTQGGDVVSAELLSHKLEEGKDQPFVLL--TSKPEHLY 115

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLD- 175
            A+   V              +                 + + + ++  ++F +   L  
Sbjct: 116 IAQSGLVGRNGPDSQAEGRPTYEAAQTSYQLADGQDQVVVPMTWTDSKGVVFTKEFILKR 175

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
             Y   +   + N S + ++    G++ +                    G  S  + +Y 
Sbjct: 176 GDYAVGVDYKIDNKSAEPVQVQFYGQLKQTVATPKDQEGHAMVASAYRGGAFSTEDTRYK 235

Query: 236 DIEKSSISNFHESN----SWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSA 291
                 + +   +      W+ +   Y+ S + P+ +   +S +  +  G  +    + A
Sbjct: 236 KYTFDEMKDADLNKTTKGGWVAMLQHYFVSAWAPNAD-DTNSFYSRVIPGKGQAIIGYKA 294

Query: 292 NEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMS 351
             + +  G+    T+ L+ G K    +            ++ +D+GW +FIA+P+  L++
Sbjct: 295 PLVDVAAGQQAEVTSKLWVGPKLQDQMAKVAN-----HLDLTVDYGWLWFIAQPLHWLLT 349

Query: 352 YFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVL 411
            F+  V N+G+AI++ T+ V+ + FPL K QY S A M+ +QPKI  LRE+F     Q +
Sbjct: 350 VFHGFVQNWGLAIIMLTLLVRGIMFPLTKAQYTSMAKMRMLQPKIAALRERFGD-DRQKM 408

Query: 412 QKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPT 471
            + M++LYK   +NPL GC PIL+Q+P+F A+Y  +  S+E+RHAPF  WI DL+  DP 
Sbjct: 409 SQGMMELYKKEKVNPLGGCLPILVQMPIFIALYWALMESVELRHAPFALWITDLSVKDPF 468

Query: 472 NIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFA 530
                               + PI+M  SM+   KMSP    D  Q  ++ +MP++F F 
Sbjct: 469 F-------------------VLPILMGASMWYLQKMSPTTVTDPMQQKVMQFMPIIFTFM 509

Query: 531 LSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
              FPAGL +YW  SNVISI+QQ +I +    +
Sbjct: 510 FLWFPAGLTLYWLVSNVISIIQQTIIYRQLEKK 542


>gi|262402088|ref|ZP_06078652.1| OxaI/YidC membrane insertion protein [Vibrio sp. RC586]
 gi|262351734|gb|EEZ00866.1| OxaI/YidC membrane insertion protein [Vibrio sp. RC586]
          Length = 541

 Score =  359 bits (921), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 142/570 (24%), Positives = 248/570 (43%), Gaps = 41/570 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL+++    +Q + V         ++             +        +
Sbjct: 1   MDSQRN-ILLIALALVSFLLFQQWQVAKNPTPQATQQAQSTGAAPAPSFSDELDPTPAQN 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
              A + +  + + +  L  SI+  G       L  Y  ++ S+ P V L +     + +
Sbjct: 60  ---AAAQAKTITVTSDVLTLSIDTLGGDIVSAKLNQYSEELDSSEPFVLLQNTQG--HQF 114

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDE 176
            A+   V         N+   + + +             I + ++       +  I    
Sbjct: 115 IAQSGLVGPQGIDVTSNNRPAYQVNADSFSLAEGQDELRIPMTYQANGIEYTKTFILKRG 174

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYS 235
            Y   +V  V NNS +         + ++   +  N       G      D    +  + 
Sbjct: 175 SYAVDVVFDVANNSGNAATLGMYAHLRQNLLDSGGNLAMPTYRGGAYSTSDVRYKKYSFD 234

Query: 236 DIEKSSIS-NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
           D++  ++S     + +W+ +   Y+AS +IP  E       + +++              
Sbjct: 235 DMKDRNLSVPNDVTVNWVAMIQHYFASAWIPRDEPQAQLYSRVINNLGD---MGIRTPNK 291

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
           TI  G        L+ G K    +         P  ++++D+GW +FIAKP+  L+S+  
Sbjct: 292 TIANGDKAEFEATLWVGPKLQDQMAAVA-----PNLDLVVDYGWLWFIAKPLHWLLSFIQ 346

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
           + VGN+G+AI+  T  V+   +PL K QY S A M+ +QPK+  +RE+      Q + + 
Sbjct: 347 SFVGNWGVAIICLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLQAMRERIGD-DRQRMSQE 405

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           M++LYK   +NPL GC PILLQ+P+F A+Y  +  S+E+RH+PF+GWI DL+A DP    
Sbjct: 406 MMELYKKEKVNPLGGCLPILLQMPIFIALYWALMESVELRHSPFFGWIHDLSAQDPYY-- 463

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSS 533
                            I P++M  SMF+  KMSP    D  Q  I+ +MPV+F F    
Sbjct: 464 -----------------ILPLLMGASMFVIQKMSPTTITDPMQQKIMTFMPVMFTFFFLW 506

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           FP+GL++YW  SN+++++QQ +I K    +
Sbjct: 507 FPSGLVLYWLVSNIVTLIQQTLIYKALEKK 536


>gi|161544990|ref|YP_153758.2| putative inner membrane protein translocase component YidC
           [Anaplasma marginale str. St. Maries]
          Length = 572

 Score =  359 bits (921), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 192/579 (33%), Positives = 317/579 (54%), Gaps = 19/579 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M    N  +A+  SV ++  W+  Y    ++E   +++    V   + +  +        
Sbjct: 1   MSEARNLVLAVVASVAVMVGWRFVYERVLVKEYPQQQRE---VVSESLIPEAMDVAEYRP 57

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           R  A++  PRV L N S+  SI+LKGA  DD++L  Y +    +S  V L+SP  T+   
Sbjct: 58  RVDAINSVPRVRLGNTSVRASISLKGALVDDVSLTKYQVSTDKHSENVVLMSPEGTREDS 117

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF 180
             E  ++   +  ++P+ NT+W +  G   +      L + N   ++F    S+D  Y+F
Sbjct: 118 IVEFGWIDPEHKTKVPDKNTLWEVEQGSEASGEGSATLRWDNGQGLVFRLRFSIDRAYMF 177

Query: 181 KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS 240
            +   V N++ + +R S  GRI +   Q   + +   EG I   G   L E  Y D++K 
Sbjct: 178 SVSQEVENSTGEDLRLSYYGRINKAHAQDGKSYWISHEGAIGSFGH-GLQEWTYKDMQKG 236

Query: 241 SISNFHESN-----SWLGISDKYWASVFIPSKET-SFHSQFKYLS-DGHARYQAKFSANE 293
           S +    +N      W+G++DKYW +  +PS +      + K++  +    +Q  FS + 
Sbjct: 237 SGARVGATNEGTGSHWIGLADKYWFTALVPSSDKGKLAFRAKHVPRNDVDHFQVDFSRSY 296

Query: 294 ITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYF 353
            TI  G    +T  LF GAKE   + +Y   L IP F+  +D+G  YFI KP+F L+ YF
Sbjct: 297 GTIPAGGKAESTTQLFIGAKELAVLDNYRSGLNIPLFDKAVDFGVLYFITKPVFQLLQYF 356

Query: 354 YNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQK 413
           + +VGNFG+AI++ T+ +KL+ FPL+ K YVS   +K +QP+I  +RE   ++    + K
Sbjct: 357 HKVVGNFGLAIVMLTIAIKLVVFPLSSKSYVSMFKLKKLQPEISRIRE-LHKTDDVRISK 415

Query: 414 AMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNI 473
            +  L++ H ++P++G  PIL+QIPVFFA+YKV+ +++EMRHAP + WI+DL++ D  N+
Sbjct: 416 EISALFRKHGVSPMSGFLPILVQIPVFFALYKVLFVTIEMRHAPLFAWIQDLSSHDTANL 475

Query: 474 FTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMS---PPPADKGQAMILNWMPVVFVFA 530
             LFG+L F  P  + VG+ PII+ ++M +Q K++       D     ++ ++P VFVF 
Sbjct: 476 LNLFGLLRFEPP--ICVGVLPIILGITMVLQQKINQQDQATQDPY--GVMKFLPYVFVFI 531

Query: 531 LSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDR 569
            SSFPAGL++YW  SNVI+++QQ  + +       L++ 
Sbjct: 532 FSSFPAGLVLYWICSNVITMLQQLFVRRFIFDRRDLVNN 570


>gi|261856984|ref|YP_003264267.1| membrane protein insertase, YidC/Oxa1 family domain containing
           [Halothiobacillus neapolitanus c2]
 gi|261837453|gb|ACX97220.1| membrane protein insertase, YidC/Oxa1 family domain containing
           [Halothiobacillus neapolitanus c2]
          Length = 570

 Score =  359 bits (920), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 154/596 (25%), Positives = 253/596 (42%), Gaps = 57/596 (9%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFY-----------------VYPRIEEMNNERKNIQTVK 44
             N    + +AL  +++  WQ +                    P         K+I    
Sbjct: 1   MDNRRLILVVALGFVLISLWQAWTHDQSQSAQQTAATLQNAASPDSPAQPTAAKDIPATS 60

Query: 45  QPNQVDNSYAAVLIDDRAQALSMS-PRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSS 103
            P+      +AV     A+  S +   + +K   L   I+L+G   D+ +L  Y  +   
Sbjct: 61  APSASGQDQSAVPGGSAAKPTSKAAQTITVKTDVLALKISLQGGVIDEADLLKYPQEQDK 120

Query: 104 NSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTP---TTPIKLVF 160
             P V LL+ SN    Y A+   +         +            LTP      I L +
Sbjct: 121 ADP-VRLLTDSNG-FVYVAQSGLIGEKGAPAPDHYAQYTAPQMEYTLTPGENELRIPLTW 178

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGF 220
           +     + +  I     Y  ++   + N S      S   ++ R      T       G 
Sbjct: 179 EKDGIKITKLIIIKRGDYTVQVEYKIDNTSQSPWAASQYRQLTRLGTTPGTQLVHTYTGT 238

Query: 221 I------AVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFH-- 272
           +            +  +  + ++ K+ +S    S+ W+ I   Y+ S ++PS     +  
Sbjct: 239 VYAGDVPGTKDRLAYEKIPFEEMLKTKLSK-DLSSGWVAIIQHYFMSAWVPSDRQQVNHF 297

Query: 273 SQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEM 332
                  +    Y    S+   TI  G S   ++ L+ G K    +    +        +
Sbjct: 298 YTLVSDKNNQTLYTIGMSSPVTTIPAGGSGELSSTLYVGPKIQANLAPLAQ-----GLNL 352

Query: 333 LIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNI 392
            ID+G F  IA P+F L+ +F+  VGN+G +I+L T+ +KL F   +   Y S A M+ +
Sbjct: 353 TIDFGIFTVIADPIFWLLKHFHEWVGNWGWSIVLVTLVIKLFFLWPSAISYRSMAKMRAV 412

Query: 393 QPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLE 452
            PK+  L+EKF     Q L + M++LY+   INPL GC PI++QIPVF ++Y V++ S+E
Sbjct: 413 TPKMKALKEKF-GEDRQKLSQEMMKLYQREKINPLGGCLPIVIQIPVFISLYWVLAESVE 471

Query: 453 MRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPA 512
           +R AP+  WI DL+  DP                     + P++M +SMFIQ K++P P 
Sbjct: 472 LRQAPWILWIHDLSQKDPYF-------------------VLPLLMGISMFIQQKLNPAPV 512

Query: 513 DKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLID 568
           D  Q  I  W+PV+F    S FPAGL++YW  +N++SI QQ +I +    ++ LI 
Sbjct: 513 DPMQQKIFAWLPVIFTIFFSFFPAGLVLYWFVNNLLSIAQQYMITRKIEKQMALIK 568


>gi|197333980|ref|YP_002154775.1| inner membrane protein OxaA [Vibrio fischeri MJ11]
 gi|197315470|gb|ACH64917.1| inner membrane protein OxaA [Vibrio fischeri MJ11]
          Length = 541

 Score =  358 bits (919), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 138/571 (24%), Positives = 240/571 (42%), Gaps = 43/571 (7%)

Query: 1   MERNWN-YFVAIAL-SVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           M+   N   +A+AL S ++   WQ      +   ++  ++       P     + +    
Sbjct: 1   MDTQRNILLLALALVSFLLFQQWQVETNPQQPATVSTVQQTQTDGDVP-----TSSTANS 55

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
           D  A +      + +    L   ++  G    +  L  Y  ++ S +  V L   ++  +
Sbjct: 56  DTPADSAQSDKLITITTDVLTLKVDTLGGDIIESVLNKYDAELDSKAKFVLL--KNDATH 113

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGK---ILTPTTPIKLVFKNANNILFERTISLD 175
           +Y A+   +                  +            + L          +  I   
Sbjct: 114 SYVAQSGLIGPQGIDSNSGRAQFTAQKTDYVLAEGQNELRVPLTLVKDGITYTKTLILKR 173

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKY 234
           + Y   +  TV N S           + ++      + T     G      D    +  +
Sbjct: 174 DSYAIDVDYTVDNQSSAPATVEMYTNLKQNLMDDGGSLTMPTYRGAAYSTEDTRYKKYSF 233

Query: 235 SDIEKSSISNFHES-NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANE 293
            D+E  ++S    +   W G+   Y+AS +IP          +   D             
Sbjct: 234 DDMEDKNLSIDMTNGQGWAGMLQHYFASAWIPRNVNDAKLTSRVAGD---YGYIGVRMPS 290

Query: 294 ITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYF 353
           +TI  G+  T +  L+ G K    +         P  ++ +D+GW +FIA P+  L+S+ 
Sbjct: 291 VTIPAGQEATLSATLWTGPKLQKEMAATA-----PYLDLTVDYGWLWFIASPLHKLLSFI 345

Query: 354 YNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQK 413
             +V N+G+AI++ T  V+   +PL K QY S A M+ +QPK+  +RE+      Q + +
Sbjct: 346 QGIVVNWGLAIIVLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLTAMRERIGD-DRQRMSQ 404

Query: 414 AMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNI 473
            M++LYK   +NPL GC PILLQ+P+F ++Y  +  S+E+RH PF+GWI DL+A DP   
Sbjct: 405 EMMELYKKEKVNPLGGCLPILLQMPIFISLYWALMESVELRHTPFFGWITDLSAQDPYY- 463

Query: 474 FTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALS 532
                             I P++M  SMF+  KMSP    D  Q  I+ +MPV+F     
Sbjct: 464 ------------------ILPLLMGASMFLIQKMSPTTVTDPMQQKIMTFMPVMFTVFFL 505

Query: 533 SFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
            FP+GL++YW  SN+++++QQ +I +    +
Sbjct: 506 WFPSGLVLYWLVSNIVTLIQQTLIYRALEKK 536


>gi|145301204|ref|YP_001144045.1| 60 kDa inner membrane protein [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|166975848|sp|A4STS5|OXAA_AERS4 RecName: Full=Inner membrane protein oxaA
 gi|142853976|gb|ABO92297.1| 60 kDa inner membrane protein [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 548

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 136/573 (23%), Positives = 240/573 (41%), Gaps = 41/573 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           ME   N  + I L  +    WQ +                QT     +   +     + +
Sbjct: 1   MESQRNLIL-IGLLFVSFLLWQQW--ESDKAPKPAPTTVAQTEHFVPEAGQTGDIPQVSE 57

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           +A A +    + + +  L  +++ +G       L  + L+   +   V L   S     Y
Sbjct: 58  QANANAARKLITVSSDVLKLTLDTQGGDIVSAELLAHKLEEGKDQSFVLL--TSQPDRLY 115

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLD- 175
            A+   V              +                 + + + ++  ++F +   L  
Sbjct: 116 VAQSGLVGRDGPDSQAQGRPTYEAAQTSYQLADGQDQVVVPMTWTDSKGVVFTKEFVLKR 175

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
             Y   +   + N S + ++    G++ +                    G  S  E +Y 
Sbjct: 176 GDYAIGVDYKIDNKSAEPVQVQFYGQLKQTVTTPKDQEGHAMVASAYRGGAFSSEESRYK 235

Query: 236 DIEKSSISNFHESN----SWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSA 291
                 + +   +      W+ +   Y+ S + P+ +   +S +  +  G  +    + A
Sbjct: 236 KYTFDEMKDADLNKTTKGGWVAMLQHYFVSAWAPNAD-DTNSFYSRVIPGKDQAIIGYKA 294

Query: 292 NEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMS 351
             + +  G+    T+ L+ G K    +            ++ +D+GW +FIA+P+  L++
Sbjct: 295 PLVDVAAGQQAEVTSKLWVGPKLQDQMAKVAN-----HLDLTVDYGWLWFIAQPLHWLLT 349

Query: 352 YFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVL 411
            F   V N+G+AI++ T+ V+ + FPL K QY S A M+ +QPK+  L+E+F     Q +
Sbjct: 350 VFQGFVHNWGVAIIMLTLLVRGIMFPLTKAQYTSMAKMRMLQPKLAALKERFSD-DRQKM 408

Query: 412 QKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPT 471
            + M++LYK   +NPL GC PIL+Q+P+F A+Y  +  S+E+RHAPF  WI DL+  DP 
Sbjct: 409 SQGMMELYKKEKVNPLGGCLPILVQMPIFIALYWALMESVELRHAPFALWITDLSVKDPF 468

Query: 472 NIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFA 530
                               + PI+M  SM+   KMSP    D  Q  ++ +MP++F F 
Sbjct: 469 F-------------------VLPILMGASMWYLQKMSPTTITDPMQQKVMQFMPIIFTFM 509

Query: 531 LSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
              FPAGL +YW  SNVISI QQ +I +    +
Sbjct: 510 FLWFPAGLTLYWLVSNVISITQQTIIYRQLEKK 542


>gi|329114454|ref|ZP_08243216.1| Inner membrane protein OxaA [Acetobacter pomorum DM001]
 gi|326696530|gb|EGE48209.1| Inner membrane protein OxaA [Acetobacter pomorum DM001]
          Length = 594

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 172/581 (29%), Positives = 302/581 (51%), Gaps = 18/581 (3%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
             +    +A  LS ++++ +  F+   ++     +  +      P     +  A      
Sbjct: 12  MDSKRLILATLLSALVLFGYDYFFPQHQLVPPAQQGVHAVAPPAPASSGAAAPAENTQAE 71

Query: 62  AQAL---SMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
           A A        RV +  P++ G++NL+GA+ DDL L+ Y   V  +SP V +L+ ++T  
Sbjct: 72  AAAPVKDGPETRVAINAPAVQGTLNLRGARLDDLVLKHYRETVKPDSPDVRVLNSASTHA 131

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHY 178
            Y        +  ++ LP++NT+W   SG  +    P+ L + N   + F+  +S+D++Y
Sbjct: 132 DYVDFGWRAPSDVSVRLPDANTLWK-ASGTQMDAEHPLTLSWDNGQGLTFDIRLSVDQNY 190

Query: 179 LFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFI----AVLGDKSLVEQKY 234
           +F I   V N++   +   P  R+ R      T    V EG I      L + S    + 
Sbjct: 191 MFTISQQVHNSTGQAVALYPFYRVNRGYTPEETGGMLVHEGPISVIDGRLNEGSYKTVRT 250

Query: 235 SDIEKSSISNFHE-SNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANE 293
             +   +I+  H+ +  W GI+DKYW    +P +  +    + + +   A      +   
Sbjct: 251 GGVPPDNIAWSHQGTGGWAGITDKYWLMAVLPDQNANVIGTYGFQAAQGAYQVGFTATAP 310

Query: 294 ITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYF 353
           + +  G++ +T   +FAGAKE   +  YEKDL +P F   +D+GW  F+ +P+F ++ + 
Sbjct: 311 VQVAAGQTASTEAHVFAGAKEVRLLEQYEKDLHVPMFWKAVDFGWLSFLTRPVFFVLDWL 370

Query: 354 YNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQK 413
              +G+FG+A++  TV VK+ F PL  KQ   T     ++P++D +R + K   P  +Q+
Sbjct: 371 NEHLGSFGLALLTFTVIVKVAFLPLTIKQMRMTWKTARLKPQVDLIRSRLKD-DPMAMQQ 429

Query: 414 AMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNI 473
            ++ LY+  N+N   G  P+L+Q PVF+ +YK + +++EMRHAPF GW+KDL+A DPTN+
Sbjct: 430 QIMALYRQENVNLFGGFLPLLIQAPVFWCLYKDLYVTIEMRHAPFVGWVKDLSAPDPTNL 489

Query: 474 FTLFGILPFYL---PGFMHVGIWPIIMSLSMFIQMKM--SPPPADKGQAMILNWMPVVFV 528
           F LFG++PF       F+ +G WPI+   ++F+  K+  S    D  Q  ++ ++P++F 
Sbjct: 490 FNLFGLIPFDPTHITPFLALGAWPIMYGATLFLMQKVSSSSANMDPSQQKVMMFIPLLFT 549

Query: 529 FALSSFPAGLIIYWSWSNVISIVQQAVIMKMHG---AEIGL 566
           F ++  P GL+IY+ WSN+++ VQQ VI+       A+  L
Sbjct: 550 FFMARQPVGLVIYYCWSNILTAVQQVVIISRLKAADAKPQL 590


>gi|254490319|ref|ZP_05103508.1| 60Kd inner membrane protein [Methylophaga thiooxidans DMS010]
 gi|224464452|gb|EEF80712.1| 60Kd inner membrane protein [Methylophaga thiooxydans DMS010]
          Length = 546

 Score =  358 bits (918), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 145/572 (25%), Positives = 246/572 (43%), Gaps = 37/572 (6%)

Query: 1   MERNWNYFVA--IALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQ-------VDN 51
           M+    +F+   + +S+++  AWQN YV P+       +    T + P           +
Sbjct: 1   MDNLRTFFIFGLLIVSLLLWEAWQNDYVRPQQAADVASQTQTTTPQAPVSDELPDMPSAS 60

Query: 52  SYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLL 111
           + +   +    Q  + S +V +K   +   I  +G    DL L  Y +        V  L
Sbjct: 61  AESLPDVPQSQQVSASSGKVHVKTDVMDLHIATQGGDIRDLALLEYAVSSEQPDTPVQFL 120

Query: 112 SPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERT 171
           + S  +                   +          +       I L +++ + +   +T
Sbjct: 121 NDSAGQFFVTQSGLRADGDAPTHYEHYQAEQTEYVLQAGQDELKIPLYWQSESGLQVVKT 180

Query: 172 ISLD-EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLV 230
            +   + Y+  +   V NNS +     P  ++ R++    +       G +         
Sbjct: 181 YNFKRDSYVVNVDYQVINNSGETFSAYPYAQLNRNRSDDDSMFIYTYTGAVFSSKGNEYE 240

Query: 231 EQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFS 290
           +  + D++  + S       W  +   Y+ +  IP + +     F   S     Y A   
Sbjct: 241 KVDFDDLDDKAFSRSSID-GWAAMIQHYFVAAIIPPQASE-QLGFYGKSINGTNYTAGVR 298

Query: 291 ANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLM 350
              I+   G+   T   L+ G K+   +    ++       + +D+G    I++P+F +M
Sbjct: 299 MPAISASSGEQAATQYQLYLGPKKHERLDKVAEN-----LPLTVDYGILTIISEPLFWIM 353

Query: 351 SYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQV 410
            + + L GN+G +I+L TV +KL FF L+   Y S A M+ + PK+  L+E++     Q 
Sbjct: 354 EWLHKLTGNWGWSIILLTVLIKLAFFKLSATSYRSMAAMRKLTPKLATLKERYGDDK-QK 412

Query: 411 LQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADP 470
             +AM+ LY+T  INPL GC PIL+Q+PVF A Y V+  S+E+R A F  WI DL A DP
Sbjct: 413 FNQAMMDLYRTEKINPLGGCLPILVQMPVFLAFYWVLVESIELRQADFMLWINDLTAMDP 472

Query: 471 TNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFA 530
                                I P++  LSM+ Q K++P P D  QAM++   P+VF   
Sbjct: 473 YF-------------------ILPVLFGLSMWFQQKLNPAPQDPAQAMMMKIFPLVFTVF 513

Query: 531 LSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
            + FPAGL++YW  +NV+SI QQ  I +  GA
Sbjct: 514 FAFFPAGLVLYWVVNNVLSIAQQWYITRKMGA 545


>gi|258622952|ref|ZP_05717967.1| inner membrane protein, 60 kDa [Vibrio mimicus VM573]
 gi|258584735|gb|EEW09469.1| inner membrane protein, 60 kDa [Vibrio mimicus VM573]
          Length = 541

 Score =  358 bits (917), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 141/570 (24%), Positives = 247/570 (43%), Gaps = 41/570 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL+++    +Q + V         ++             +        +
Sbjct: 1   MDSQRN-ILLIALALVSFLLFQQWQVAKNPAPQATQQAQSTGAAPAPSFSDELDPTPAQN 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
              A + +  + + +  L  SI+  G       L  Y  ++ S+   V L +     + +
Sbjct: 60  ---AAAQAKTITVTSDVLTLSIDTLGGDIVSAKLNQYSEELDSSESFVLLQNTQG--HQF 114

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDE 176
            A+   V         N+   + + +             I + ++       +  I    
Sbjct: 115 IAQSGLVGPQGIDVTSNNRPAYQVSADSFSLAEGQDELRIPMTYQANGIDYTKTFILKRG 174

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYS 235
            Y   +V  V NNS +         + ++   +  N       G      D    +  + 
Sbjct: 175 SYAVDVVFDVANNSGNAATLGMYAHLRQNLLDSGGNLAMPTYRGGAYSTSDVRYKKYSFD 234

Query: 236 DIEKSSIS-NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
           D++  ++S     + +W+ +   Y+AS +IP  E       + +++              
Sbjct: 235 DMKDRNLSVPNDVTVNWVAMIQHYFASAWIPRDEPQAQLYSRVINNLGD---MGIRTPNK 291

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
           TI  G        L+ G K    +         P  ++++D+GW +FIAKP+  L+S+  
Sbjct: 292 TIANGDKAEFEATLWVGPKLQDQMAAVA-----PNLDLVVDYGWLWFIAKPLHWLLSFIQ 346

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
           + VGN+G+AI+  T  V+   +PL K QY S A M+ +QPK+  +RE+      Q + + 
Sbjct: 347 SFVGNWGVAIICLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLQAMRERIGD-DRQRMSQE 405

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           M++LYK   +NPL GC PILLQ+P+F A+Y  +  S+E+RH+PF+GWI DL+A DP    
Sbjct: 406 MMELYKKEKVNPLGGCLPILLQMPIFIALYWALMESVELRHSPFFGWIHDLSAQDPYY-- 463

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSS 533
                            I P++M  SMF+  KMSP    D  Q  I+ +MPV+F F    
Sbjct: 464 -----------------ILPLLMGASMFVIQKMSPTTITDPMQQKIMTFMPVMFTFFFLW 506

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           FP+GL++YW  SN+++++QQ +I K    +
Sbjct: 507 FPSGLVLYWLVSNIVTLIQQTLIYKALEKK 536


>gi|117617478|ref|YP_858698.1| membrane protein OxaA [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|166975847|sp|A0KQZ7|OXAA_AERHH RecName: Full=Inner membrane protein oxaA
 gi|117558885|gb|ABK35833.1| membrane protein OxaA [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
          Length = 548

 Score =  358 bits (917), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 137/573 (23%), Positives = 245/573 (42%), Gaps = 41/573 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           ME   N  + I L  +    WQ +                QT     +   +     + +
Sbjct: 1   MESQRNLIL-IGLLFVSFLLWQQW--ESDKAPKPAPTTVAQTEHFVPEAGQTGDIPQVSE 57

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           +A A +    + + +  L  +++ +G      +L  + L+   + P V L   S  ++ Y
Sbjct: 58  QANANTARKLITVSSDVLKLTLDTQGGDIVSADLLAHKLEEGKDQPFVLL--TSQPEHLY 115

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLD- 175
            A+   V              +                 + + + ++  ++F +   L  
Sbjct: 116 VAQSGLVGRNGPDSQAQGRPTYEAAQTSYQLADGQDQVVVPMTWTDSKGVVFTKEFVLKR 175

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
             Y   +   + N S + ++    G++ +                    G  S  + +Y 
Sbjct: 176 GDYAVGVDYKIDNKSAEPVQVQFYGQLKQTVTTPKDQQGHAMVASAYRGGAFSSEDTRYK 235

Query: 236 DIEKSSISNFHESN----SWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSA 291
                 + +   +      W+ +   Y+ S + P+ +   +S +  +  G  +    + A
Sbjct: 236 KYTFDEMKDADLNKTTKGGWVAMLQHYFVSAWAPNAD-DTNSFYSRVIPGKDQAIIGYKA 294

Query: 292 NEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMS 351
             + +  G+    T+ L+ G K    +            ++ +D+GW +FIA+P+  L++
Sbjct: 295 PLVDVAAGQQAEVTSKLWVGPKLQDQMAKVAN-----HLDLTVDYGWLWFIAQPLHWLLT 349

Query: 352 YFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVL 411
            F+  V N+G+AI++ T+ V+ + FPL K QY S A M+ +QPK+  LRE+F     Q +
Sbjct: 350 VFHGFVQNWGVAIIMLTLLVRGIMFPLTKAQYTSMAKMRMLQPKLAALRERFGD-DRQKM 408

Query: 412 QKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPT 471
            + M++LYK   +NPL GC PIL+Q+P+F A+Y  +  S+E+RHAPF  WI DL+  DP 
Sbjct: 409 SQGMMELYKKEKVNPLGGCLPILVQMPIFIALYWALMESVELRHAPFALWITDLSVKDPF 468

Query: 472 NIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFA 530
                               + PI+M  SM+   KMSP    D  Q  ++ +MP++F F 
Sbjct: 469 F-------------------VLPILMGASMWYLQKMSPTTITDPMQQKVMQFMPIIFTFM 509

Query: 531 LSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
              FPAGL +YW  SNVISI QQ +I +    +
Sbjct: 510 FLWFPAGLTLYWLVSNVISITQQTIIYRQLEKK 542


>gi|145640676|ref|ZP_01796259.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae R3021]
 gi|145274602|gb|EDK14465.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae 22.4-21]
          Length = 541

 Score =  358 bits (917), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 142/567 (25%), Positives = 255/567 (44%), Gaps = 38/567 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
             +    + +AL  I    +Q + +         +  +I           S +  + D +
Sbjct: 1   MDSRRSLLVLALIFISFLVYQQWQLDKNPPVQTEQTTSITATSDVPASSPSNSQAIADSQ 60

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
               +    + L+N      I+  G       L  Y  ++ S +P   L      ++ Y 
Sbjct: 61  ----TRGRIITLENDVFRLKIDTLGGDVISSELLKYDAELDSKTPFELL--KDTKEHIYI 114

Query: 122 AELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDEH 177
           A+   +   N I+  +    + +            +  + L+F+       +  +     
Sbjct: 115 AQSGLIG-KNGIDTRSGRAQYQIEGDNFKLAEGQESLSVPLLFEKDGVTYQKIFVLKRGS 173

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           Y   +   + N S   I   P G++     +++ N         A    ++  ++     
Sbjct: 174 YDLGVDYKIDNQSGQAIEVEPYGQLKHSIVESSGNVAMPTYTGGAYSSSETNYKKYSFAD 233

Query: 238 EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITIL 297
            + +  +      W+ +   Y+ S +IP+++ +    +      +      +    +TI 
Sbjct: 234 MQDNNLSIGTKAGWVAVLQHYFVSAWIPNQDVNNQL-YTITDSKNNVASIGYRGPVVTIP 292

Query: 298 PGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLV 357
            G   T T+ L+ G K    +     +      ++ +D+GW +FIAKP+F L+++   +V
Sbjct: 293 SGSQETITSSLWTGPKLQNQMATVANN-----LDLTVDYGWAWFIAKPLFWLLTFIQGIV 347

Query: 358 GNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQ 417
            N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++
Sbjct: 348 SNWGLAIICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGD-DRQRMSQEMMK 406

Query: 418 LYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLF 477
           LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A DP       
Sbjct: 407 LYKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQDPYY----- 461

Query: 478 GILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPA 536
                         I PI+M +SMF+  KMSP P  D  Q  ++N+MP+VF+F    FP+
Sbjct: 462 --------------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLVFMFFFLWFPS 507

Query: 537 GLIIYWSWSNVISIVQQAVIMKMHGAE 563
           GL++YW  SN+I+I QQ +I +    +
Sbjct: 508 GLVLYWLVSNLITIAQQQLIYRGLEKK 534


>gi|77461960|ref|YP_351467.1| putative inner membrane protein translocase component YidC
           [Pseudomonas fluorescens Pf0-1]
 gi|123602665|sp|Q3K428|OXAA_PSEPF RecName: Full=Inner membrane protein oxaA
 gi|77385963|gb|ABA77476.1| putative inner membrane protein [Pseudomonas fluorescens Pf0-1]
          Length = 560

 Score =  358 bits (917), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 149/583 (25%), Positives = 245/583 (42%), Gaps = 51/583 (8%)

Query: 1   MERNWNYFVAIAL---SVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           M+      + +AL   S ++V  W   Y    +   N       +        N+ AA  
Sbjct: 1   MDI-KRTILIVALAIVSYVMVLKWNQDYGQAALPTQNVASSTTTSGLPDTATGNNAAASD 59

Query: 58  IDDRAQALSMSP----------RVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPI 107
              RA + + +P           +++K   L  SI+ +G     L L  Y          
Sbjct: 60  DIPRAASDTSAPAETPVAASKDLIQIKTDVLDLSIDPQGGDVAQLTLPLYPRRQDRPDVP 119

Query: 108 VTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKL----VFKNA 163
             L   +  +  Y A+   + T      P    +++             KL     F   
Sbjct: 120 FQLF-DNGGERTYLAQSGLIGTNGPDANPAGRPIYSSEKKTYQLADGQDKLVVDLKFSKD 178

Query: 164 NNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT----ATNTFGVQEG 219
                +R       Y   +   + N S      S   ++ R                  G
Sbjct: 179 GVNYIKRFTLKRGLYDVTVTYLIDNQSAQPWSGSMFAQLKRDASADPSSTTATGTATYLG 238

Query: 220 FIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLS 279
                  +   +    D++K+ +     +  W+     Y+ + ++  K  +   Q +  S
Sbjct: 239 AALWTSSEPYKKVSMKDMDKAQLKET-VTGGWVAWLQHYFVTAWVAPKGENNIVQTRKDS 297

Query: 280 DGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWF 339
            G   Y   ++   +T  PG  + T+  L+AG K    +         P  E+ +D+G  
Sbjct: 298 KG--NYIIGYTGPSLTAAPGAKVETSAVLYAGPKSQAVLKELS-----PGLELTVDYGIL 350

Query: 340 YFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDEL 399
           +FIA+P+F L+ + +++VGN+G +I+  T+ +K +FFPL+   Y S A M+ + PK+  L
Sbjct: 351 WFIAQPIFWLLQHIHSIVGNWGWSIIFLTMLIKGIFFPLSAASYKSMARMRAVAPKLAAL 410

Query: 400 REKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFW 459
           +E+      Q + +AM++LYK   INPL GC PIL+Q+PVF ++Y V+  S+EMR APF 
Sbjct: 411 KEQHGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLSLYWVLLESVEMRQAPFM 469

Query: 460 GWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMI 519
            WI DL+  DP                     I PIIM  +MFIQ +++P P D  QA +
Sbjct: 470 LWITDLSIKDPFF-------------------ILPIIMGATMFIQQRLNPTPPDPMQAKV 510

Query: 520 LNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           +  MP++F F    FPAGL++YW  +N +SI QQ  I +   A
Sbjct: 511 MKMMPIIFTFFFLWFPAGLVLYWVVNNCLSIAQQWYITRKIEA 553


>gi|16272937|ref|NP_439163.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae Rd KW20]
 gi|260580091|ref|ZP_05847921.1| membrane protein insertase, YidC/Oxa1 family domain [Haemophilus
           influenzae RdAW]
 gi|1168226|sp|P44973|OXAA_HAEIN RecName: Full=Inner membrane protein oxaA
 gi|1574032|gb|AAC22663.1| inner membrane protein, 60 kDa (yidC) [Haemophilus influenzae Rd
           KW20]
 gi|260093375|gb|EEW77308.1| membrane protein insertase, YidC/Oxa1 family domain [Haemophilus
           influenzae RdAW]
          Length = 541

 Score =  358 bits (917), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 142/567 (25%), Positives = 256/567 (45%), Gaps = 38/567 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
             +    + +AL  I    +Q + +         +  +I           S +  + D +
Sbjct: 1   MDSRRSLLVLALIFISFLVYQQWQLDKNPPVQTEQTTSITATSDVPASSPSNSQAIADSQ 60

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
               +    + L+N      I+  G       L  Y  ++ S +P   L      ++ Y 
Sbjct: 61  ----TRGRIITLENDVFRLKIDTLGGDVISSELLKYDAELDSKTPFELL--KDTKEHIYI 114

Query: 122 AELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDEH 177
           A+   +   N I+  +    + +            +  + L+F+       +  +     
Sbjct: 115 AQSGLIG-KNGIDTRSGRAQYQIEGDNFKLAEGQESLSVPLLFEKDGVTYQKIFVLKRGS 173

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           Y   +   + N S   I   P G++     +++ N         A    ++  ++     
Sbjct: 174 YDLGVDYKIDNQSGQAIEVEPYGQLKHSIVESSGNVAMPTYTGGAYSSSETNYKKYSFSD 233

Query: 238 EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITIL 297
            + +  +      W+ +   Y+ S +IP+++ +    +      +      +  + +TI 
Sbjct: 234 MQDNNLSIDTKAGWVAVLQHYFVSAWIPNQDVNNQL-YTITDSKNNVASIGYRGSVVTIP 292

Query: 298 PGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLV 357
            G   T T+ L+ G K    +     +      ++ +D+GW +FIAKP+F L+++   +V
Sbjct: 293 AGSQETITSSLWTGPKLQNQMATVANN-----LDLTVDYGWAWFIAKPLFWLLTFIQGIV 347

Query: 358 GNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQ 417
            N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++
Sbjct: 348 SNWGLAIICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGD-DRQRMSQEMMK 406

Query: 418 LYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLF 477
           LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A DP       
Sbjct: 407 LYKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQDPYY----- 461

Query: 478 GILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPA 536
                         I PI+M +SMF+  KMSP P  D  Q  ++N+MP+VF+F    FP+
Sbjct: 462 --------------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLVFMFFFLWFPS 507

Query: 537 GLIIYWSWSNVISIVQQAVIMKMHGAE 563
           GL++YW  SN+I+I QQ +I +    +
Sbjct: 508 GLVLYWLVSNLITIAQQQLIYRGLEKK 534


>gi|59710610|ref|YP_203386.1| putative inner membrane protein translocase component YidC [Vibrio
           fischeri ES114]
 gi|59478711|gb|AAW84498.1| cytoplasmic insertase into membrane protein, Sec system [Vibrio
           fischeri ES114]
          Length = 541

 Score =  358 bits (917), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 138/571 (24%), Positives = 240/571 (42%), Gaps = 43/571 (7%)

Query: 1   MERNWN-YFVAIAL-SVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           M+   N   +A+AL S ++   WQ      +   ++  ++       P     + +    
Sbjct: 1   MDTQRNILLLALALVSFLLFQQWQVETNPQQPATVSTVQQTQTDGDVP-----TSSTANS 55

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
           D  A +      + +    L   ++  G    +  L  Y  ++ S +  V L   ++  +
Sbjct: 56  DTPADSAQSDKLITITTDVLTLKVDTLGGDIIESVLNKYDAELGSKAKFVLL--KNDATH 113

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGK---ILTPTTPIKLVFKNANNILFERTISLD 175
           +Y A+   +                  +            + L          +  I   
Sbjct: 114 SYVAQSGLIGPQGIDSNSGRAQFTAQKTDYVLAEGQNELRVPLTLVKDGITYTKTLILKR 173

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKY 234
           + Y   +  TV N S           + ++      + T     G      D    +  +
Sbjct: 174 DSYAIDVDYTVDNQSSAPATVEMYTNLKQNLMDDGGSLTMPTYRGAAYSTEDTRYKKYSF 233

Query: 235 SDIEKSSISNFHES-NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANE 293
            D+E  ++S    +   W G+   Y+AS +IP          +   D             
Sbjct: 234 DDMEDKNLSIDMTNGQGWAGMLQHYFASAWIPRNVNDAKLTSRVAGD---YGYIGVRMPS 290

Query: 294 ITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYF 353
           +TI  G+  T +  L+ G K    +         P  ++ +D+GW +FIA P+  L+S+ 
Sbjct: 291 VTIPAGQEATLSATLWTGPKLQKEMAATA-----PYLDLTVDYGWLWFIASPLHKLLSFI 345

Query: 354 YNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQK 413
             +V N+G+AI++ T  V+   +PL K QY S A M+ +QPK+  +RE+      Q + +
Sbjct: 346 QGIVVNWGLAIIVLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLTAMRERIGD-DRQRMSQ 404

Query: 414 AMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNI 473
            M++LYK   +NPL GC PILLQ+P+F ++Y  +  S+E+RH PF+GWI DL+A DP   
Sbjct: 405 EMMELYKKEKVNPLGGCLPILLQMPIFISLYWALMESVELRHTPFFGWITDLSAQDPYY- 463

Query: 474 FTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALS 532
                             I P++M  SMF+  KMSP    D  Q  I+ +MPV+F     
Sbjct: 464 ------------------ILPLLMGASMFLIQKMSPTTVTDPMQQKIMTFMPVMFTVFFL 505

Query: 533 SFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
            FP+GL++YW  SN+++++QQ +I +    +
Sbjct: 506 WFPSGLVLYWLVSNIVTLIQQTLIYRALEKK 536


>gi|309973500|gb|ADO96701.1| Inner membrane translocation protein YidC [Haemophilus influenzae
           R2846]
          Length = 541

 Score =  358 bits (917), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 142/567 (25%), Positives = 254/567 (44%), Gaps = 38/567 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
             +    + +AL  I    +Q + +         +  +I           S +  + D +
Sbjct: 1   MDSRRSLLVLALIFISFLVYQQWQLDKNPPVQTEQTTSITATSDVPASSPSNSQAIADSQ 60

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
               +    + L+N      I+  G       L  Y  ++ S +P   L      ++ Y 
Sbjct: 61  ----TRGRIITLENDVFRLKIDTLGGDVISSELLKYDAELDSKTPFELL--KDTKEHIYI 114

Query: 122 AELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDEH 177
           A+   +   N I+  +    + +            +  + L+F+       +  +     
Sbjct: 115 AQSGLIG-KNGIDTRSGRAQYQIEGDNFKLAEGQESLSVPLLFEKDGVTYQKIFVLKRGS 173

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           Y   +   + N S   I   P G++     +++ N         A     +  ++     
Sbjct: 174 YDLGVDYKIDNQSGQAIEVEPYGQLKHSIVESSGNVAMPTYTGGAYSSSDTNYKKYSFAD 233

Query: 238 EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITIL 297
            + +  +      W+ +   Y+ S +IP+++ +    +      +      +    +TI 
Sbjct: 234 MQDNNLSIDTKAGWVAVLQHYFVSAWIPNQDVNNQL-YTITDSKNNVASIGYRGPVVTIP 292

Query: 298 PGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLV 357
            G   T T+ L+ G K    +     +      ++ +D+GW +FIAKP+F L+++   +V
Sbjct: 293 SGSQETITSSLWTGPKLQNQMATVANN-----LDLTVDYGWAWFIAKPLFWLLTFIQGIV 347

Query: 358 GNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQ 417
            N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++
Sbjct: 348 SNWGLAIICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGD-DRQRMSQEMMK 406

Query: 418 LYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLF 477
           LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A DP       
Sbjct: 407 LYKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQDPYY----- 461

Query: 478 GILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPA 536
                         I PI+M +SMF+  KMSP P  D  Q  ++N+MP+VF+F    FP+
Sbjct: 462 --------------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLVFMFFFLWFPS 507

Query: 537 GLIIYWSWSNVISIVQQAVIMKMHGAE 563
           GL++YW  SN+I+I QQ +I +    +
Sbjct: 508 GLVLYWLVSNLITIAQQQLIYRGLEKK 534


>gi|313202488|ref|YP_004041146.1| 60 kda inner membrane insertion protein [Methylovorus sp. MP688]
 gi|312441804|gb|ADQ85910.1| 60 kDa inner membrane insertion protein [Methylovorus sp. MP688]
          Length = 549

 Score =  358 bits (917), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 147/573 (25%), Positives = 251/573 (43%), Gaps = 34/573 (5%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYV--YPRIEEMNNERKNIQTVKQPNQVDNSYAAV-LI 58
                  + +  S  I+  W  +     P  E +  E     +V    ++  + AA  + 
Sbjct: 1   MDTKRLILFVIFSFSILMLWDAWQREHTPPPETVTAEAATDNSVPHAEKLPGAKAAADMP 60

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
            +    L  + R++++       I+  G     L L  +  D S+    V LL       
Sbjct: 61  KESGFRLQTADRIQVETDVYKAVIDTTGGDLRRLELLKHRADNSTTENFV-LLDDRAAPM 119

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD-EH 177
            Y A+   +               +       + T  ++L   +A+ +  ++  +   + 
Sbjct: 120 VYVAQSGLIGQGLPNHKTVFTAEASNYQLAAGSDTLEVRLTAASADGVKVDKIYTFHRDS 179

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
           Y+  +   + N S   I  +   +++   +    ++      G           +  + D
Sbjct: 180 YVINLRYEIHNESASPIDPTVYYQVVHDTESNQGSHMMPTFTGGAYFTQADKFKKLSFKD 239

Query: 237 IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITI 296
           + K+ +S    S+ W+G+   Y+ S +IP +      QF         Y     ++   I
Sbjct: 240 MGKNDLSKT-TSDGWVGLLQHYFVSAWIPKEG--VTRQFYSKKLADNIYSIGTKSDIGVI 296

Query: 297 LPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNL 356
            PG S       +AG +    +         P  E  +D+GW   IA P+F ++S   ++
Sbjct: 297 APGASAEVEARYYAGPQNQEVMKQVA-----PGLEYTVDYGWLTIIASPLFWILSKIESV 351

Query: 357 VGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMI 416
           V N+G+AI+L TV +KL F+PL+   Y S A+M+ + P++  L+E++     Q +Q AM+
Sbjct: 352 VHNWGVAIILLTVMIKLAFYPLSAASYRSMAHMRELAPRLQRLKEQYGD-DRQKMQVAMM 410

Query: 417 QLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTL 476
           +LYKT  INP+ GC PIL+QIPVF ++Y V+  S+EMRHAPF  WI DL+A DP      
Sbjct: 411 ELYKTEKINPMGGCLPILVQIPVFISLYWVLLGSVEMRHAPFMLWIHDLSAIDPYY---- 466

Query: 477 FGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPA 536
                          + PI+M  +M IQ +++P P D  QA ++  MP+VF      FPA
Sbjct: 467 ---------------VLPILMGATMIIQTRLNPTPTDPVQAKVMMIMPIVFSVFFFFFPA 511

Query: 537 GLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDR 569
           GL++YW  +NV+SI QQ  I +       L  +
Sbjct: 512 GLVLYWLVNNVLSIAQQWHINRSTERATALKKK 544


>gi|68249585|ref|YP_248697.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae 86-028NP]
 gi|229843940|ref|ZP_04464081.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae 6P18H1]
 gi|81335986|sp|Q4QLR0|OXAA_HAEI8 RecName: Full=Inner membrane protein oxaA
 gi|68057784|gb|AAX88037.1| preprotein translocase subunit YidC [Haemophilus influenzae
           86-028NP]
 gi|229812934|gb|EEP48622.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae 6P18H1]
          Length = 541

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 142/567 (25%), Positives = 255/567 (44%), Gaps = 38/567 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
             +    + +AL  I    +Q + +         +  +I           S +  + D +
Sbjct: 1   MDSRRSLLVLALIFISFLVYQQWQLDKNPPVQTEQTTSITATSDVPASSPSNSQAIADSQ 60

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
               +    + L+N      I+  G       L  Y  ++ S +P   L      ++ Y 
Sbjct: 61  ----TRGRIITLENDVFRLKIDTLGGDVISSELLKYDAELDSKTPFELL--KDTKEHIYI 114

Query: 122 AELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDEH 177
           A+   +   N I+  +    + +            +  + L+F+       +  +     
Sbjct: 115 AQSGLIG-KNGIDTRSGRAQYQIEGDNFKLAEGQESLSVPLLFEKDGVTYQKIFVLKRGS 173

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           Y   +   + N S   I   P G++     +++ N         A    ++  ++     
Sbjct: 174 YDLGVDYKIDNQSGQAIEVEPYGQLKHSIIESSGNVAMPTYTGGAYSSSETNYKKYSFAD 233

Query: 238 EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITIL 297
            + +  +      W+ +   Y+ S +IP+++ +    +      +      +    +TI 
Sbjct: 234 MQDNNLSIDTKAGWVAVLQHYFVSAWIPNQDVNNQL-YTITDSKNNVASIGYRGPVVTIP 292

Query: 298 PGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLV 357
            G   T T+ L+ G K    +     +      ++ +D+GW +FIAKP+F L+++   +V
Sbjct: 293 AGSQETITSSLWTGPKLQNQMATVANN-----LDLTVDYGWAWFIAKPLFWLLTFIQGIV 347

Query: 358 GNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQ 417
            N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++
Sbjct: 348 SNWGLAIICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGD-DRQRMSQEMMK 406

Query: 418 LYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLF 477
           LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A DP       
Sbjct: 407 LYKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQDPYY----- 461

Query: 478 GILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPA 536
                         I PI+M +SMF+  KMSP P  D  Q  ++N+MP+VF+F    FP+
Sbjct: 462 --------------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLVFMFFFLWFPS 507

Query: 537 GLIIYWSWSNVISIVQQAVIMKMHGAE 563
           GL++YW  SN+I+I QQ +I +    +
Sbjct: 508 GLVLYWLVSNLITIAQQQLIYRGLEKK 534


>gi|319897488|ref|YP_004135685.1| inner membrane protein oxaa [Haemophilus influenzae F3031]
 gi|317432994|emb|CBY81365.1| Inner membrane protein oxaA [Haemophilus influenzae F3031]
          Length = 541

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 142/567 (25%), Positives = 256/567 (45%), Gaps = 38/567 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
             +    + +AL  I    +Q + +         +  +I           S +  + D +
Sbjct: 1   MDSRRSLLVLALIFISFLVYQQWQLDKNPPVQTEQTTSITATSDVPASSPSNSQAIADSQ 60

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
               +    + L+N      I+  G       L  Y  +++S +P   L      ++ Y 
Sbjct: 61  ----TRGRIITLENDVFRLKIDTLGGDVISSELLKYDAELNSKTPFELL--KDTKEHIYI 114

Query: 122 AELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDEH 177
           A+   +   N I+  +    + +            +  + L+F+       +  +     
Sbjct: 115 AQSGLIG-KNGIDTRSGRAQYQVEGDNFKLAEGQESLSVPLLFEKDGVTYQKIFVLKRGS 173

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           Y   +   + N S   I   P G++     +++ N         A    ++  ++     
Sbjct: 174 YDLGVDYKIDNQSGQAIEVEPYGQLKHSIVESSGNVAMPTYTGGAYSSSETNYKKYSFSD 233

Query: 238 EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITIL 297
            + +  +      W+ +   Y+ S +IP+++ +    +      +      +    +TI 
Sbjct: 234 MQDNNLSIDTKAGWVAVLQHYFVSAWIPNQDVNNQL-YTITDSKNNVASIGYRGPVVTIP 292

Query: 298 PGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLV 357
            G   T T+ L+ G K    +     +      ++ +D+GW +FIAKP+F L+++   +V
Sbjct: 293 AGSQETITSSLWTGPKLQNQMATVANN-----LDLTVDYGWAWFIAKPLFWLLTFIQGIV 347

Query: 358 GNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQ 417
            N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++
Sbjct: 348 SNWGLAIICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGD-DRQRMSQEMMK 406

Query: 418 LYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLF 477
           LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A DP       
Sbjct: 407 LYKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQDPYY----- 461

Query: 478 GILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPA 536
                         I PI+M +SMF+  KMSP P  D  Q  ++N+MP+VF+F    FP+
Sbjct: 462 --------------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLVFMFFFLWFPS 507

Query: 537 GLIIYWSWSNVISIVQQAVIMKMHGAE 563
           GL++YW  SN+I+I QQ +I +    +
Sbjct: 508 GLVLYWLVSNLITIAQQQLIYRGLEKK 534


>gi|261213269|ref|ZP_05927551.1| OxaI/YidC membrane insertion protein [Vibrio sp. RC341]
 gi|260837543|gb|EEX64246.1| OxaI/YidC membrane insertion protein [Vibrio sp. RC341]
          Length = 541

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 141/570 (24%), Positives = 244/570 (42%), Gaps = 41/570 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL+++    +Q + V         ++             +        +
Sbjct: 1   MDSQRN-ILLIALALVSFLLFQQWQVAKNPAPQATQQAQSTGAADAPSFSDELDPTPAQN 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
              A + +  + + +  L  SI+  G       L  Y  ++ S    V L +     + +
Sbjct: 60  ---AAAQAKTITVTSDVLTLSIDTLGGDIVSAKLNQYAEELDSAESFVLLQNTQG--HQF 114

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDE 176
            A+   V         N+   + + +             I + ++       +  I    
Sbjct: 115 IAQSGLVGPQGIDVTSNNRPAYQVNAESFTLAEGQDELRIPMTYQANGIDYTKTFILKRG 174

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYS 235
            Y   +V  V NNS +         + ++   +  N       G      D    +  + 
Sbjct: 175 SYAVDVVFDVANNSGNPATLGMYAHLRQNLLDSGGNLAMPTYRGGAYSTSDVRYKKYSFD 234

Query: 236 DIEKSSIS-NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
           D++  ++S     + +W  +   Y+AS +IP  E       + +S+              
Sbjct: 235 DMKDRNLSAPNDVTVNWAAMIQHYFASAWIPRNEPQAQLYSRVISNLGD---IGIRTPNK 291

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
           TI  G        L+ G K    +         P  ++++D+GW +FIAKP+  L+S   
Sbjct: 292 TIANGDKAEFEATLWVGPKLQDKMAAVA-----PNLDLVVDYGWLWFIAKPLHWLLSVIQ 346

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
           + VGN+G+AI+  T  V+   +PL K QY S A M+ +QPK+  +RE+      Q + + 
Sbjct: 347 SFVGNWGVAIICLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLQAMRERIGD-DRQRMSQE 405

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           M++LYK   +NPL GC PI+LQ+P+F A+Y  +  S+E+RH+PF+GWI DL+A DP    
Sbjct: 406 MMELYKKEKVNPLGGCLPIVLQMPIFIALYWALMESVELRHSPFFGWIHDLSAQDPYY-- 463

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSS 533
                            I P++M  SMF+  KMSP    D  Q  I+ +MPV+F F    
Sbjct: 464 -----------------ILPLLMGASMFVIQKMSPTTVTDPMQQKIMTFMPVMFTFFFLW 506

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           FP+GL++YW  SN+++++QQ +I K    +
Sbjct: 507 FPSGLVLYWLVSNIVTLIQQTLIYKALEKK 536


>gi|229846058|ref|ZP_04466170.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae 7P49H1]
 gi|229811062|gb|EEP46779.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae 7P49H1]
          Length = 541

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 142/567 (25%), Positives = 254/567 (44%), Gaps = 38/567 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
             +    + +AL  I    +Q + +         +  +I           S +  + D +
Sbjct: 1   MDSRRSLLVLALIFISFLVYQQWQLDKNPPVQTEQTTSITATSDVPASSPSNSQAIADSQ 60

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
               +    + L+N      I+  G       L  Y  ++ S +P   L      ++ Y 
Sbjct: 61  ----TRGRIITLENDVFRLKIDTLGGDVISSELLKYDAELDSKTPFELL--KDTKEHIYI 114

Query: 122 AELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDEH 177
           A+   +   N I+  +    + +            +  + L+F+       +  +     
Sbjct: 115 AQSGLIG-KNGIDTRSGRAQYQIEGDNFKLAEGQESLSVPLLFEKDGVTYQKIFVLKRGS 173

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           Y   +   + N S   I   P G++     +++ N         A     +  ++     
Sbjct: 174 YDLGVDYKIDNQSGQAIEVEPYGQLKHSIIESSGNVAMPTYTGGAYSSSDTNYKKYSFAD 233

Query: 238 EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITIL 297
            + +  +      W+ +   Y+ S +IP+++ +    +      +      +    +TI 
Sbjct: 234 MQDNNLSIDTKAGWVAVLQHYFVSAWIPNQDVNNQL-YTITDSKNNVASIGYRGPVVTIP 292

Query: 298 PGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLV 357
            G   T T+ L+ G K    +     +      ++ +D+GW +FIAKP+F L+++   +V
Sbjct: 293 AGSQETITSSLWTGPKLQNQMATVANN-----LDLTVDYGWAWFIAKPLFWLLTFIQGIV 347

Query: 358 GNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQ 417
            N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++
Sbjct: 348 SNWGLAIICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGD-DRQRMSQEMMK 406

Query: 418 LYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLF 477
           LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A DP       
Sbjct: 407 LYKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQDPYY----- 461

Query: 478 GILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPA 536
                         I PI+M +SMF+  KMSP P  D  Q  ++N+MP+VF+F    FP+
Sbjct: 462 --------------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLVFMFFFLWFPS 507

Query: 537 GLIIYWSWSNVISIVQQAVIMKMHGAE 563
           GL++YW  SN+I+I QQ +I +    +
Sbjct: 508 GLVLYWLVSNLITIAQQQLIYRGLEKK 534


>gi|329123023|ref|ZP_08251594.1| YidC/Oxa1 family membrane protein insertase [Haemophilus aegyptius
           ATCC 11116]
 gi|327471954|gb|EGF17394.1| YidC/Oxa1 family membrane protein insertase [Haemophilus aegyptius
           ATCC 11116]
          Length = 541

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 143/567 (25%), Positives = 255/567 (44%), Gaps = 38/567 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
             +    + +AL  I    +Q + +         +  +I           S +  + D +
Sbjct: 1   MDSRRSLLVLALIFISFLVYQQWQLDKNPPVQTEQTTSITATSDVPASSPSNSQAIADSQ 60

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
               +    + L+N      I+  G       L  Y  +++S +P   L      ++ Y 
Sbjct: 61  ----TRGRIITLENDVFRLKIDTLGGDVISSELLKYDAELNSKTPFELL--KDTKEHIYI 114

Query: 122 AELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDEH 177
           A+   +   N I+  +    + +            +  + L+F+       +  +     
Sbjct: 115 AQSGLIG-KNGIDTRSGRAQYQIEGDNFKLAEGQESLSVPLLFEKDGVTYQKIFVLKRGS 173

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           Y   +   + N S   I   P G++     + + N         A    ++  ++     
Sbjct: 174 YDLGVDYKIDNQSGQAIEVEPYGQLKHSIVENSGNVAMPTYTGGAYSSSETNYKKYSFSD 233

Query: 238 EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITIL 297
            + +  +      W+ +   Y+ S +IP+++ +    +      +      +    +TI 
Sbjct: 234 MQDNNLSIDTKAGWVAVLQHYFVSAWIPNQDVNNQL-YTITDSKNNVASIGYRGPVVTIP 292

Query: 298 PGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLV 357
            G   T T+ L+ G K    +     +      ++ +D+GW +FIAKP+F L+++   +V
Sbjct: 293 AGSQETITSSLWIGPKLQNQMATVANN-----LDLTVDYGWAWFIAKPLFWLLTFIQGIV 347

Query: 358 GNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQ 417
            N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++
Sbjct: 348 SNWGLAIICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGD-DRQRMSQEMMK 406

Query: 418 LYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLF 477
           LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A DP       
Sbjct: 407 LYKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQDPYY----- 461

Query: 478 GILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPA 536
                         I PI+M +SMF+  KMSP P  D  Q  ++N+MP+VF+F    FPA
Sbjct: 462 --------------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLVFMFFFLWFPA 507

Query: 537 GLIIYWSWSNVISIVQQAVIMKMHGAE 563
           GL++YW  SN+I+I QQ +I +    +
Sbjct: 508 GLVLYWLVSNLITIAQQQLIYRGLEKK 534


>gi|145634176|ref|ZP_01789887.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae PittAA]
 gi|148826353|ref|YP_001291106.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae PittEE]
 gi|166975868|sp|A5UD72|OXAA_HAEIE RecName: Full=Inner membrane protein oxaA
 gi|145268620|gb|EDK08613.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae PittAA]
 gi|148716513|gb|ABQ98723.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae PittEE]
          Length = 541

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 140/567 (24%), Positives = 254/567 (44%), Gaps = 38/567 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
             +    + +AL  I    +Q + +         +  +I           S +  + D +
Sbjct: 1   MDSRRSLLVLALIFISFLVYQQWQLDKNPPVQTEQTTSITATSDVPASSPSNSQAIADSQ 60

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
               +    + L+N      I+  G       L  Y  ++ S +P   L      ++ Y 
Sbjct: 61  ----TRGRIITLENDVFRLKIDTLGGDVISSELLKYDAELDSKTPFELL--KDTKEHIYI 114

Query: 122 AELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDEH 177
           A+   +   N I+  +    + +            +  + L+F+       +  +     
Sbjct: 115 AQSGLIG-KNGIDTRSGRAQYQIEGDNFKLAEGQESLSVPLLFEKDGVTYQKIFVLKRGS 173

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           Y   +   + N S   I   P G++     +++ N         A    ++  ++     
Sbjct: 174 YDLGVDYKIDNQSGQAIEVEPYGQLKHSIVESSGNVAMPTYTGGAYSSSETNYKKYSFAD 233

Query: 238 EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITIL 297
            + +  +      W+ +   Y+ S +IP+++ +    +      +      +    +TI 
Sbjct: 234 MQDNNLSIDTKAGWVAVLQHYFVSAWIPNQDVNNQL-YTITDSKNNVASIGYRGPVVTIP 292

Query: 298 PGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLV 357
            G   T T+ L+ G K    +     +      ++ +D+GW +FIAKP+F L+++   +V
Sbjct: 293 AGSQETITSSLWTGPKLQNQMATVANN-----LDLTVDYGWAWFIAKPLFWLLTFIQGIV 347

Query: 358 GNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQ 417
            N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++
Sbjct: 348 SNWGLAIICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGD-DRQRMSQEMMK 406

Query: 418 LYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLF 477
           LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A DP       
Sbjct: 407 LYKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQDPYY----- 461

Query: 478 GILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPA 536
                         I PI+M +SMF+  KMSP P  D  Q  ++N+MP++F+     FP+
Sbjct: 462 --------------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLIFMVFFLWFPS 507

Query: 537 GLIIYWSWSNVISIVQQAVIMKMHGAE 563
           GL++YW  SN+I+I QQ +I +    +
Sbjct: 508 GLVLYWLVSNLITIAQQQLIYRGLEKK 534


>gi|145637306|ref|ZP_01792967.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae PittHH]
 gi|145269558|gb|EDK09500.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae PittHH]
          Length = 541

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 142/567 (25%), Positives = 253/567 (44%), Gaps = 38/567 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
             +    + +AL  I    +Q + +         +  +I           S +  + D +
Sbjct: 1   MDSRRSLLVLALIFISFLVYQQWQLDKNPPVQTEQTTSITATSDVPASSPSNSQAIADSQ 60

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
               +    + L+N      I+  G       L  Y  ++ S +P   L      ++ Y 
Sbjct: 61  ----TRGRIITLENDVFRLKIDTLGGDVISSELLKYDAELDSKTPFELL--KDTKEHIYI 114

Query: 122 AELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDEH 177
           A+   +   N I+  +    + +            +  + L+F+       +  +     
Sbjct: 115 AQSGLIG-KNGIDTRSGRAQYQIEGDNFKLAEGQESLSVPLLFEKDGVTYQKIFVLKRGS 173

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           Y   +   + N S   I   P G++     + + N         A     +  ++     
Sbjct: 174 YDLGVDYKIDNQSGQAIEVEPYGQLKHSIVENSGNVAMPTYTGGAYSSSDTNYKKYSFAD 233

Query: 238 EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITIL 297
            + +  +      W+ +   Y+ S +IP+++ +    +      +      +    +TI 
Sbjct: 234 MQDNNLSIDTKAGWVAVLQHYFVSAWIPNQDVNNQL-YTITDSKNNVASIGYRGPVVTIP 292

Query: 298 PGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLV 357
            G   T T+ L+ G K    +     +      ++ +D+GW +FIAKP+F L+++   +V
Sbjct: 293 SGSQETITSSLWTGPKLQNQMATVANN-----LDLTVDYGWAWFIAKPLFWLLTFIQGIV 347

Query: 358 GNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQ 417
            N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++
Sbjct: 348 SNWGLAIICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGD-DRQRMSQEMMK 406

Query: 418 LYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLF 477
           LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A DP       
Sbjct: 407 LYKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQDPYY----- 461

Query: 478 GILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPA 536
                         I PI+M +SMF+  KMSP P  D  Q  ++N+MP+VF+F    FP+
Sbjct: 462 --------------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLVFMFFFLWFPS 507

Query: 537 GLIIYWSWSNVISIVQQAVIMKMHGAE 563
           GL++YW  SN+I+I QQ +I +    +
Sbjct: 508 GLVLYWLVSNLITIAQQQLIYRGLEKK 534


>gi|254000529|ref|YP_003052592.1| 60 kDa inner membrane insertion protein [Methylovorus sp. SIP3-4]
 gi|253987208|gb|ACT52065.1| 60 kDa inner membrane insertion protein [Methylovorus sp. SIP3-4]
          Length = 549

 Score =  357 bits (916), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 147/573 (25%), Positives = 251/573 (43%), Gaps = 34/573 (5%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYV--YPRIEEMNNERKNIQTVKQPNQVDNSYAAV-LI 58
                  + +  S  I+  W  +     P  E +  E     +V    ++  + AA  + 
Sbjct: 1   MDTKRLILFVIFSFSILMLWDAWQREHTPPPETVTAEAATDNSVPHAEKLPGAKAAADMP 60

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
            +    L  + R++++       I+  G     L L  +  D S+    V LL       
Sbjct: 61  KESGFRLQTADRIQVETDVYKAVIDTTGGDLRRLELLKHRADNSTTENFV-LLDDRAAPM 119

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD-EH 177
            Y A+   +               +       + T  ++L   +A+ +  ++  +   + 
Sbjct: 120 VYVAQSGLIGQGLPNHKTVFTAEASNYQLAAGSDTLEVRLTAASADGVKVDKIYTFHRDS 179

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRH-KPQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
           Y+  +   + N S   I  +   +++   +    ++      G           +  + D
Sbjct: 180 YVINLRYEIHNESASPIDPTVYYQVVHDTESNQGSHMMPTFTGGAYFTQADKFKKLSFKD 239

Query: 237 IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITI 296
           + K+ +S    S+ W+G+   Y+ S +IP +      QF         Y     ++   I
Sbjct: 240 MGKNDLSKT-TSDGWVGLLQHYFVSAWIPKEG--VTRQFYSKKLADNIYSIGTKSDIGVI 296

Query: 297 LPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNL 356
            PG S       +AG +    +         P  E  +D+GW   IA P+F ++S   ++
Sbjct: 297 APGASAEVDARYYAGPQNQEVMKQVA-----PGLEYTVDYGWLTIIASPLFWILSKIESV 351

Query: 357 VGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMI 416
           V N+G+AI+L TV +KL F+PL+   Y S A+M+ + P++  L+E++     Q +Q AM+
Sbjct: 352 VHNWGVAIILLTVMIKLAFYPLSAASYRSMAHMRELAPRLQRLKEQYGD-DRQKMQVAMM 410

Query: 417 QLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTL 476
           +LYKT  INP+ GC PIL+QIPVF ++Y V+  S+EMRHAPF  WI DL+A DP      
Sbjct: 411 ELYKTEKINPMGGCLPILVQIPVFISLYWVLLGSVEMRHAPFMLWIHDLSAIDPYY---- 466

Query: 477 FGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPA 536
                          + PI+M  +M IQ +++P P D  QA ++  MP+VF      FPA
Sbjct: 467 ---------------VLPILMGATMIIQTRLNPTPTDPVQAKVMMIMPIVFSVFFFFFPA 511

Query: 537 GLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDR 569
           GL++YW  +NV+SI QQ  I +       L  +
Sbjct: 512 GLVLYWLVNNVLSIAQQWHINRSTERATALKKK 544


>gi|219871547|ref|YP_002475922.1| putative inner membrane protein translocase component YidC
           [Haemophilus parasuis SH0165]
 gi|254772790|sp|B8F6M2|OXAA_HAEPS RecName: Full=Inner membrane protein oxaA
 gi|219691751|gb|ACL32974.1| putative inner membrane protein translocase component YidC
           [Haemophilus parasuis SH0165]
          Length = 546

 Score =  357 bits (916), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 148/569 (26%), Positives = 257/569 (45%), Gaps = 37/569 (6%)

Query: 1   MERNWNYFV--AIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           M  N +  +   + +S +I   WQ  Y  P I+         QT +  NQ  +  A+   
Sbjct: 1   MNSNRSLLIMGLLLVSFLIFTQWQQDYN-PEIQAQKQAMAQAQTQQVANQSSDVPASSNA 59

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
               +  +    + ++   L  +++  G    D +L  Y+ ++ SN+P   L    N K 
Sbjct: 60  ASINEQSTKGKTITIETDVLRLTVDTLGGDVVDSDLLKYNAELDSNTPFELL--QDNGKV 117

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPI---KLVFKNANNILFERTISLD 175
            Y A+   V                      L          L F+    +  +      
Sbjct: 118 LYVAQSGLVGKNGIDTTAGRAQYQATAEKFALAEGQDEIALPLTFEKDGVVYTKTFTLKR 177

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
             Y   +   + N + + +   P G++     ++  N         A    +   ++   
Sbjct: 178 GSYNVAVNYHIKNGTAETLEVQPYGQLKHTLVESTGNFAMPTYTGGAYSSSEVNYKKYSF 237

Query: 236 DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
           D    +  +      W  +   Y+ S +IP+++   +   +    G+      +      
Sbjct: 238 DEMAKANLSVDTKAGWAAVLQHYFVSAWIPNQDAENNLYTRT---GNGVGTIGYRGPVTQ 294

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           + P    T T+ L+ G K+   +     +     F++ +D+GW +FIAKP+F L+++  +
Sbjct: 295 VAPNGEATITSHLWTGPKDQAAMAQVANN-----FDLTVDYGWAWFIAKPLFWLLTFIQS 349

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
           +V N+G+AI+  T+ VK + +PL K QY S A M+ +QP+I E+RE+F     Q + + M
Sbjct: 350 IVSNWGLAIIGVTIVVKTILYPLTKAQYTSMAKMRMLQPRIQEMRERFGD-DRQRMSQEM 408

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           ++LYK   +NP+ GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A DP  IF 
Sbjct: 409 MKLYKEEKVNPMGGCLPILLQMPIFIALYWTFMEAVELRHAPFFGWIQDLSAQDPYYIF- 467

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSF 534
                             P++M  SM++  KMSP P AD  Q  ++N+MPV+F      F
Sbjct: 468 ------------------PLLMGGSMYLLQKMSPTPIADPVQQKVMNFMPVMFTVFFLWF 509

Query: 535 PAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           P+GL++YW  SN+I+I QQ +I +    +
Sbjct: 510 PSGLVLYWLTSNLITIAQQWLIYRNLEKK 538


>gi|269103816|ref|ZP_06156513.1| OxaI/YidC membrane insertion protein [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268163714|gb|EEZ42210.1| OxaI/YidC membrane insertion protein [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 540

 Score =  357 bits (915), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 138/568 (24%), Positives = 244/568 (42%), Gaps = 39/568 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL  +    +Q +      +  +                ++   ++   
Sbjct: 1   MDSQRN-ILLIALLFVSFLLFQQWNSDKNPQPQSQGVAQQVNNSGDVPSHSADGQLVT-- 57

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
                S    + +K   L  +++  G    D  L  Y+  + S  P V L   +N +++Y
Sbjct: 58  --DQSSSQNLITIKTDVLALTVDTLGGDVVDAKLLKYNNTLGSKDPFVLL--ENNPEHSY 113

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLV----FKNANNILFERTISLDE 176
            A+   +     I+       + +            +L     ++       +  +    
Sbjct: 114 VAQSGLIGQNG-IDTNAGRAQFTVSGKDFTLAPDQKELRVPMTYEKDGIKYTKTFVLKPN 172

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
            Y   +  T+ N S          ++      + ++         A     +  ++   D
Sbjct: 173 SYAVNVDYTIDNQSAAPTSVQMYAQLRHSLVASKSSLTMPTYQGGAYSSVDTNYKKYSFD 232

Query: 237 IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITI 296
             K    N    + W+ +   Y+ S +IP       +   Y                +T+
Sbjct: 233 DMKDKNLNVTTPDGWVAVLQHYFVSAWIPRDGNESLNNL-YSRSSDGNGYIGVRMPAVTV 291

Query: 297 LPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNL 356
            PG + T    L+ G K    +    K+       + +D+GW +FIA P+  L+S+ +++
Sbjct: 292 APGATDTLKATLWVGPKLQNEMAATAKN-----LNLTVDYGWLWFIASPLHKLLSFIHSI 346

Query: 357 VGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMI 416
           VGN+G+AIM+ T  V+   +PL K QY S A M+ +QPK+  +RE+F     Q L + M+
Sbjct: 347 VGNWGVAIMVLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLQAMRERFGD-DRQRLSQEMM 405

Query: 417 QLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTL 476
           +LY+   +NPL GC PIL+Q+P+F A+Y  +  S+E+RHAPF+GWI DL+A DP      
Sbjct: 406 ELYRKEKVNPLGGCLPILVQMPIFIALYWALMESVELRHAPFFGWIHDLSAQDPYY---- 461

Query: 477 FGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFP 535
                          I PI+M ++MF+  KMSP    D  Q  I+ +MPV+F F    FP
Sbjct: 462 ---------------ILPILMGITMFMIQKMSPSTITDPMQQKIMTFMPVMFTFFFLWFP 506

Query: 536 AGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           +GL++YW  SN+++++QQ +I +    +
Sbjct: 507 SGLVLYWLVSNIVTLIQQTLIYRSLEKK 534


>gi|145632386|ref|ZP_01788121.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae 3655]
 gi|144987293|gb|EDJ93823.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae 3655]
          Length = 541

 Score =  357 bits (915), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 139/567 (24%), Positives = 254/567 (44%), Gaps = 38/567 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
             +    + +AL  I    +Q + +         +  +I           S +  + D +
Sbjct: 1   MDSRRSLLVLALIFISFLVYQQWQLDKNPPVQTEQTTSITATSDVPASSPSNSQAIADSQ 60

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
               +    + L+N      I+  G       L  Y  ++ S +P   L      ++ Y 
Sbjct: 61  ----TRGRIITLENDVFRLKIDTLGGDVISSELLKYDAELDSKTPFELL--KDTKEHIYI 114

Query: 122 AELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDEH 177
           A+   +   N I+  +    + +            +  + L+F+       +  +     
Sbjct: 115 AQSGLIG-KNGIDTRSGRAQYQIEGDNFKLAEGQESLSVPLLFEKDGVTYQKIFVLKRGS 173

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           Y   +   + N S   I   P G++     +++ N         A    ++  ++     
Sbjct: 174 YDLGVDYKIDNQSGQAIEVEPYGQLKHSIIESSGNVAMPTYTGGAYSSSETNYKKYSFSD 233

Query: 238 EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITIL 297
            + +  +      W+ +   Y+ S +IP+++ +    +      +      +    ++I 
Sbjct: 234 MQDNNLSIDTKAGWVAVLQHYFVSAWIPNQDVNNQL-YTITDSKNNVASIGYRGPVVSIP 292

Query: 298 PGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLV 357
            G   T T+ L+ G K    +     +      ++ +D+GW +FIAKP+F L+++   +V
Sbjct: 293 AGSQETITSSLWTGPKLQNQMATVANN-----LDLTVDYGWAWFIAKPLFWLLTFIQGIV 347

Query: 358 GNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQ 417
            N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++
Sbjct: 348 SNWGLAIICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGD-DRQRMSQEMMK 406

Query: 418 LYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLF 477
           LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A DP       
Sbjct: 407 LYKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQDPYY----- 461

Query: 478 GILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPA 536
                         I PI+M +SMF+  KMSP P  D  Q  ++N+MP++F+     FP+
Sbjct: 462 --------------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLIFMVFFLWFPS 507

Query: 537 GLIIYWSWSNVISIVQQAVIMKMHGAE 563
           GL++YW  SN+I+I QQ +I +    +
Sbjct: 508 GLVLYWLVSNLITIAQQQLIYRGLEKK 534


>gi|145630098|ref|ZP_01785880.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae R3021]
 gi|144984379|gb|EDJ91802.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae R3021]
          Length = 541

 Score =  357 bits (915), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 140/567 (24%), Positives = 254/567 (44%), Gaps = 38/567 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
             +    + +AL  I    +Q + +         +  +I           S +  + D +
Sbjct: 1   MDSRRSLLVLALIFISFLVYQQWQLDKNPPVQTEQTTSITATSDVPASSPSNSQAIADSQ 60

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
               +    + L+N      I+  G       L  Y  ++ S +P   L      ++ Y 
Sbjct: 61  ----TRGRIITLENDVFRLKIDTLGGDVISSELLKYDAELDSKTPFELL--KDTKEHIYI 114

Query: 122 AELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDEH 177
           A+   +   N I+  +    + +            +  + L+F+       +  +     
Sbjct: 115 AQSGLIG-KNGIDTRSGRAQYQIEGDNFKLAEGQESLSVPLLFEKDGVTYQKIFVLKRGS 173

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           Y   +   + N S   I   P G++     +++ N         A    ++  ++     
Sbjct: 174 YDLGVDYKIDNQSGQAIEVEPYGQLKHSIIESSGNVAMPTYTGGAYSSSETNYKKYSFSD 233

Query: 238 EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITIL 297
            + +  +      W+ +   Y+ S +IP+++ +    +      +      +    +TI 
Sbjct: 234 MQDNNLSIDTKAGWVAVLQHYFVSAWIPNQDVNNQL-YTITDSKNNVASIGYRGPVVTIP 292

Query: 298 PGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLV 357
            G   T T+ L+ G K    +     +      ++ +D+GW +FIAKP+F L+++   +V
Sbjct: 293 SGSQETITSSLWTGPKLQNQMATVANN-----LDLTVDYGWAWFIAKPLFWLLTFIQGIV 347

Query: 358 GNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQ 417
            N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++
Sbjct: 348 SNWGLAIICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGD-DRQRMSQEMMK 406

Query: 418 LYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLF 477
           LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A DP       
Sbjct: 407 LYKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQDPYY----- 461

Query: 478 GILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPA 536
                         I PI+M +SMF+  KMSP P  D  Q  ++N+MP++F+     FP+
Sbjct: 462 --------------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLIFMVFFLWFPS 507

Query: 537 GLIIYWSWSNVISIVQQAVIMKMHGAE 563
           GL++YW  SN+I+I QQ +I +    +
Sbjct: 508 GLVLYWLVSNLITIAQQQLIYRGLEKK 534


>gi|319775066|ref|YP_004137554.1| Inner membrane protein oxaA [Haemophilus influenzae F3047]
 gi|317449657|emb|CBY85863.1| Inner membrane protein oxaA [Haemophilus influenzae F3047]
          Length = 541

 Score =  357 bits (915), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 141/567 (24%), Positives = 254/567 (44%), Gaps = 38/567 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
             +    + +AL  I    +Q + +         +  +I           S +  + D +
Sbjct: 1   MDSRRSLLVLALIFISFLVYQQWQLDKNPPVQTEQTTSITATSDVPASSPSNSQAIADSQ 60

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
               +    + L+N      I+  G       L  Y  ++ S +P   L      ++ Y 
Sbjct: 61  ----TRGRIITLENDVFRLKIDTLGGDVISSELLKYDAELDSKTPFELL--KDTKEHIYI 114

Query: 122 AELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDEH 177
           A+   +   N I+  +    + +            +  + L+F+       +  +     
Sbjct: 115 AQSGLIG-KNGIDTRSGRAQYQIEGDNFKLAEGQESLSVPLLFEKDGVTYQKIFVLKRGS 173

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           Y   +   + N S   I   P G++     +++ N         A    ++  ++     
Sbjct: 174 YDLGVDYKIDNQSGQAIEVEPYGQLKHSIIESSGNVAMPTYTGGAYSSSETNYKKYSFSD 233

Query: 238 EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITIL 297
            + +  +      W+ +   Y+ S +IP+++ +    +      +      +  + +TI 
Sbjct: 234 MQDNNLSIDTKAGWVAVLQHYFVSAWIPNQDVNNQL-YTITDSKNNVASIGYRGSVVTIP 292

Query: 298 PGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLV 357
            G   T T+ L+ G K    +     +      ++ +D+GW +FIAKP+F L+++   +V
Sbjct: 293 AGSQETITSSLWTGPKLQNQMATVANN-----LDLTVDYGWAWFIAKPLFWLLTFIQGIV 347

Query: 358 GNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQ 417
            N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE       Q + + M++
Sbjct: 348 SNWGLAIICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRE-CFGDDRQRMSQEMMK 406

Query: 418 LYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLF 477
           LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A DP       
Sbjct: 407 LYKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQDPYY----- 461

Query: 478 GILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPA 536
                         I PI+M +SMF+  KMSP P  D  Q  ++N+MP+VF+F    FP+
Sbjct: 462 --------------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLVFMFFFLWFPS 507

Query: 537 GLIIYWSWSNVISIVQQAVIMKMHGAE 563
           GL++YW  SN+I+I QQ +I +    +
Sbjct: 508 GLVLYWLVSNLITIAQQQLIYRGLEKK 534


>gi|301169726|emb|CBW29327.1| cytoplasmic insertase into membrane protein, Sec system
           [Haemophilus influenzae 10810]
          Length = 541

 Score =  356 bits (913), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 143/567 (25%), Positives = 257/567 (45%), Gaps = 38/567 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
             +    + +AL  I    +Q + +         +  +I           S +  + D +
Sbjct: 1   MDSRRSLLVLALIFISFLVYQQWQLDKNPPVQTEQTTSITATSDVPASSPSNSQAIADSQ 60

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
               +    + L+N      I+  G       L  Y  +++S +P   L      ++ Y 
Sbjct: 61  ----TRGRIITLENDVFRLKIDTLGGDVISSELLKYDAELNSKTPFELL--KDTKEHIYI 114

Query: 122 AELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDEH 177
           A+   +   N I+  +    + +            +  + L+F+       +  +     
Sbjct: 115 AQSGLIG-KNGIDTRSGRAQYQIEGDNFKLAEGQESLSVPLLFEKDGVTYQKIFVLKRGS 173

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           Y   +   + N S   I   P G++     +++ N         A    ++  ++     
Sbjct: 174 YDLGVDYKIDNQSGQAIEVEPYGQLKHSIVESSGNVAMPTYTGGAYSSSETNYKKYSFSD 233

Query: 238 EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITIL 297
            + +  +      W+ +   Y+ S +IP+++ +    +      +      +  + +TI 
Sbjct: 234 MQDNNLSIDTKAGWVAVLQHYFVSAWIPNQDVNNQL-YTITDSKNNVASIGYRGSVVTIP 292

Query: 298 PGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLV 357
            G   T T+ L+ G K    +     +      ++ +D+GW +FIAKP+F L+++   +V
Sbjct: 293 AGSQETITSSLWTGPKLQNQMATVANN-----LDLTVDYGWAWFIAKPLFWLLTFIQGIV 347

Query: 358 GNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQ 417
            N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++
Sbjct: 348 SNWGLAIICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGD-DRQRMSQEMMK 406

Query: 418 LYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLF 477
           LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A DP       
Sbjct: 407 LYKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQDPYY----- 461

Query: 478 GILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPA 536
                         I PI+M +SMF+  KMSP P  D  Q  ++N+MP+VF+F    FPA
Sbjct: 462 --------------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLVFMFFFLWFPA 507

Query: 537 GLIIYWSWSNVISIVQQAVIMKMHGAE 563
           GL++YW  SN+I+I QQ +I +    +
Sbjct: 508 GLVLYWLVSNLITIAQQQLIYRGLEKK 534


>gi|153803663|ref|ZP_01958249.1| inner membrane protein, 60 kDa [Vibrio cholerae MZO-3]
 gi|153830819|ref|ZP_01983486.1| inner membrane protein, 60 kDa [Vibrio cholerae 623-39]
 gi|229515955|ref|ZP_04405412.1| OxaI/YidC membrane insertion protein [Vibrio cholerae TMA 21]
 gi|254291134|ref|ZP_04961931.1| inner membrane protein, 60 kDa [Vibrio cholerae AM-19226]
 gi|297581961|ref|ZP_06943881.1| inner membrane protein [Vibrio cholerae RC385]
 gi|124120800|gb|EAY39543.1| inner membrane protein, 60 kDa [Vibrio cholerae MZO-3]
 gi|148873703|gb|EDL71838.1| inner membrane protein, 60 kDa [Vibrio cholerae 623-39]
 gi|150422979|gb|EDN14929.1| inner membrane protein, 60 kDa [Vibrio cholerae AM-19226]
 gi|229347055|gb|EEO12017.1| OxaI/YidC membrane insertion protein [Vibrio cholerae TMA 21]
 gi|297533828|gb|EFH72669.1| inner membrane protein [Vibrio cholerae RC385]
          Length = 541

 Score =  356 bits (913), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 141/570 (24%), Positives = 244/570 (42%), Gaps = 41/570 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL+++    +Q + V         ++             +        +
Sbjct: 1   MDSQRN-ILLIALALVSFLLFQQWQVAKNPAPQATQQAQSTGAAPAPSFSDELDPTPAQN 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
                + +  + +    L  SI+  G       L  Y  +++S    V L +     + +
Sbjct: 60  ---VAAKAKTITVSTDVLTLSIDTLGGDVVSAKLNQYSEELNSPESFVLLQNTQG--HQF 114

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDE 176
            A+   V         N+   + + +             I + ++       +  I    
Sbjct: 115 IAQSGLVGPQGIDVTSNNRPAYQVSADSFTLAEGQDELRIPMTYQANGIDYTKTFILKRG 174

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYS 235
            Y   +V  V NNS  +        + ++   +  N       G      D    +  + 
Sbjct: 175 SYAVDVVFDVANNSGSEATLGMYAHLRQNLLDSGGNLAMPTYRGGAYSTSDVRYKKYSFD 234

Query: 236 DIEKSSIS-NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
           D++  ++S     + +W+ +   Y+AS +IP  E       + +++              
Sbjct: 235 DMKDRNLSAPNDVTVNWVAMIQHYFASAWIPRDEPQAQLYSRVINNLGD---MGIRTPNK 291

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
           TI  G        L+ G K    +         P  ++++D+GW +FIAKP+  L+S   
Sbjct: 292 TIANGDKAEFEATLWVGPKLQDQMAATA-----PNLDLVVDYGWLWFIAKPLHWLLSVIQ 346

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
           N VGN+G+AI+  T  V+   +PL K QY S A M+ +QPK+  +RE+      Q + + 
Sbjct: 347 NFVGNWGVAIICLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLQAMRERIGD-DRQRMSQE 405

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           M++LYK   +NPL GC PILLQ+P+F A+Y  +  S+E+RH+PF+GWI DL+A DP    
Sbjct: 406 MMELYKKEKVNPLGGCLPILLQMPIFIALYWALMESVELRHSPFFGWIHDLSAQDPYY-- 463

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSS 533
                            I P++M  SMF+  KMSP    D  Q  I+ +MPV+F F    
Sbjct: 464 -----------------ILPLLMGASMFVIQKMSPTTITDPMQQKIMTFMPVMFTFFFLW 506

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           FP+GL++YW  SN+++++QQ +I K    +
Sbjct: 507 FPSGLVLYWLVSNIVTLIQQTLIYKALEKK 536


>gi|260581921|ref|ZP_05849717.1| membrane protein insertase, YidC/Oxa1 family domain [Haemophilus
           influenzae NT127]
 gi|260095114|gb|EEW79006.1| membrane protein insertase, YidC/Oxa1 family domain [Haemophilus
           influenzae NT127]
          Length = 541

 Score =  356 bits (913), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 141/567 (24%), Positives = 255/567 (44%), Gaps = 38/567 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
             +    + +AL  I    +Q + +         +  ++           S +  + D +
Sbjct: 1   MDSRRSLLVLALIFISFLVYQQWQLDKNPPVQTEQTTSMTATSDVPASSPSNSQAIADSQ 60

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
               +    + L+N      I+  G       L  Y  ++ S +P   L      ++ Y 
Sbjct: 61  ----TRGRIITLENDVFRLKIDTLGGDVISSELLKYDAELDSKTPFELL--KDTKEHIYI 114

Query: 122 AELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDEH 177
           A+   +   N I+  +    + +            +  + L+F+       +  +     
Sbjct: 115 AQSGLIG-KNGIDTRSGRAQYQIEGDNFKLAEGQESLSVPLLFEKDGVTYQKIFVLKRGS 173

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           Y   +   + N S   I   P G++     +++ N         A    ++  ++     
Sbjct: 174 YDLGVDYKIDNQSGQAIEVEPYGQLKHSIIESSGNVAMPTYTGGAYSSSETNYKKYSFSD 233

Query: 238 EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITIL 297
            + +  +      W+ +   Y+ S +IP+++ +    +      +      +    +TI 
Sbjct: 234 MQDNNLSIDTKAGWVAVLQHYFVSAWIPNQDVNNQL-YTITDSKNNVASIGYRGPVVTIP 292

Query: 298 PGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLV 357
            G   T T+ L+ G K    +     +      ++ +D+GW +FIAKP+F L+++   +V
Sbjct: 293 AGSQETITSSLWTGPKLQNQMATVANN-----LDLTVDYGWAWFIAKPLFWLLTFIQGIV 347

Query: 358 GNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQ 417
            N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++
Sbjct: 348 SNWGLAIICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGD-DRQRMSQEMMK 406

Query: 418 LYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLF 477
           LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A DP       
Sbjct: 407 LYKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQDPYY----- 461

Query: 478 GILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPA 536
                         I PI+M +SMF+  KMSP P  D  Q  ++N+MP+VF+F    FP+
Sbjct: 462 --------------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLVFMFFFLWFPS 507

Query: 537 GLIIYWSWSNVISIVQQAVIMKMHGAE 563
           GL++YW  SN+I+I QQ +I +    +
Sbjct: 508 GLVLYWLVSNLITIAQQQLIYRGLEKK 534


>gi|229530208|ref|ZP_04419597.1| OxaI/YidC membrane insertion protein [Vibrio cholerae 12129(1)]
 gi|229332341|gb|EEN97828.1| OxaI/YidC membrane insertion protein [Vibrio cholerae 12129(1)]
          Length = 541

 Score =  356 bits (913), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 140/570 (24%), Positives = 244/570 (42%), Gaps = 41/570 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL+++    +Q + V         ++             +        +
Sbjct: 1   MDSQRN-ILLIALALVSFLLFQQWQVAKNPAPQATQQAQSTGAAPAPSFSDELDPTPAQN 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
                + +  + +    L  SI+  G       L  Y  +++S    V L +     + +
Sbjct: 60  ---VAAKAKTITVSTDVLTLSIDTLGGDVVSAKLNQYSEELNSPESFVLLQNTQG--HQF 114

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDE 176
            A+   V         N+   + + +             I + ++       +  I    
Sbjct: 115 IAQSGLVGPQGIDVTSNNRPAYQVSADSFTLAEGQDELRIPMTYQANGIDYTKTFILKRG 174

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYS 235
            Y   +V  V NNS  +        + ++   +  N       G      D    +  + 
Sbjct: 175 SYAVDVVFDVANNSGSEATLGMYAHLRQNLLDSGGNLAMPTYRGGAYSTSDVRYKKYSFD 234

Query: 236 DIEKSSIS-NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
           D++  ++S     + +W+ +   Y+AS +IP  E       + +++              
Sbjct: 235 DMKDRNLSAPNDVTVNWVAMIQHYFASAWIPRDEPQAQLYSRVINNLGD---MGIRTPNK 291

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
           TI  G        L+ G K    +         P  ++++D+GW +FIAKP+  L+S   
Sbjct: 292 TIANGDKAEFEATLWVGPKLQDQMAATA-----PNLDLVVDYGWLWFIAKPLHWLLSVIQ 346

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
           + VGN+G+AI+  T  V+   +PL K QY S A M+ +QPK+  +RE+      Q + + 
Sbjct: 347 SFVGNWGVAIICLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLQAMRERIGD-DRQRMSQE 405

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           M++LYK   +NPL GC PILLQ+P+F A+Y  +  S+E+RH+PF+GWI DL+A DP    
Sbjct: 406 MMELYKKEKVNPLGGCLPILLQMPIFIALYWALMESVELRHSPFFGWIHDLSAQDPYY-- 463

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSS 533
                            I P++M  SMF+  KMSP    D  Q  I+ +MPV+F F    
Sbjct: 464 -----------------ILPLLMGASMFVIQKMSPTTITDPMQQKIMTFMPVMFTFFFLW 506

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           FP+GL++YW  SN+++++QQ +I K    +
Sbjct: 507 FPSGLVLYWLVSNIVTLIQQTLIYKALEKK 536


>gi|15640036|ref|NP_062588.1| putative inner membrane protein translocase component YidC [Vibrio
           cholerae O1 biovar El Tor str. N16961]
 gi|121591471|ref|ZP_01678744.1| inner membrane protein, 60 kDa [Vibrio cholerae 2740-80]
 gi|147674272|ref|YP_001218407.1| putative inner membrane protein translocase component YidC [Vibrio
           cholerae O395]
 gi|153212974|ref|ZP_01948568.1| inner membrane protein, 60 kDa [Vibrio cholerae 1587]
 gi|153821953|ref|ZP_01974620.1| inner membrane protein, 60 kDa [Vibrio cholerae B33]
 gi|227080241|ref|YP_002808792.1| putative Inner membrane protein [Vibrio cholerae M66-2]
 gi|229508291|ref|ZP_04397795.1| OxaI/YidC membrane insertion protein [Vibrio cholerae BX 330286]
 gi|229508870|ref|ZP_04398361.1| OxaI/YidC membrane insertion protein [Vibrio cholerae B33]
 gi|229606565|ref|YP_002877213.1| inner membrane protein translocase component YidC [Vibrio cholerae
           MJ-1236]
 gi|254851570|ref|ZP_05240920.1| inner membrane protein oxaA [Vibrio cholerae MO10]
 gi|255746812|ref|ZP_05420758.1| OxaI/YidC membrane insertion protein [Vibrio cholera CIRS 101]
 gi|262155892|ref|ZP_06029014.1| OxaI/YidC membrane insertion protein [Vibrio cholerae INDRE 91/1]
 gi|262167094|ref|ZP_06034809.1| OxaI/YidC membrane insertion protein [Vibrio cholerae RC27]
 gi|298501190|ref|ZP_07010989.1| inner membrane protein [Vibrio cholerae MAK 757]
 gi|38503195|sp|Q9KVY4|OXAA_VIBCH RecName: Full=Inner membrane protein oxaA
 gi|172047497|sp|A5F484|OXAA_VIBC3 RecName: Full=Inner membrane protein oxaA
 gi|254778170|sp|C3LP77|OXAA_VIBCM RecName: Full=Inner membrane protein oxaA
 gi|9654395|gb|AAF93182.1| inner membrane protein, 60 kDa [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121546673|gb|EAX56855.1| inner membrane protein, 60 kDa [Vibrio cholerae 2740-80]
 gi|124116200|gb|EAY35020.1| inner membrane protein, 60 kDa [Vibrio cholerae 1587]
 gi|126520492|gb|EAZ77715.1| inner membrane protein, 60 kDa [Vibrio cholerae B33]
 gi|146316155|gb|ABQ20694.1| inner membrane protein, 60 kDa [Vibrio cholerae O395]
 gi|227008129|gb|ACP04341.1| putative Inner membrane protein [Vibrio cholerae M66-2]
 gi|227011993|gb|ACP08203.1| putative Inner membrane protein [Vibrio cholerae O395]
 gi|229354145|gb|EEO19077.1| OxaI/YidC membrane insertion protein [Vibrio cholerae B33]
 gi|229354564|gb|EEO19486.1| OxaI/YidC membrane insertion protein [Vibrio cholerae BX 330286]
 gi|229369220|gb|ACQ59643.1| OxaI/YidC membrane insertion protein [Vibrio cholerae MJ-1236]
 gi|254847275|gb|EET25689.1| inner membrane protein oxaA [Vibrio cholerae MO10]
 gi|255735569|gb|EET90968.1| OxaI/YidC membrane insertion protein [Vibrio cholera CIRS 101]
 gi|262024480|gb|EEY43166.1| OxaI/YidC membrane insertion protein [Vibrio cholerae RC27]
 gi|262030344|gb|EEY48986.1| OxaI/YidC membrane insertion protein [Vibrio cholerae INDRE 91/1]
 gi|297540062|gb|EFH76124.1| inner membrane protein [Vibrio cholerae MAK 757]
          Length = 541

 Score =  356 bits (913), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 140/570 (24%), Positives = 243/570 (42%), Gaps = 41/570 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL+++    +Q + V         ++             +        +
Sbjct: 1   MDSQRN-ILLIALALVSFLLFQQWQVAKNPAPQATQQAQSTGAAPAPSFSDELDPTPAQN 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
                + +  + +    L  SI+  G       L  Y  +++S    V L +     + +
Sbjct: 60  ---VAAKAKTITVSTDVLTLSIDTLGGDVVSAKLNQYSEELNSPESFVLLQNTQG--HQF 114

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDE 176
            A+   V         N+   + + +             I + ++       +  I    
Sbjct: 115 IAQSGLVGPQGIDVTSNNRPAYQVSADSFTLAEGQDELRIPMTYQANGIDYTKTFILKRG 174

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYS 235
            Y   +V  V NNS  +        + ++   +  N       G      D    +  + 
Sbjct: 175 SYAVDVVFDVANNSGSEATLGMYAHLRQNLLDSGGNLAMPTYRGGAYSTSDVRYKKYSFD 234

Query: 236 DIEKSSIS-NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
           D++  ++S     + +W+ +   Y+AS +IP  E       + +++              
Sbjct: 235 DMKDRNLSAPNDVTVNWVAMIQHYFASAWIPRDEPQAQLYSRVINNLGD---MGIRTPNK 291

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
           TI  G        L+ G K    +         P  ++++D+GW +FIAKP+  L+S   
Sbjct: 292 TIANGDKAEFEATLWVGPKLQDQMAATA-----PNLDLVVDYGWLWFIAKPLHWLLSVIQ 346

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
             VGN+G+AI+  T  V+   +PL K QY S A M+ +QPK+  +RE+      Q + + 
Sbjct: 347 TFVGNWGVAIICLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLQAMRERIGD-DRQRMSQE 405

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           M++LYK   +NPL GC PILLQ+P+F A+Y  +  S+E+RH+PF+GWI DL+A DP    
Sbjct: 406 MMELYKKEKVNPLGGCLPILLQMPIFIALYWALMESVELRHSPFFGWIHDLSAQDPYY-- 463

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSS 533
                            I P++M  SMF+  KMSP    D  Q  I+ +MPV+F F    
Sbjct: 464 -----------------ILPLLMGASMFVIQKMSPTTITDPMQQKIMTFMPVMFTFFFLW 506

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           FP+GL++YW  SN+++++QQ +I K    +
Sbjct: 507 FPSGLVLYWLVSNIVTLIQQTLIYKALEKK 536


>gi|254788526|ref|YP_003075955.1| preprotein translocase subunit YidC [Teredinibacter turnerae T7901]
 gi|259515729|sp|C5BKL7|OXAA_TERTT RecName: Full=Inner membrane protein oxaA
 gi|237685608|gb|ACR12872.1| preprotein translocase subunit YidC [Teredinibacter turnerae T7901]
          Length = 560

 Score =  356 bits (913), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 139/580 (23%), Positives = 245/580 (42%), Gaps = 48/580 (8%)

Query: 1   MERNWNYFVA--IALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           M    N  +   + +S +++  W  F      E    +     + +    + +       
Sbjct: 1   MNLLRNALIGGIVLVSFLLIIRWNEFQERKFEETQLQQSSANNSERVAPSIPSEQPQAPN 60

Query: 59  DDR---------------AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSS 103
            +                        ++ +   +L   I+  G     L L  Y+  +  
Sbjct: 61  GEEVPDAPASDSKDAVEFTANADNDRQIHISTDTLDLVIDTNGGDIVRLALPQYYAMLHE 120

Query: 104 NSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPI---KLVF 160
                 LL+ ++T + Y A+   V                  S   L P        L +
Sbjct: 121 KDNPFVLLNNNDT-STYIAQSGLVGPNGTDGKNGRPRFSAASSDYTLEPGKDTLVVDLKY 179

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMR--HKPQTATNTFGVQE 218
           +  + I+ +R     + YL  +   + N        +  G+I R  H P  A        
Sbjct: 180 QQESAIITKRFTFHRDSYLIDLEYLIENTGDTNWVGNLYGQIKRDDHNPAQAVGVGMQPF 239

Query: 219 GFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYL 278
              A+   ++  ++   D           +  W+ +   Y+ S ++P ++       +  
Sbjct: 240 LGAAITTPETNYKKLKFDELAKEKLEVSNTGGWVAMVQHYFMSAWVPDQDKDQKYVLRKS 299

Query: 279 SDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGW 338
            + +  + +  +    T+ PG + +     +AG K    +         P  ++ ID+ W
Sbjct: 300 RNANMYFLSFTTLTSTTVAPGTTGSIKAQYYAGPKHIRVLEKIA-----PHLDLTIDYSW 354

Query: 339 FYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDE 398
            +FIAKP+F  + + + LVGN+G+AI+L T  +KL+FF  +   Y S A M+ +QP ++E
Sbjct: 355 LWFIAKPLFYALDFIHGLVGNWGLAIILLTCCIKLVFFYPSAMSYRSMAKMRKVQPLMNE 414

Query: 399 LREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF 458
           L+E++     Q +   +++LYK   +NPL GC PILLQ+PVF A+Y +I  S+E+RHAPF
Sbjct: 415 LKERYGD-DRQRMSAELMKLYKKEKVNPLGGCLPILLQMPVFIALYWMIMESVELRHAPF 473

Query: 459 WGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAM 518
           + WI DL+  DP                     + P+IM ++M+IQ K++P PAD  QA 
Sbjct: 474 FLWIHDLSVRDPYF-------------------VLPLIMGVTMWIQQKLNPTPADPMQAK 514

Query: 519 ILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           ++  MP  F      FPAGL++YW  +N +SI QQ +I +
Sbjct: 515 VMQLMPFFFTALFMMFPAGLVLYWVVNNTLSITQQYIITR 554


>gi|167856364|ref|ZP_02479091.1| putative inner membrane protein translocase component YidC
           [Haemophilus parasuis 29755]
 gi|167852502|gb|EDS23789.1| putative inner membrane protein translocase component YidC
           [Haemophilus parasuis 29755]
          Length = 546

 Score =  356 bits (913), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 149/569 (26%), Positives = 260/569 (45%), Gaps = 37/569 (6%)

Query: 1   MERNWNYFV--AIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           M  N +  +   + +S +I   WQ  Y  P I+         QT +  NQ  +  A+  +
Sbjct: 1   MNSNRSLLIMGLLLVSFLIFTQWQQDYN-PEIQAQKQAMAQAQTQQVANQSSDVPASSNV 59

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
               +  +    + ++   L  +++  G    D +L  Y+ ++ SN+P   L    N K 
Sbjct: 60  ASINEQSTKGKTITIETDVLRLTVDTLGGDVVDSDLLKYNAELDSNTPFELL--QDNGKV 117

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKILTPTT---PIKLVFKNANNILFERTISLD 175
            Y A+   V                      L        + L F+  + +  +      
Sbjct: 118 LYVAQSGLVGKNGIDTTAGRAQYQATAEKFALAEGQNEIDVPLTFEKDDVVYTKTFTLKR 177

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
             Y   +   + N S + +   P G++     ++A N         A    +   ++   
Sbjct: 178 GSYNVAVNYHIKNGSAETLEVQPYGQLKHTLVESAGNFAMPTYTGGAYSSSEVNYKKYSF 237

Query: 236 DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
           D    +  +      W  +   Y+ S +IP+++   +   +    G+      +      
Sbjct: 238 DEMAKANLSVDTKAGWAAVLQHYFVSAWIPNQDAENNLYTRT---GNGVGTIGYRGPVTQ 294

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           + P    T  + L+ G K+   +     +     F++ +D+GW +FIAKP+F L+++  +
Sbjct: 295 VAPNGEATIISHLWTGPKDQAAMAQVANN-----FDLTVDYGWAWFIAKPLFWLLTFIQS 349

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
           +V N+G+AI+  T+ VK + +PL K QY S A M+ +QP+I E+RE+F     Q + + M
Sbjct: 350 IVSNWGLAIIGVTIVVKTILYPLTKAQYTSMAKMRMLQPRIQEMRERFGD-DRQRMSQEM 408

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           ++LYK   +NP+ GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A DP  IF 
Sbjct: 409 MKLYKEEKVNPMGGCLPILLQMPIFIALYWTFMEAVELRHAPFFGWIQDLSAQDPYYIF- 467

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSF 534
                             P++M  SM++  KMSP P AD  Q  ++N+MPV+F      F
Sbjct: 468 ------------------PLLMGGSMYLLQKMSPTPIADPVQQKVMNFMPVMFTVFFLWF 509

Query: 535 PAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           P+GL++YW  SN+I+I QQ +I +    +
Sbjct: 510 PSGLVLYWLTSNLITIAQQWLIYRNLEKK 538


>gi|120556799|ref|YP_961150.1| putative inner membrane protein translocase component YidC
           [Marinobacter aquaeolei VT8]
 gi|166975875|sp|A1U7J4|OXAA_MARAV RecName: Full=Inner membrane protein oxaA
 gi|120326648|gb|ABM20963.1| protein translocase subunit yidC [Marinobacter aquaeolei VT8]
          Length = 567

 Score =  356 bits (913), Expect = 6e-96,   Method: Composition-based stats.
 Identities = 145/593 (24%), Positives = 243/593 (40%), Gaps = 60/593 (10%)

Query: 1   MERNWNYFVA--IALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPN----------- 47
           M+       A    +S ++V AW   Y  P+ E++   + +  +    +           
Sbjct: 1   MDIQRIVLFAGLAIVSYLMVLAWNEDYHQPQTEQVAEAQSSSDSSATNSTDDMILPEDNN 60

Query: 48  ------QVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDV 101
                     + +       +        + +        I+  G    D +L  Y   +
Sbjct: 61  AGGEEFATPETGSLASTSANSDQDLADRFITVTTDVYELKIDRVGGNVVDSSLLQYDESL 120

Query: 102 SSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILT-----PTTPI 156
            S  P+  L +   +   Y  E   +                                 I
Sbjct: 121 DSEQPLKLLTN--TSTRTYLLESGLIGRDGPDGSQAGEAPVFQAETGSYQLAEGEDELTI 178

Query: 157 KLVFKNANNILFERTISL-DEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFG 215
            LV+   + +   +   L    Y   +   + N S    + +  G+I+R +    T+   
Sbjct: 179 NLVYTTDSGVAITKRYHLARNSYQIDVSYLIDNRSESPWQGNFTGKIVRDQAPDPTSQAS 238

Query: 216 V----QEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSF 271
           +      G +    +    +  + D+      N   +N WL     Y+ + +IP ++   
Sbjct: 239 MGIRAYLGMVISTPEDPYEKYDFEDL-SEKRVNQSVTNGWLAFLQHYFLTAWIPERDQKA 297

Query: 272 HSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFE 331
             Q     D    +   F     T+ PG++       + G K    +         P  +
Sbjct: 298 QFQTTRRGD---LHVMGFVYPATTVAPGETAEVGATAYVGPKIIDRLEALA-----PNLD 349

Query: 332 MLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKN 391
             +D+GW +FI+ P+F ++ +FY LVGN+G+AI+L TV VK +FF L+   Y S A M+ 
Sbjct: 350 RTVDFGWLFFISLPLFYILEWFYGLVGNWGVAIILLTVLVKAVFFHLSATSYRSMAKMRA 409

Query: 392 IQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISL 451
           + P++  L+E +     Q + + M+ LYK   INPL GC PIL+Q+PVF ++Y V+  S+
Sbjct: 410 VAPQLTRLKELYGD-DRQRMSQEMMALYKREKINPLGGCLPILVQMPVFISLYWVLFESV 468

Query: 452 EMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP 511
           ++RHAPF  WI+DL+  DP                     I PI+M  SMFIQM ++P P
Sbjct: 469 QLRHAPFMLWIQDLSQMDPYF-------------------ILPILMGASMFIQMSLNPTP 509

Query: 512 ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEI 564
            D  QA I+  MP++F      FPAGL++YW  +N++SI QQ  I +   AE 
Sbjct: 510 PDPMQAKIMKLMPLIFTVFFLWFPAGLVLYWLVNNILSISQQWYITRKIEAET 562


>gi|145638178|ref|ZP_01793788.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae PittII]
 gi|145272507|gb|EDK12414.1| putative inner membrane protein translocase component YidC
           [Haemophilus influenzae PittII]
 gi|309751334|gb|ADO81318.1| Inner membrane translocation protein YidC [Haemophilus influenzae
           R2866]
          Length = 541

 Score =  356 bits (912), Expect = 7e-96,   Method: Composition-based stats.
 Identities = 139/567 (24%), Positives = 253/567 (44%), Gaps = 38/567 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
             +    + +AL  I    +Q + +         +  +I           S +  + D +
Sbjct: 1   MDSRRSLLVLALIFISFLVYQQWQLDKNPPVQTEQTTSITATSDVPASSPSNSQAIADSQ 60

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
               +    + L+N      I+  G       L  Y  ++ S +P   L      ++ Y 
Sbjct: 61  ----TRGRIITLENDVFRLKIDTLGGDVISSELLKYDAELDSKTPFELL--KDTKEHIYI 114

Query: 122 AELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDEH 177
           A+   +   N I+       + +            +  + L+F+       +  +     
Sbjct: 115 AQSGLIG-KNGIDTRFGRAQYQIEGDNFKLAEGQESLSVPLLFEKDGVTYQKIFVLKRGS 173

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           Y   +   + N S   I   P G++     +++ N         A    ++  ++     
Sbjct: 174 YDLGVDYKIDNQSGQAIEVEPYGQLKHSIIESSGNVAMPTYTGGAYSSSETNYKKYSFAD 233

Query: 238 EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITIL 297
            + +  +      W+ +   Y+ S +IP+++ +    +      +      +    ++I 
Sbjct: 234 MQDNNLSIDTKAGWVAVLQHYFVSAWIPNQDVNNQL-YTITDSKNNVASIGYRGPVVSIP 292

Query: 298 PGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLV 357
            G   T T+ L+ G K    +     +      ++ +D+GW +FIAKP+F L+++   +V
Sbjct: 293 AGSQETITSSLWTGPKLQNQMATVANN-----LDLTVDYGWAWFIAKPLFWLLTFIQGIV 347

Query: 358 GNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQ 417
            N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++
Sbjct: 348 SNWGLAIICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRERFGD-DRQRMSQEMMK 406

Query: 418 LYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLF 477
           LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A DP       
Sbjct: 407 LYKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQDPYY----- 461

Query: 478 GILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPA 536
                         I PI+M +SMF+  KMSP P  D  Q  ++N+MP++F+     FP+
Sbjct: 462 --------------ILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLIFMVFFLWFPS 507

Query: 537 GLIIYWSWSNVISIVQQAVIMKMHGAE 563
           GL++YW  SN+I+I QQ +I +    +
Sbjct: 508 GLVLYWLVSNLITIAQQQLIYRGLEKK 534


>gi|88811304|ref|ZP_01126560.1| 60 kDa inner membrane insertion protein [Nitrococcus mobilis
           Nb-231]
 gi|88791843|gb|EAR22954.1| 60 kDa inner membrane insertion protein [Nitrococcus mobilis
           Nb-231]
          Length = 548

 Score =  355 bits (911), Expect = 9e-96,   Method: Composition-based stats.
 Identities = 141/561 (25%), Positives = 229/561 (40%), Gaps = 30/561 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           ME     F+ +AL  ++   W  +           +                     +  
Sbjct: 1   MENQR-LFLFLALGAVLFLLWDAWQQDYGPRPPTPQSTEQAVQAPQADGPAEELPTELRQ 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           +A   +   R+ +        IN  G       L  +       +P   L          
Sbjct: 60  QAGLAAQGMRISVVTDLFAIEINTVGGGIGSAKLLKHATSTDDPAPFTLLRDQGKPLFVV 119

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILF-ERTISLDEHYL 179
            A L     +         +               + LV+   N I    R I     Y 
Sbjct: 120 QAGLRAKEGSAPGTQARFQSRQKAYQLASGEQQLVVPLVWHGPNGITVTRRYIFQRGKYT 179

Query: 180 FKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKY-SDIE 238
             I   V N S          +++R +        G        +       QK   D  
Sbjct: 180 IDIEQEVQNASAAPWSAYQYTQLLRGEENKTGGLAGQVAYIGGAIYSPDDKYQKISFDEM 239

Query: 239 KSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILP 298
           +    +    N W+ +   Y+ +  +P +      +F     G   +    S+   TI P
Sbjct: 240 QEQALDRTVQNGWVAMVQHYFLAAMVPPRG--MTERFYSRIVGGDLFSLGMSSPWQTIQP 297

Query: 299 GKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVG 358
           G+S T    L+ G K+   +            E+ +D+G F  IAKPMF+++S+F+ +VG
Sbjct: 298 GQSGTFQTQLYLGPKDQERMASVAS-----GLELTVDYGIFTIIAKPMFVVLSWFHAVVG 352

Query: 359 NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQL 418
           N+G AI+  TV +K +FF L++  Y S A M+ +QP++ +L+E+F     Q + + ++ L
Sbjct: 353 NWGWAIVFLTVLIKAVFFKLSETSYRSMARMRKLQPRMQQLKEQFGD-DRQRMNQELMTL 411

Query: 419 YKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFG 478
           YK   +NPL GC PIL+QIPVF A+Y V+  S+E+R APF  W++DL+A DP        
Sbjct: 412 YKREKVNPLGGCLPILIQIPVFIALYWVLLESVELRQAPFILWLRDLSAPDPYY------ 465

Query: 479 ILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGL 538
                        + PIIM L+M  Q +++P P D  Q  I+ +MPVVF      FP GL
Sbjct: 466 -------------VLPIIMGLTMLAQQRLNPAPMDPIQQKIMLFMPVVFTGFFLFFPGGL 512

Query: 539 IIYWSWSNVISIVQQAVIMKM 559
           ++Y++ +N +SI+QQ +I + 
Sbjct: 513 VLYYTVNNSLSILQQWLITRR 533


>gi|152998480|ref|YP_001343315.1| 60 kDa inner membrane insertion protein [Marinomonas sp. MWYL1]
 gi|189036353|sp|A6W3V1|OXAA_MARMS RecName: Full=Inner membrane protein oxaA
 gi|150839404|gb|ABR73380.1| 60 kDa inner membrane insertion protein [Marinomonas sp. MWYL1]
          Length = 551

 Score =  355 bits (911), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 149/581 (25%), Positives = 251/581 (43%), Gaps = 49/581 (8%)

Query: 1   MERNWNYFV-AIALS-VIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVD-------N 51
           M+    +   A+ +S  ++   W   Y     + +    ++          D        
Sbjct: 1   MDFRRYFLWGALFISGYLLFLQWSQDYGPQSTQSVAQSTQSQSETNSQMSDDLPMATQST 60

Query: 52  SYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLL 111
           + A   I      ++    +E+   +L  +IN  G    +  L  Y  ++    P V L 
Sbjct: 61  TEANAEIPQSVTKIAPGKLIEVTTDTLRVAINPVGGDLVEAALLQYKKELGQPDPFVIL- 119

Query: 112 SPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNIL 167
               ++  Y  +   V        P    V+              +  + L + +A  + 
Sbjct: 120 -EDGSERTYVTQSGLVGQDGPDASPEGRPVYQSEKTAYTLADGENSLDVNLYYTDAKGVK 178

Query: 168 FERTI-SLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT----ATNTFGVQEGFIA 222
           + +T   +   Y  + + TV N S +  R +   +I R          +       G   
Sbjct: 179 YTKTFRFMKGKYRIRQLITVDNTSSNTWRGNLFAQIKRDNTPDPSKATSMGLQPYLGGAI 238

Query: 223 VLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGH 282
                   +  +SD+++  I     +  W+ +   Y+ S +IP +      Q +   D +
Sbjct: 239 SDEQTKYTKVSFSDMKEDPIKTT-TTKGWVAVLQHYFVSAWIPEQGQKVTLQARTNGDFN 297

Query: 283 ARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFI 342
                 F+   + I PGK  T ++  + G K    +    ++      ++ +D+GW +++
Sbjct: 298 ---IIGFTGTSVEIAPGKQGTLSSTFYVGPKLQDHLESTAEN-----LDLTVDYGWLWWL 349

Query: 343 AKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREK 402
           AKP+F L++   + V N+GIAI+L  V VK +FF L+   Y S A M+   P+I +L+EK
Sbjct: 350 AKPLFWLLTLIQSFVINWGIAIILIVVCVKAIFFKLSAASYRSMAKMRKFGPEIAKLKEK 409

Query: 403 FKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWI 462
           +     Q + + M+ LYK   INPL GC PIL+Q+PVF ++Y V+  S+E+RHAPF+ WI
Sbjct: 410 YGD-DRQKMSQEMMALYKKEKINPLGGCLPILVQMPVFLSLYWVLMESVELRHAPFFLWI 468

Query: 463 KDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNW 522
            DL+  DP                     I PI+M +SMF+Q  ++P P D  QA I+  
Sbjct: 469 HDLSVMDPYF-------------------ILPILMGISMFVQQSLNPTPPDPMQARIMKI 509

Query: 523 MPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           MPV F      FPAGL++YW  +N +SI+QQ VI K    E
Sbjct: 510 MPVAFSIFFLWFPAGLVLYWVTNNTLSILQQYVITKRIENE 550


>gi|229524907|ref|ZP_04414312.1| OxaI/YidC membrane insertion protein [Vibrio cholerae bv. albensis
           VL426]
 gi|229338488|gb|EEO03505.1| OxaI/YidC membrane insertion protein [Vibrio cholerae bv. albensis
           VL426]
          Length = 541

 Score =  355 bits (910), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 139/570 (24%), Positives = 245/570 (42%), Gaps = 41/570 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL+++    +Q + V         ++             +      + +
Sbjct: 1   MDSQRN-ILLIALALVSFLLFQQWQVAKNPAPQATQQAQSTGAAPAPSFSDELDPTPVQN 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
                + +  + +    L  SI+  G       L  Y  +++S    V L +     + +
Sbjct: 60  ---VAAKAKTITVSTDVLTLSIDTLGGDVVSAKLNQYSEELNSPESFVLLQNTQG--HQF 114

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDE 176
            A+   V         N+   + + +             I + ++       +  I    
Sbjct: 115 IAQSGLVGPQGIDVTSNNRPAYQVSADSFTLAEGQDELRIPMTYQANGIDYTKTFILKRG 174

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYS 235
            Y   +V  V NNS  +        + ++   +  N       G      D    +  + 
Sbjct: 175 SYAVDVVFDVANNSGSEATLGMYAHLRQNLLDSGGNLAMPTYRGGAYSTSDVRYKKYSFD 234

Query: 236 DIEKSSIS-NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
           D++  ++S     + +W+ +   Y+AS +IP  E       + +++              
Sbjct: 235 DMKDRNLSAPNDVTVNWVAMIQHYFASAWIPRDEPQTQLYSRVINNLGD---MGIRTPNK 291

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
           TI  G        L+ G K    +         P  ++++D+GW +FIAKP+  L+S   
Sbjct: 292 TIANGDKAEFEATLWVGPKLQEQMAAVA-----PHLDLVVDYGWLWFIAKPLHWLLSVIQ 346

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
           ++V N+G+AI+  T  V+   +PL K QY S A M+ +QPK+  +RE+      Q + + 
Sbjct: 347 SVVINWGLAIICLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLQAMRERIGD-DRQRMSQE 405

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           M++LYK   +NPL GC PILLQ+P+F A+Y  +  S+E+RH+PF+GWI DL+A DP    
Sbjct: 406 MMELYKKEKVNPLGGCLPILLQMPIFIALYWALMESVELRHSPFFGWIHDLSAQDPYY-- 463

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSS 533
                            I P++M  SMF+  KMSP    D  Q  I+ +MPV+F F    
Sbjct: 464 -----------------ILPLLMGASMFVIQKMSPTTITDPMQQKIMTFMPVMFTFFFLW 506

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           FP+GL++YW  SN+++++QQ +I K    +
Sbjct: 507 FPSGLVLYWLVSNIVTLIQQTLIYKALEKK 536


>gi|70733513|ref|YP_263288.1| putative inner membrane protein translocase component YidC
           [Pseudomonas fluorescens Pf-5]
 gi|123651831|sp|Q4K395|OXAA_PSEF5 RecName: Full=Inner membrane protein oxaA
 gi|68347812|gb|AAY95418.1| inner membrane protein, 60 kDa [Pseudomonas fluorescens Pf-5]
          Length = 566

 Score =  355 bits (910), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 143/587 (24%), Positives = 243/587 (41%), Gaps = 54/587 (9%)

Query: 2   ERNWNYFVAIAL---SVIIVYAWQNFYVYPRIEEMNNERKNIQ---------TVKQPNQV 49
                  + +AL   S ++V  W   Y    +   N                T    + +
Sbjct: 1   MDIKRTILIVALAIVSYVMVLKWNQDYGQAALPTQNVASSTTAPGLPDAPTGTSAANDDI 60

Query: 50  DNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVT 109
             + +       A   +    +++K   L  +++ +G     L L  Y            
Sbjct: 61  PRAASDTTAPAEAPVAASKDLIQIKTDVLDLAVDPQGGDIAQLRLPLYPRRQDHPEIPFQ 120

Query: 110 LLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANN 165
           L   +  +  Y A+   + +      P    +++                + L F     
Sbjct: 121 LF-DNGNERTYLAQSGLIGSNGPDASPAGRPIYSAEKKSYQLADGQDQLVVDLKFSKDGV 179

Query: 166 ILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGV----QEGFI 221
              +R       Y   +   + N S      +   ++ R      +++         G  
Sbjct: 180 NYIKRFTLKRGLYDITVSYLIDNESAQPWTGAMFAQLKRDASSDPSSSTATGTATYLGAA 239

Query: 222 AVLGDKSLVEQKYSDIEKSSISN------FHESNSWLGISDKYWASVFIPSKETSFHSQF 275
                +   +    D++K +          +    W+     Y+ + +IP K  +     
Sbjct: 240 LWTSSEPYKKVSMKDMDKVNEDKSKAPITENVQGGWVAWLQHYFVTAWIPPKGENNQVLA 299

Query: 276 KYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLID 335
           +  S G   Y   ++   +T+ PG    T+  L+AG K    +         P  E+ +D
Sbjct: 300 RKDSKG--NYIIGYTGPSMTVAPGAKAETSAILYAGPKSQAVLKELS-----PGLELTVD 352

Query: 336 WGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPK 395
           +G+ +FIA+P+F L+ + ++LVGN+G +I+  T+ +K +FFPL+   Y S A M+ + PK
Sbjct: 353 YGFLWFIAQPIFWLLQHIHSLVGNWGWSIIFLTMLIKGIFFPLSAASYKSMARMRAVAPK 412

Query: 396 IDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRH 455
           +  L+EKF     Q + +AM++LYK   INPL GC PIL+Q+PVF ++Y V+  S+EMR 
Sbjct: 413 LAALKEKFGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLSLYWVLLESVEMRQ 471

Query: 456 APFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKG 515
           APF  WI DL+  DP                     I PIIM  +MFIQ +++P P D  
Sbjct: 472 APFMLWITDLSIKDPFF-------------------ILPIIMGATMFIQQQLNPTPPDPM 512

Query: 516 QAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           QA ++  MP++F F    FPAGL++YW  +N +SI QQ  I +   A
Sbjct: 513 QAKVMKMMPIIFTFFFLWFPAGLVLYWVVNNCLSIAQQWYITRKIEA 559


>gi|312964014|ref|ZP_07778485.1| preprotein translocase YidC subunit [Pseudomonas fluorescens WH6]
 gi|311282049|gb|EFQ60659.1| preprotein translocase YidC subunit [Pseudomonas fluorescens WH6]
          Length = 567

 Score =  355 bits (910), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 146/589 (24%), Positives = 246/589 (41%), Gaps = 56/589 (9%)

Query: 1   MERNWNYFVAIAL---SVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           M+      + +AL   S ++V  W   Y    +   N     + T         + AA  
Sbjct: 1   MDI-KRTILIVALAIVSYVMVLKWNQDYGQAALPTQNVAANAVPTGLPDAASGTNTAASD 59

Query: 58  IDDRAQ----------ALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPI 107
              RA             + +  +++K   L  +I+ +G     L L  Y          
Sbjct: 60  DIPRAAGETKAPAEVAVATSTDLIQIKTDVLDLAIDPQGGDVAKLTLPLYPRRQDHPEIP 119

Query: 108 VTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNA 163
             L   +  +  Y A+   + T           +++                + L F   
Sbjct: 120 FQLF-DNGGERVYQAQSGLIGTNGPDASAAGRPIFSSEKKSYQLADGQDQLVVDLKFSKD 178

Query: 164 NNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGV----QEG 219
                +R       Y   +   + N S      +   ++ R      +++         G
Sbjct: 179 GVNYIKRFTLKRGLYDIVVTYLIDNQSAQPWTGAMFAQLKRDASSDPSSSTATGTATYLG 238

Query: 220 FIAVLGDKSLVEQKYSDIEK------SSISNFHESNSWLGISDKYWASVFIPSKETSFHS 273
                  +   +    D++K       +   ++ +  W+     Y+ + +IP    +   
Sbjct: 239 AALWTSSEPYKKVSMKDMDKVAEDKLKAPITYNVNGGWVAWLQHYFVTAWIPQPGQNNAV 298

Query: 274 QFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEML 333
             +  S G   Y   ++   +T+ PG    T+  L+AG K    +         P  E+ 
Sbjct: 299 LARKDSKG--NYIIGYTGPAMTVAPGAKAETSATLYAGPKSQAVLKELS-----PGLELT 351

Query: 334 IDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQ 393
           +D+G  +FIA+P+F L+ + +++VGN+G +I+  T+ +K LFFPL+   Y S A M+ + 
Sbjct: 352 VDYGILWFIAQPIFWLLQHIHSIVGNWGWSIIFLTMLIKGLFFPLSAASYKSMARMRAVA 411

Query: 394 PKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEM 453
           PK+  L+E+      Q + +AM++LYK   INPL GC PIL+Q+PVF ++Y V+  S+EM
Sbjct: 412 PKLAALKEQHGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLSLYWVLLESVEM 470

Query: 454 RHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPAD 513
           R APF  WI DL+  DP                     I PIIM  +MFIQ +++P P D
Sbjct: 471 RQAPFMLWITDLSIKDPFF-------------------ILPIIMGATMFIQQRLNPTPPD 511

Query: 514 KGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
             QA ++  MP++F F    FPAGL++YW  +NV+SI QQ  I +   A
Sbjct: 512 PMQAKVMKMMPIIFTFFFLWFPAGLVLYWVVNNVLSISQQWYITRKIEA 560


>gi|229593497|ref|YP_002875616.1| putative inner membrane protein translocase component YidC
           [Pseudomonas fluorescens SBW25]
 gi|259515713|sp|C3K1G2|OXAA_PSEFS RecName: Full=Inner membrane protein oxaA
 gi|229365363|emb|CAY53750.1| putative inner membrane protein [Pseudomonas fluorescens SBW25]
          Length = 560

 Score =  355 bits (910), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 148/579 (25%), Positives = 244/579 (42%), Gaps = 50/579 (8%)

Query: 2   ERNWNYFVAIAL---SVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
                  + +AL   S ++V  W   Y    +   N              + N+ +A   
Sbjct: 1   MDIKRTILIVALAIVSYVMVLKWNQDYGQAALPTQNVATNQAAPAIPDTPLGNNASASAD 60

Query: 59  DDRAQALSMSPR----------VELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIV 108
              A   + +P           + +K   L  +I+ +G     L L  Y           
Sbjct: 61  VPSANGETSAPLETPVVTNKDLIHVKTDVLDLAIDPQGGDIAQLKLPLYPRRQDHPDVPF 120

Query: 109 TLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNAN 164
            L   +  +  Y A+     T           V++                + L F    
Sbjct: 121 QLF-DNGGERTYLAQSGLTGTNGPDARATGRPVYSTEQKTYQLADGQNQLNVDLKFSLDG 179

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGV----QEGF 220
               +R       Y  K+   + N S      +   ++ R      +++         G 
Sbjct: 180 VNYIKRFSFTRGLYDLKVTYLIDNESGKPWSGNLFAQLKRDASSDPSSSTATGTATYLGA 239

Query: 221 IAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
                ++   +    DI+K S+        W+     Y+ + +IP+K  +   Q +   D
Sbjct: 240 ALWTSNEPYKKVSMKDIDKGSLKET-VQGGWVAWLQHYFVTAWIPNKGDANLVQTR--KD 296

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
               Y   F+   +T+ PG    T+  L+AG K    +         P  E+ +D+G+ +
Sbjct: 297 SQGNYIIGFTGPALTVAPGAKAETSATLYAGPKSQAVLKELS-----PGLELTVDYGFLW 351

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           FIA+P+F L+ + +++VGN+G +I+  T+ +K +FFPL+   Y S A M+ + PK+  L+
Sbjct: 352 FIAQPIFWLLQHIHSIVGNWGWSIIFLTMLIKGIFFPLSAASYKSMARMRAVAPKLAALK 411

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E+      Q + +AM++LYK   INPL GC PIL+Q+PVF ++Y V+  S+EMR APF  
Sbjct: 412 EQHGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLSLYWVLLESVEMRQAPFML 470

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMIL 520
           WI DL+  DP                     I PIIM  +MFIQ +++P P D  QA ++
Sbjct: 471 WITDLSIKDPFF-------------------ILPIIMGATMFIQQRLNPTPPDPMQAKVM 511

Query: 521 NWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKM 559
             MP++F F    FPAGL++YW  +NV+SI QQ  I + 
Sbjct: 512 KMMPIIFTFFFLWFPAGLVLYWVVNNVLSISQQWYITRK 550


>gi|332288922|ref|YP_004419774.1| putative inner membrane protein translocase component YidC
           [Gallibacterium anatis UMN179]
 gi|330431818|gb|AEC16877.1| putative inner membrane protein translocase component YidC
           [Gallibacterium anatis UMN179]
          Length = 540

 Score =  355 bits (909), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 147/566 (25%), Positives = 246/566 (43%), Gaps = 37/566 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
             +    + IAL  I    +Q + +    +     +   QT    ++V  + +       
Sbjct: 1   MDSRRSLLVIALLFISFLIYQQWEIDNNPQP---AQTATQTQVDKSEVPTTVSTAANTTI 57

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
                    + L++  L   I+  G    +  L  Y  ++ S +P   L   +  +  Y 
Sbjct: 58  DNNQQQGKIITLQSDVLRLKIDTLGGDIVEAQLLKYGAELHSETPFALL--KNTPQQVYI 115

Query: 122 AELDYVSTANNIELPNSNTVWNLISG---KILTPTTPIKLVFKNANNILFERTISLDEHY 178
           A+   +    +  +                       +   F        +        Y
Sbjct: 116 AQSGLIGANGSDTVAGRADYQVEGDNFTLAEGQNELSVPFTFTKDGVTYRKIFTLSRNSY 175

Query: 179 LFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIE 238
             K+   VTNNS   I+  P  ++     +++ N         A    ++  ++   +  
Sbjct: 176 DVKVNYEVTNNSGATIQVQPYAQLKHTLVESSGNIAMPTYTGGAYSSSETNYKKYSFEDM 235

Query: 239 KSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILP 298
           +           W  I   Y+ S +IP+++           D        F     +I  
Sbjct: 236 QKENLAIKTKQGWAAILQHYFVSAWIPNQDADNQLYTSTQGDFA---YIGFRGPVTSIAN 292

Query: 299 GKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVG 358
           G + T ++ L+ G K    +         P  ++ +D+GW +FIAKP+F L+ +  +LV 
Sbjct: 293 GATDTISSQLWVGPKLQNEMETVA-----PHLDLTVDYGWAWFIAKPLFWLLQFIQSLVH 347

Query: 359 NFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQL 418
           N+G+AI+  T+ VK + +PL K QY S A M+ +QPKI E+RE+F     Q + + M++L
Sbjct: 348 NWGLAIIGVTIVVKAILYPLTKAQYTSMAKMRMLQPKIQEMRERFGD-DRQRMSQEMMKL 406

Query: 419 YKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFG 478
           YK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A DP        
Sbjct: 407 YKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQDPYY------ 460

Query: 479 ILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPAG 537
                        I P++M  SMF+  KMSP P AD  Q  ++ +MPV+F F    FP+G
Sbjct: 461 -------------ILPLLMGASMFLLQKMSPTPVADPMQQKVMMFMPVMFTFFFLWFPSG 507

Query: 538 LIIYWSWSNVISIVQQAVIMKMHGAE 563
           L++YW  SN+I+IVQQ +I +    +
Sbjct: 508 LVLYWLVSNLITIVQQQLIYRGLEKK 533


>gi|327482918|gb|AEA77325.1| Inner membrane protein translocase component YidC, long form
           [Vibrio cholerae LMA3894-4]
          Length = 541

 Score =  355 bits (909), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 140/570 (24%), Positives = 243/570 (42%), Gaps = 41/570 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL+++    +Q + V         ++             +        +
Sbjct: 1   MDSQRN-ILLIALALVSFLLFQQWQVAKNPAPQAIQQAQSTGAAPAPSFSDELDPTPAQN 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
                + +  + +    L  SI+  G       L  Y  +++S    V L +     + +
Sbjct: 60  ---VAAKAKTITVSTDVLTLSIDTLGGDVVSAKLNQYSEELNSPESFVLLQNTQG--HQF 114

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDE 176
            A+   V         N+   + + +             I + ++       +  I    
Sbjct: 115 IAQSGLVGPQGIDVTSNNRPAYQVSADSFTLAEGQDELRIPMTYQANGIDYTKTFILKRG 174

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYS 235
            Y   +V  V NNS  +        + ++   +  N       G      D    +  + 
Sbjct: 175 SYAVDVVFDVANNSGSEATLGMYAHLRQNLLDSGGNLAMPTYRGGAYSTSDVRYKKYSFD 234

Query: 236 DIEKSSIS-NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
           D++  ++S     + +W+ +   Y+AS +IP  E       + +++              
Sbjct: 235 DMKDRNLSAPNDVTVNWVAMIQHYFASAWIPRDEPQAQLYSRVINNLGD---MGIRTPNK 291

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
           TI  G        L+ G K    +         P  ++++D+GW +FIAKP+  L+S   
Sbjct: 292 TITNGDKAEFEATLWVGPKLQDQMAATA-----PNLDLVVDYGWLWFIAKPLHWLLSVIQ 346

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
             VGN+G+AI+  T  V+   +PL K QY S A M+ +QPK+  +RE+      Q + + 
Sbjct: 347 TFVGNWGVAIICLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLQAMRERIGD-DRQRMSQE 405

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           M++LYK   +NPL GC PILLQ+P+F A+Y  +  S+E+RH+PF+GWI DL+A DP    
Sbjct: 406 MMELYKKEKVNPLGGCLPILLQMPIFIALYWALMESVELRHSPFFGWIHDLSAQDPYY-- 463

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSS 533
                            I P++M  SMF+  KMSP    D  Q  I+ +MPV+F F    
Sbjct: 464 -----------------ILPLLMGASMFVIQKMSPTTITDPMQQKIMTFMPVMFTFFFLW 506

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           FP+GL++YW  SN+++++QQ +I K    +
Sbjct: 507 FPSGLVLYWLVSNIVTLIQQTLIYKALEKK 536


>gi|330812749|ref|YP_004357211.1| Sec protein secretion system, subunit YidC [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327380857|gb|AEA72207.1| Putative Sec protein secretion system, subunit YidC [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 560

 Score =  355 bits (909), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 149/582 (25%), Positives = 247/582 (42%), Gaps = 50/582 (8%)

Query: 2   ERNWNYFVAIAL---SVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
                  + +AL   S ++V  W   Y    +   N    N         V N+ A+   
Sbjct: 1   MDIKRTILIVALAIVSYVMVLKWNQDYGQAALPTQNVAASNTAPSLPDAPVGNNAASNDD 60

Query: 59  DDRAQALSMSP----------RVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIV 108
             RA + + +P           +++K   L  +I+ +G     L L  Y           
Sbjct: 61  IPRAASDTSAPAEAPVAVSKDLIQIKTDVLELAIDPQGGDVAQLKLPLYPRRQDHPEIPF 120

Query: 109 TLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNAN 164
            L   +  +  Y A+   + T      P    +++                + L F    
Sbjct: 121 QLF-DNGNERTYLAQSGLIGTNGPDSNPAGRPIYSAEKKTYQLADGQDQLVVDLKFSKDG 179

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGV----QEGF 220
               +R       Y   +   + N S      +   ++ R      +++         G 
Sbjct: 180 VNYIKRFTLKRGLYDVTVSYLIDNQSAQPWSGAMFAQLKRDASSDPSSSTATGTATYLGA 239

Query: 221 IAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
                 +   +    D++K  +        W+     Y+ + +IP K  S   Q +  S 
Sbjct: 240 ALWTSSEPYKKVSMKDMDKGPLKET-VQGGWVAWLQHYFVTAWIPQKGDSNVVQTRKDSK 298

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
           G   +   ++   +T  PG    T+  L+AG K    +         P  E+ +D+G+ +
Sbjct: 299 G--NFIIGYTGPTLTAAPGAKAETSAILYAGPKSQAVLKELS-----PGLELTVDYGFLW 351

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           FIA+P+F L+ + +++VGN+G +I+  T+ +K LFFPL+   Y S A M+ + PK+  L+
Sbjct: 352 FIAQPIFWLLQHIHSIVGNWGWSIIFLTMLIKGLFFPLSAASYKSMARMRAVAPKLAALK 411

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           E+      Q + ++M++LYK   INPL GC PIL+Q+PVF ++Y V+  S+EMR APF  
Sbjct: 412 EQHGD-DRQKMSQSMMELYKKEKINPLGGCLPILVQMPVFLSLYWVLLESVEMRQAPFML 470

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMIL 520
           WI DL+  DP                     I PIIM  +MFIQ +++P P D  QA ++
Sbjct: 471 WITDLSIKDPFF-------------------ILPIIMGATMFIQQQLNPTPPDPMQAKVM 511

Query: 521 NWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
             MP++F F    FPAGL++YW  +NV+SI QQ  I +   A
Sbjct: 512 KMMPIIFTFFFLWFPAGLVLYWVVNNVLSITQQWYITRKIEA 553


>gi|149190488|ref|ZP_01868759.1| putative inner membrane protein translocase component YidC [Vibrio
           shilonii AK1]
 gi|148835742|gb|EDL52708.1| putative inner membrane protein translocase component YidC [Vibrio
           shilonii AK1]
          Length = 540

 Score =  355 bits (909), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 144/570 (25%), Positives = 246/570 (43%), Gaps = 42/570 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + I L+++    +Q +  Y     +  ++    T+  P+  D    A     
Sbjct: 1   MDSQRN-ILLIGLALVSFLLFQQWQSYKNPAPVPTQQTQSSTLPAPSFADEHDPAPGQSQ 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
            A        + +K   L   IN  G       L  Y  ++ S+ P   L       + +
Sbjct: 60  TAA----EKIITVKTDVLTLGINTVGGDVVTAKLNEYATELESSEPFELLKDDQG--HQF 113

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDE 176
            A+   V          S   + + +             + + F+       +  I    
Sbjct: 114 IAQSGLVGPQGIDLSSTSRPAYTVSADSFTIADGQDELRVPMTFEANGISYTKTFILKRG 173

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYS 235
           +Y   +   V NNS     F     + ++      + T     G      D    +  + 
Sbjct: 174 NYAIDVEYDVDNNSGQNATFGMYAHLRQNLQDKGGSITMPTYNGGAYSTQDVRYKKYSFE 233

Query: 236 DIEKSSISNFHES-NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
           D++  ++S        W  +   Y+A+ +IP +    +   + + +              
Sbjct: 234 DMQDRNLSLNLTDGQGWAAMIQHYFAAAWIPREAPGTNLYTRVIGNLGD---IGVRMPNA 290

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
           TI  G+S T    L+AG K    +         P  ++++D+GW +FIAKP+  L+S+  
Sbjct: 291 TIADGQSATLKATLWAGPKLQKQMAETA-----PNLDLVVDYGWLWFIAKPLHTLLSFIQ 345

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
            +V N+G+AI+  T  V+   +PL K QY S A M+ +QPK+  +RE+      Q + + 
Sbjct: 346 GIVVNWGLAIICLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLQAMRERIGD-DRQRMSQE 404

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           M++LYK   +NPL GC PILLQ+P+F A+Y  +  S+E+RH+PF+GWI DL+A DP    
Sbjct: 405 MMELYKKEKVNPLGGCLPILLQMPIFIALYWALMESVELRHSPFFGWIHDLSAQDPYY-- 462

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSS 533
                            I P++M  SMF+  KMSP    D  Q  I+ +MPV+F F    
Sbjct: 463 -----------------ILPLLMGASMFLIQKMSPTTVTDPMQQKIMTFMPVMFTFFFLW 505

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           FP+GL++YW  SN+++++QQ +I +    +
Sbjct: 506 FPSGLVLYWLVSNIVTLIQQTLIYRALEKK 535


>gi|187479885|ref|YP_787910.1| putative inner membrane protein translocase component YidC
           [Bordetella avium 197N]
 gi|123513533|sp|Q2KTI5|OXAA_BORA1 RecName: Full=Inner membrane protein oxaA
 gi|115424472|emb|CAJ51026.1| inner-membrane protein insertion factor [Bordetella avium 197N]
          Length = 559

 Score =  354 bits (908), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 148/587 (25%), Positives = 253/587 (43%), Gaps = 54/587 (9%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNF---------YVYPRIEEMNNERKNIQTVKQPNQVDN 51
           M+      + +  S  ++  W N+         +  P  E+      N Q    P     
Sbjct: 1   MDI-RRTVLWMIFSFSLLLLWNNWQIHNGQPALFGGPSPEQNAPATANNQAATNPASNTP 59

Query: 52  SYAAVLID---------DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVS 102
           +                  A A + +  V +    L  + +  GAQ     L  Y     
Sbjct: 60  AVPNAPAATSAPSSVPGSTAPAPAQAQEVVITTDVLRLTFSSTGAQIIRAELLKYPATAG 119

Query: 103 SNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKN 162
           S+ P+V L    +    Y A+   +    N     +         ++      ++   ++
Sbjct: 120 SDQPMVLL--DRSAGLTYTAQTGVIGAGQNFPTHLTPFAVTTNERELTGDKLVVRFEAES 177

Query: 163 ANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHK--PQTATNTFGVQEGF 220
               + +        Y   +   VTN        S   ++ R    P   ++ +    G 
Sbjct: 178 GGLRVIKTFTLDRGSYDVHVRHDVTNVGTAAQHPSVYLQLERDGNDPAGTSSFYHTFTGV 237

Query: 221 IAVLGDKSLVEQKYSDIEKSSISNFHE-SNSWLGISDKYWASVFIPSKETSFHSQFKYLS 279
                     +  +SDI K+  S   +  N W+GI   Y+A+ ++P + T   +    L 
Sbjct: 238 AVYSEQDKFQKVTFSDIAKNKASYIKQADNGWIGIVQHYFATAWVPKEGTPRTNDLLQLQ 297

Query: 280 DGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWF 339
                 +A        + PG ++++   L+ G ++   +         P  E+++D+GW 
Sbjct: 298 PNLFAARA--IEALGEVAPGATVSSDAQLWVGPQDQQAMAAVA-----PGLELVVDYGWL 350

Query: 340 YFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDEL 399
             IAKP+F LM++ ++L+GN+G  I+  TV +K +F+PLA   Y S A MK + P++  L
Sbjct: 351 TIIAKPLFTLMTWLHSLLGNWGWTIVALTVIIKAVFYPLASASYRSMARMKQVAPRLQAL 410

Query: 400 REKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFW 459
           +EK+     Q L +AM+++Y+T  INPL GC P+++QIPVF A+Y V+  S+EMR AP+ 
Sbjct: 411 KEKYGD-DRQKLNQAMMEMYRTEKINPLGGCLPMVVQIPVFIALYWVLLASVEMRGAPWI 469

Query: 460 GWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMI 519
            WI DL+  DP                     I P +M  +MF+Q+K++P P D  QA +
Sbjct: 470 LWIHDLSVRDPYF-------------------ILPAVMMATMFLQIKLNPTPPDPVQAKV 510

Query: 520 LNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK---MHGAE 563
           +  MP+VF   +  FPAGL++YW  +N +SI+QQ  I +      A+
Sbjct: 511 MMVMPLVFGGMMFFFPAGLVLYWCVNNTLSILQQWSITRSITRQTAK 557


>gi|52424536|ref|YP_087673.1| putative inner membrane protein translocase component YidC
           [Mannheimia succiniciproducens MBEL55E]
 gi|81691469|sp|Q65VC2|OXAA_MANSM RecName: Full=Inner membrane protein oxaA
 gi|52306588|gb|AAU37088.1| YidC protein [Mannheimia succiniciproducens MBEL55E]
          Length = 540

 Score =  354 bits (908), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 138/570 (24%), Positives = 257/570 (45%), Gaps = 44/570 (7%)

Query: 1   MERNWNYF--VAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           M+   +      + +S ++   WQ  Y  P+       +      + P    ++   V  
Sbjct: 1   MDSRRSLLVLALLFISFLVYEQWQMDYNTPKPVATEQAQAVSSNAEMPASTSSTEGTV-- 58

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
                 ++    + ++N      ++  G    + +L  Y  +++S++  + L    N  N
Sbjct: 59  ----DNVAQGKIISIQNDVFTLKVDTLGGDVVESSLTNYAAELNSDARFILL---QNKPN 111

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFK---NANNILFERTISLD 175
             +     +   N I+       + + + +        +L        + +++ +   + 
Sbjct: 112 EVYVAQSGLIGKNGIDTKAGRAAYQVEAEQFTLADGQNELRVPLTLEKDGVIYRKVFVIK 171

Query: 176 -EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKY 234
              Y  ++   + N + + I   P G++     Q++ +         A     +  ++  
Sbjct: 172 AGSYDIEVNYEIQNQTNEAIEVQPYGQLKHTLVQSSGSMAMPTYTGGAYSSADTNYKKYS 231

Query: 235 SDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
            D  K    +      W+ +   Y+ S +IP+++          +         +    +
Sbjct: 232 FDEMKDKNLSIDTKAGWVAVLQHYFVSAWIPNQDADNQLYTSTANG---LGFIGYRGPVV 288

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
            +  G S T  + L+ G K    +            ++ +D+GW +FIAKP+F L++   
Sbjct: 289 NVPAGGSETIKSALWTGPKLQNEMGAVAN-----HLDLTVDYGWAWFIAKPLFWLLNVIQ 343

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
           ++V N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + 
Sbjct: 344 SIVSNWGLAIIGVTIVVKGILYPLTKAQYTSMAKMRMLQPKLQEMRERFGD-DRQRMSQE 402

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           M++LYK   +NPL GC P+L+Q+P+F A+Y     ++E+RHAPF+GWI+DL+A DP    
Sbjct: 403 MMKLYKEEKVNPLGGCLPLLIQMPIFIALYWTFMEAVELRHAPFFGWIQDLSAQDPYY-- 460

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSS 533
                            I PI+M  SMF+  KMSP P AD  Q  I+N+MP++F+     
Sbjct: 461 -----------------ILPILMGASMFLLQKMSPTPVADPMQQKIMNFMPLIFMVFFLW 503

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           FPAGL++YW  SN+I+IVQQ +I +    +
Sbjct: 504 FPAGLVLYWLVSNIITIVQQQLIYRGLEKK 533


>gi|91777106|ref|YP_546862.1| protein translocase subunit yidC [Methylobacillus flagellatus KT]
 gi|122399286|sp|Q1GXL6|OXAA_METFK RecName: Full=Inner membrane protein oxaA
 gi|91711093|gb|ABE51021.1| protein translocase subunit yidC [Methylobacillus flagellatus KT]
          Length = 552

 Score =  354 bits (908), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 147/568 (25%), Positives = 255/568 (44%), Gaps = 38/568 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
                  + +  S  I+  W ++    +    +  +   Q+V+  +    + ++    ++
Sbjct: 1   MDTKRLILFVIFSFSILMLWDSWQRDQQPPAASQTQTTAQSVEDGSVPQAAKSSASAANQ 60

Query: 62  AQALSM-------SPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPS 114
           A   +        + R+ ++      SI+  G     L LR +  D       V L+   
Sbjct: 61  ASVPAETGFRLQSAERINVETDLYKASIDTIGGDLRRLELREHKDDEDQTKNFV-LMDDQ 119

Query: 115 NTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISL 174
           +    Y A+   +            +               ++L +K  N +   +  + 
Sbjct: 120 SAPMLYVAQTGLIGNGLPTHKEVFTSESTNYQLAPGEDKLDVRLTWKGDNGVEVHKIYTF 179

Query: 175 D-EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHK-PQTATNTFGVQEGFIAVLGDKSLVEQ 232
             + Y  ++   + NNS   +  S   +I+        +       G           + 
Sbjct: 180 RRDSYAIEVSYEIRNNSDTAVDPSVYYQIVHDNQSHQGSYMMPTFTGGAYYTEADKYKKL 239

Query: 233 KYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSAN 292
            +SD+ K+++S    S+ W+G+   Y+ S +IP        +F         Y     + 
Sbjct: 240 SFSDMAKTNLSKN-ASDGWVGLVQHYFVSAWIPEDG--LVREFYTKKLSDNVYSIGSVSP 296

Query: 293 EITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSY 352
              I PG+S+T  + L+AG +    +         P  E  +D+GW   IA P+F ++S 
Sbjct: 297 LGNIAPGQSVTLKSRLYAGPQTQSELKSVA-----PGLEYTVDYGWLTVIATPLFWILSS 351

Query: 353 FYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQ 412
              +V N+G+AI+L T+ +KL+F+PL+   Y S ANM+ + P++  L+E++     Q L 
Sbjct: 352 IQKVVHNWGVAIILLTILIKLVFYPLSAASYRSMANMRELAPRLQRLKEQYGD-DRQKLH 410

Query: 413 KAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTN 472
           +AM+++YKT  INP+ GC PIL+QIPVF A+Y V+  S+EMRHAPF  WI+DL+A DP  
Sbjct: 411 QAMMEMYKTEKINPMGGCLPILVQIPVFIALYWVLLGSVEMRHAPFMLWIQDLSAVDPYY 470

Query: 473 IFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALS 532
                              + PI+M ++M IQ K++P PAD  QA ++  MP+VF     
Sbjct: 471 -------------------VLPILMGITMIIQTKLNPKPADPIQAKVMTIMPIVFSVFFF 511

Query: 533 SFPAGLIIYWSWSNVISIVQQAVIMKMH 560
            FPAGL++YW  +N++SI QQ  I +  
Sbjct: 512 FFPAGLVLYWLVNNILSIAQQWYINRST 539


>gi|258626076|ref|ZP_05720927.1| inner membrane protein, 60 kDa [Vibrio mimicus VM603]
 gi|258581602|gb|EEW06500.1| inner membrane protein, 60 kDa [Vibrio mimicus VM603]
          Length = 539

 Score =  354 bits (907), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 141/570 (24%), Positives = 243/570 (42%), Gaps = 43/570 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL+++    +Q + V         ++             +        +
Sbjct: 1   MDSQRN-ILLIALALVSFLLFQQWQVAKNPAPQATQQAQSTGAAPAPSFSDELDPTPSQN 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
            A     +  + +    L  SI+  G       L  Y  ++ S    V L +     + +
Sbjct: 60  AA-----AKTITVTTDVLTLSIDTIGGDIVTAKLNQYSEELDSAESFVLLQNTQG--HQF 112

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDE 176
            A+   V         N+   + + +             I + ++       +  I    
Sbjct: 113 IAQSGLVGPQGIDVTSNNRPAYQVSADSFSLAEGQDELRIPMTYQANGIDYTKTFILKRG 172

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYS 235
            Y   +V  V NNS +         + ++   +  N       G      D    +  + 
Sbjct: 173 SYAVDVVFDVANNSGNAATLGMYAHLRQNLLDSGGNLAMPTYRGGAYSTSDVRYKKYSFD 232

Query: 236 DIEKSSIS-NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
           D++  ++S     + +W  +   Y+AS +IP  E       + +++              
Sbjct: 233 DMKDRNLSAPNDVTVNWAAMIQHYFASAWIPRNEPQAQLYSRVINNLGD---IGIRTPNK 289

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
           TI  G        L+ G K    +         P  ++++D+GW +FIAKP+  L+S+  
Sbjct: 290 TIANGDKAEFEATLWVGPKLQDQMAAVA-----PNLDLVVDYGWLWFIAKPLHWLLSFIQ 344

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
           + VGN+G+AI+  T  V+   +PL K QY S A M+ +QPK+  +RE+      Q + + 
Sbjct: 345 SFVGNWGVAIICLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLQAMRERIGD-DRQRMSQE 403

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           M++LYK   +NPL GC PILLQ+P+F A+Y  +  S+E+RH+PF+GWI DL+A DP    
Sbjct: 404 MMELYKKEKVNPLGGCLPILLQMPIFIALYWALMESVELRHSPFFGWIHDLSAQDPYY-- 461

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSS 533
                            I P++M  SMF+  KMSP    D  Q  I+ +MPV+F F    
Sbjct: 462 -----------------ILPLLMGASMFVIQKMSPTTITDPMQQKIMTFMPVMFTFFFLW 504

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           FP+GL++YW  SN+++++QQ +I K    +
Sbjct: 505 FPSGLVLYWLVSNIVTLIQQTLIYKALEKK 534


>gi|28872711|ref|NP_795330.1| inner membrane protein, 60 kDa [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|38502973|sp|Q87TS1|OXAA_PSESM RecName: Full=Inner membrane protein oxaA
 gi|28855967|gb|AAO59025.1| inner membrane protein, 60 kDa [Pseudomonas syringae pv. tomato
           str. DC3000]
          Length = 562

 Score =  353 bits (906), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 147/585 (25%), Positives = 242/585 (41%), Gaps = 53/585 (9%)

Query: 1   MERNWNYFVAIALSVIIVYA---WQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           M+      + +AL+++       W   Y    +   N    N           N+ +A  
Sbjct: 1   MDI-KRTILIVALAIVTYVGVLKWNQDYGQAAMPTQNVAASNTAPGIPDTAAGNNGSASA 59

Query: 58  IDDRAQ------------ALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNS 105
               A             A++    + +K   L  +I+  G     L L  Y        
Sbjct: 60  DVPSATGNTTSAAPLETPAVASKDLIHVKTDVLDLAIDPVGGDVVQLRLPLYPRRQDRPD 119

Query: 106 PIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFK 161
               L   +  +  + A+     T       +   V++             +  ++L F 
Sbjct: 120 VPFQLF-DNGGERTFLAQSGLTGTNGPDARASGRPVYSSAQKSYQLADGQDSMVVELKFS 178

Query: 162 NANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT----ATNTFGVQ 217
                  +R       Y   +   V N S      +   ++ R                 
Sbjct: 179 ENGVNYIKRFTFKRGLYDLVMTYVVDNQSAQPWAGNLFAQLKRDASSDPSSTTATGTATY 238

Query: 218 EGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKY 277
            G       +   +    DI+K  I        W+     Y+ + +IP    +   Q + 
Sbjct: 239 LGAALWTAAEPYKKVSMKDIDKGQIKEN-VQGGWVAWLQHYFVTAWIPDHNVTNAVQTR- 296

Query: 278 LSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWG 337
             D    Y   F++  +++ PG    TT  L+AG K    +         P  E+ +D+G
Sbjct: 297 -KDSQGNYIIGFTSPTLSVAPGAQGETTATLYAGPKSQAVLKELS-----PGLELTVDYG 350

Query: 338 WFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKID 397
           + +FIA+P+F L+ + + ++GN+G +I++ T+ +K LFFPL+   Y S A M+ + PK+ 
Sbjct: 351 FLWFIAQPIFWLLQHIHAILGNWGWSIIVLTMLIKGLFFPLSAASYKSMARMRAVAPKLA 410

Query: 398 ELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAP 457
            L+E+      Q + +AM++LYK   INPL GC PIL+Q+PVF ++Y V+  S+EMR AP
Sbjct: 411 VLKEQHGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLSLYWVLLESVEMRQAP 469

Query: 458 FWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQA 517
           +  WI DL+  DP                     I PIIM  +MFIQ +++P P D  QA
Sbjct: 470 WILWITDLSIKDPFF-------------------ILPIIMGATMFIQQRLNPTPPDPMQA 510

Query: 518 MILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
            ++  MP++F F    FPAGL++YW  +N +SI QQA I +  GA
Sbjct: 511 KVMKMMPIIFTFFFLWFPAGLVLYWVVNNTLSIAQQAYITRKIGA 555


>gi|104784447|ref|YP_610945.1| putative inner membrane protein translocase component YidC
           [Pseudomonas entomophila L48]
 gi|123079038|sp|Q1I2H4|OXAA_PSEE4 RecName: Full=Inner membrane protein oxaA
 gi|95113434|emb|CAK18162.1| Preprotein translocase subunit YidC [Pseudomonas entomophila L48]
          Length = 561

 Score =  353 bits (904), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 143/584 (24%), Positives = 240/584 (41%), Gaps = 52/584 (8%)

Query: 1   MERNWNYFVAIAL---SVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           M+      + +AL   S ++V  W   Y    +   N            +    +  A  
Sbjct: 1   MDI-KRTILIVALAIVSYVMVLKWNQDYGQAALPTQNTAASTANASLPDSVPAGNNGANA 59

Query: 58  IDDRAQALS------------MSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNS 105
                 A +                +++K   L  +I+  G     L L  +        
Sbjct: 60  DLPSVNAQNGTTGLAPAPVAVSKDLIQVKTDVLNLAIDPVGGDIVQLTLPKFPRRQDHPE 119

Query: 106 PIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPI---KLVFKN 162
               L   +  +  Y A+   + T                    L          L F  
Sbjct: 120 IPFQLF-DNGGERVYLAQSGLIGTDGPDRASGRPLYATEQKSYQLADGQDQLVVDLKFSE 178

Query: 163 ANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGV----QE 218
                 +R       Y   +   + N S      +   ++ R      +++         
Sbjct: 179 NGVNYIKRFSLKRGEYDLTVSYLIDNQSAQAWSGNMFAQLKRDASSDPSSSTATGTATYL 238

Query: 219 GFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYL 278
           G       +   +    D++K  +     +  W+     Y+ + +IPSK  +   Q +  
Sbjct: 239 GAALWTASEPYKKVSMKDMDKGGLQEN-VAGGWVAWLQHYFVTAWIPSKSDNNAVQTR-- 295

Query: 279 SDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGW 338
            D    Y   ++   + +  G  + T+  L+AG K    +         P  E+ +D+G+
Sbjct: 296 KDSQGNYIIGYTGPALNVPAGGKVETSAMLYAGPKIQSKLKELS-----PGLELTVDYGF 350

Query: 339 FYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDE 398
            +FIA+P+F L+ + ++L+GN+G +I++ T+ +K LFFPL+   Y S A M+ + PK+ +
Sbjct: 351 LWFIAQPIFWLLQHIHSLLGNWGWSIIVLTMLIKGLFFPLSAASYRSMARMRAVAPKLAQ 410

Query: 399 LREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF 458
           L+E+F     Q + +AM++LYK   INPL GC PIL+Q+PVF A+Y V+  S+EMR AP+
Sbjct: 411 LKERFGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLALYWVLLESVEMRQAPW 469

Query: 459 WGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAM 518
             WI DL+  DP                     I PIIM  +MFIQ +++P P D  QA 
Sbjct: 470 MLWITDLSIKDPFF-------------------ILPIIMGATMFIQQRLNPTPPDPMQAK 510

Query: 519 ILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           ++  MP++F F    FPAGL++YW  +N +SI QQ  I +   A
Sbjct: 511 VMKMMPIIFTFFFLWFPAGLVLYWVVNNCLSIAQQWYITRSIEA 554


>gi|229517141|ref|ZP_04406587.1| OxaI/YidC membrane insertion protein [Vibrio cholerae RC9]
 gi|229346204|gb|EEO11176.1| OxaI/YidC membrane insertion protein [Vibrio cholerae RC9]
          Length = 541

 Score =  353 bits (904), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 140/570 (24%), Positives = 242/570 (42%), Gaps = 41/570 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL+++    +Q + V         ++             +        +
Sbjct: 1   MDSQRN-ILLIALALVSFLLFQQWQVAKNPAPQATQQAQSTGAAPAPSFSDELDPTPAQN 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
                + +  + +    L  SI+  G       L  Y  +++S    V L +     + +
Sbjct: 60  ---VAAKAKTITVSTDVLTLSIDTLGGDVVSAKLNQYSEELNSPESFVLLQNTQG--HQF 114

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDE 176
            A+   V         N+   + + +             I + ++       +  I    
Sbjct: 115 IAQSGLVGPQGIDVTSNNRPAYQVSADSFTLAEGQDELRIPMTYQANGIDYTKTFILKRG 174

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYS 235
            Y   +V  V NNS  +        + ++   +  N       G      D    +  + 
Sbjct: 175 SYAVDVVFDVANNSGSEATLGMYAHLRQNLLDSGGNLAMPTYRGGAYSTSDVRYKKYSFD 234

Query: 236 DIEKSSIS-NFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
           D++  ++S     + +W+ +   Y+AS +IP  E       + +++              
Sbjct: 235 DMKDRNLSAPNDVTVNWVAMIQHYFASAWIPRDEPQAQLYSRVINNLGD---MGIRTPNK 291

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
           TI  G        L+ G K    +         P  ++++D+GW +FIAKP+  L+S   
Sbjct: 292 TIANGDKAEFEATLWVGPKLQDQMAATA-----PNLDLVVDYGWLWFIAKPLHWLLSVIQ 346

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
             VGN+G+AI+  T  V+   +PL K QY S A M+ +QPK+  +RE+      Q + + 
Sbjct: 347 TFVGNWGVAIICLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLQAMRERIGD-DRQRMSQE 405

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           M++LYK   +NPL GC PILLQ+P+F A+Y  +  S+E+RH+PF+GWI DL+A DP    
Sbjct: 406 MMELYKKEKVNPLGGCLPILLQMPIFIALYWALMESVELRHSPFFGWIHDLSAQDPYY-- 463

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSS 533
                            I P+ M  SMF+  KMSP    D  Q  I+ +MPV+F F    
Sbjct: 464 -----------------ILPLQMGASMFVIQKMSPTTITDPMQQKIMTFMPVMFTFFFLW 506

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           FP+GL++YW  SN+++++QQ +I K    +
Sbjct: 507 FPSGLVLYWLVSNIVTLIQQTLIYKALEKK 536


>gi|330961501|gb|EGH61761.1| membrane protein insertase [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 562

 Score =  353 bits (904), Expect = 7e-95,   Method: Composition-based stats.
 Identities = 146/585 (24%), Positives = 240/585 (41%), Gaps = 53/585 (9%)

Query: 1   MERNWNYFVAIALSVIIVYA---WQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           M+      + +AL+++       W   Y    +   N    N           N+ +A  
Sbjct: 1   MDI-KRTILIVALAIVTYVGVLKWNQDYGQAAMPTQNVAASNTAPGIPDTAAGNNGSASA 59

Query: 58  IDDRAQALSMS------------PRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNS 105
               A A + S              + +K   L  +I+  G     L L  Y        
Sbjct: 60  DVPSATANTTSAAPLETPAVASKDLIHVKTDVLDLAIDPVGGDVVQLRLPLYPRRQDRPD 119

Query: 106 PIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFK 161
               L   +  +  + A+     T           V++             +  ++L F 
Sbjct: 120 VPFQLF-DNGGERTFLAQSGLTGTNGPDARAAGRPVYSSAQKTYQLADGQDSMVVELKFS 178

Query: 162 NANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT----ATNTFGVQ 217
                  +R       Y   +   V N S      +   ++ R                 
Sbjct: 179 ENGVNYIKRFTFKRGLYDLVMTYVVDNQSAQPWAGNLFAQLKRDASSDPSSTTATGTATY 238

Query: 218 EGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKY 277
            G       +   +    DI+K  I        W+     Y+ + +IP    +   Q + 
Sbjct: 239 LGAALWTAAEPYKKVSMKDIDKGQIKET-VQGGWVAWLQHYFVTAWIPDHNATNQVQTR- 296

Query: 278 LSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWG 337
             D    Y   F++  +++ PG    T+  L+AG K    +         P  E+ +D+G
Sbjct: 297 -KDSQGNYIIGFTSPTLSVAPGAQGETSATLYAGPKSQAVLKELS-----PGLELTVDYG 350

Query: 338 WFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKID 397
           + +FIA+P+F L+ + + ++GN+G +I++ T+ +K LFFPL+   Y S A M+ + PK+ 
Sbjct: 351 FLWFIAQPIFWLLQHIHAILGNWGWSIIVLTMLIKGLFFPLSAASYKSMARMRAVAPKLA 410

Query: 398 ELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAP 457
            L+E+      Q + +AM++LYK   INPL GC PIL+Q+PVF ++Y V+  S+EMR AP
Sbjct: 411 LLKEQHGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLSLYWVLLESVEMRQAP 469

Query: 458 FWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQA 517
           +  WI DL+  DP                     I PIIM  +MFIQ +++P P D  QA
Sbjct: 470 WILWITDLSIKDPFF-------------------ILPIIMGATMFIQQRLNPTPPDPMQA 510

Query: 518 MILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
            ++  MP++F F    FPAGL++YW  +N +SI QQA I +   A
Sbjct: 511 KVMKLMPIIFTFFFLWFPAGLVLYWVVNNTLSIAQQAYITRKIEA 555


>gi|293602692|ref|ZP_06685133.1| Oxa1 family cytochrome oxidase biogenesis protein [Achromobacter
           piechaudii ATCC 43553]
 gi|292818883|gb|EFF77923.1| Oxa1 family cytochrome oxidase biogenesis protein [Achromobacter
           piechaudii ATCC 43553]
          Length = 559

 Score =  353 bits (904), Expect = 7e-95,   Method: Composition-based stats.
 Identities = 144/588 (24%), Positives = 249/588 (42%), Gaps = 49/588 (8%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNF---------YVYPRIEEMNNERKN-----IQTVKQP 46
           M+      + +  S  ++  W N+         +  P       E +        +V   
Sbjct: 1   MDI-RRTVLWMIFSFSLLLLWNNWQIHNGKPSLFGGPTPAASTAEPQAGANNATPSVPSA 59

Query: 47  NQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSP 106
                +  + +    A A + S  V +    L  + +  GAQ     L  Y      + P
Sbjct: 60  PTTTATAPSAVPGATAPAAARSEEVVVTTDVLRLTFDTMGAQLVRAELLKYPATGQPDKP 119

Query: 107 IVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKIL--TPTTPIKLVFKNAN 164
            V L    +    Y  +   V   N    P   T + + S +         +    ++  
Sbjct: 120 TVLL--DRSAGLNYVVQSGVVGAPNGQSFPTHQTPFRVTSSERQLTGDNLVVSFEGESGG 177

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHK--PQTATNTFGVQEGFIA 222
             + +        Y   +   + N     +  +   ++ R    P   ++ +    GF  
Sbjct: 178 VKVTKTFTLHKGRYDIDVRHDLANVGSAPVTPALYLQLERDGNDPADTSSFYHTFTGFAV 237

Query: 223 VLGDKSLVEQKYSDIEKSSISNFHE-SNSWLGISDKYWASVFIPSKETSFHSQFKYLSDG 281
                   +  +SDIEK   +   +  N W+ +   Y+A+ ++P +     ++   +   
Sbjct: 238 YSEQDKFQKSTFSDIEKKKANYIKQADNGWIAVVQHYFATAWVPPQGKPRTNELLEVQKN 297

Query: 282 HARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYF 341
              Y A+       I PG +    + L+ G ++   +         P  E+++D+GW   
Sbjct: 298 --LYAARSIEAVGEIAPGSASRVDSHLWVGPQDQKAMAALA-----PGLELVVDYGWLTI 350

Query: 342 IAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELRE 401
           IAKP+F LM++ ++L+GN+G  I+  TV +K +FFPLA   Y S A MK + P++  L+E
Sbjct: 351 IAKPLFTLMTWLHSLLGNWGWTIVALTVLIKAIFFPLAAASYRSMARMKQVAPRLQALKE 410

Query: 402 KFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGW 461
           K+     Q L  AM+++Y+T  INPL GC P+++QIPVF ++Y V+  S+EMR AP+  W
Sbjct: 411 KYGDDK-QKLNAAMMEMYRTEKINPLGGCLPMVVQIPVFISLYWVLLASVEMRGAPWILW 469

Query: 462 IKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILN 521
           + DL+  DP                     I P IM  +MF+Q+K++P P D  QA ++ 
Sbjct: 470 VHDLSIRDPYF-------------------ILPAIMMATMFLQIKLNPTPPDPIQAKVMM 510

Query: 522 WMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDR 569
            MP+VF   +  FPAGL++YW  +N +SI QQ  I +    +      
Sbjct: 511 IMPLVFGGMMFFFPAGLVLYWCVNNTLSIAQQWSITRSMQRKTEAAAN 558


>gi|189183736|ref|YP_001937521.1| putative inner membrane protein translocase component YidC
           [Orientia tsutsugamushi str. Ikeda]
 gi|189180507|dbj|BAG40287.1| 60 kD inner-membrane protein [Orientia tsutsugamushi str. Ikeda]
          Length = 567

 Score =  352 bits (903), Expect = 7e-95,   Method: Composition-based stats.
 Identities = 205/570 (35%), Positives = 330/570 (57%), Gaps = 11/570 (1%)

Query: 1   ME-RNW-NYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNS---YAA 55
           M+  N  N  +AI LS+ I+  W  FY  PR+ +M+N +K      + +  +      +A
Sbjct: 1   MDSDNRLNLILAITLSLAIILGWHFFYEKPRLIKMSNAQKEKIEYNKRSSTNKHLLHESA 60

Query: 56  VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSN 115
           + I D+   +  S RV++    L GSI+LKG +FDDL L GY  DV  NSP V LLSPS 
Sbjct: 61  LKIKDKVDIIDYSTRVKIMTNKLHGSISLKGLRFDDLILVGYKQDVLENSPDVELLSPSE 120

Query: 116 TKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD 175
           T  AYFAE+ +    N      ++         IL         + N +N+ F  ++S+D
Sbjct: 121 TATAYFAEVGWYCAKNADSDFPNSDTLWQTDKSILQANDTTTFTWTNKHNVQFIVSVSID 180

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
           ++Y+F I  ++ NNS  Q+     G I R+  +   +    Q    ++     L E  Y+
Sbjct: 181 DNYMFTINQSIVNNSKQQLAVQFHGLIHRNLAENENSANIFQGPIASIDSY--LNEVTYN 238

Query: 236 DIEKSSISNFHESN-SWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSAN-E 293
            +++    +++ +   WLGISDKYW + FIP  +  + + F Y   G  +YQ  F +  E
Sbjct: 239 KLKEKKHIDYNLNVVHWLGISDKYWLTSFIPDVKYRYSTSFMYGKAGFEKYQVSFLSPKE 298

Query: 294 ITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYF 353
           +    G S++  + LF GAKE   + +Y K   I  F+  ID+GWFY + KP+F  +S+F
Sbjct: 299 VVNSDGGSLSVVHHLFLGAKEVKLLDYYAKKYNIKLFDRAIDFGWFYILTKPLFYTLSFF 358

Query: 354 YNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQK 413
           Y   GNFG++I++ T+ +K++ F  + + Y S   M+++QP+I  L+E +     + L +
Sbjct: 359 YKYCGNFGVSILIVTILIKIMMFSFSNRSYSSMKKMRDLQPRIQRLQELYGDDKIK-LHQ 417

Query: 414 AMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNI 473
            ++ LYK   ++        L+Q+P+FF++YKV+ +++EMRHAPF+ WIKDL+A DPT I
Sbjct: 418 EIMALYKKEKVSLAGSFLQSLIQLPIFFSLYKVLHVTIEMRHAPFFIWIKDLSALDPTCI 477

Query: 474 FTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMS-PPPADKGQAMILNWMPVVFVFALS 532
           F LFG+LPF++P F+++G WPI+ S +M +Q K++  P AD  QA +L +MP++ +   +
Sbjct: 478 FNLFGLLPFHVPWFLNIGAWPILTSATMMLQQKINPAPAADPAQAQVLKFMPLILLIVFN 537

Query: 533 SFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           +FPAGL+IYW+W+N++SIVQQ +I K++  
Sbjct: 538 NFPAGLLIYWTWNNILSIVQQFIINKINNK 567


>gi|212712607|ref|ZP_03320735.1| hypothetical protein PROVALCAL_03702 [Providencia alcalifaciens DSM
           30120]
 gi|212684823|gb|EEB44351.1| hypothetical protein PROVALCAL_03702 [Providencia alcalifaciens DSM
           30120]
          Length = 553

 Score =  352 bits (903), Expect = 7e-95,   Method: Composition-based stats.
 Identities = 148/574 (25%), Positives = 262/574 (45%), Gaps = 53/574 (9%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL  +    WQ +      +E    + + Q    P+   N   AV   +
Sbjct: 1   MDSQRNLLL-IALLFVSFLVWQAWESDKVAQETKAVQVSQQKTDMPSSASNDGQAVTGSE 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
                     + +K   L   IN +G   D+ +L  Y   ++S  P   L   +     Y
Sbjct: 60  ------QGKLIAVKTDVLDIRINTRGGDIDEADLLAYPATLNSPDPFRLL--ETTPGFVY 111

Query: 121 FAELDYVST-------ANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTIS 173
            A+   +          NN + P   +       K       I + F + N +++++T  
Sbjct: 112 QAQSGLIGPHGPDNPANNNGQRPLYTSDATSFELKDGQDELRIPMTFTDNNGVVYQKTYI 171

Query: 174 LD-EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNT-------FGVQEGFIAVLG 225
           L    Y   +   + N +   +  +  G++ +                     G      
Sbjct: 172 LKRGKYTVDVEYNIQNPTAQPLTLAFFGQLKQTIALPEQRDTGSSNFALHTYRGAAYSSD 231

Query: 226 DKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARY 285
           + +  +  +SDIE  ++S       W+ +  +Y+A+ +IP+      S F  +       
Sbjct: 232 ENNYKKYSFSDIEDKNLSLT-TKGGWVAMLQQYFATAWIPASSEQ--STFYTIDLDKKSA 288

Query: 286 QAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKP 345
              + +  +TI    + T ++ L+ G +    +         P  ++ +D+GW +FI++P
Sbjct: 289 IVGYKSEPLTIASNGAATYSSTLWVGPEIQSEMAEVA-----PHLDLTVDYGWLWFISQP 343

Query: 346 MFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQ 405
           +F L+ + +  VGN+GIAI++ T  V+ + +PL K QY S A M+ +QPK+  +RE+   
Sbjct: 344 LFKLLKFIHGFVGNWGIAIIVITFIVRGIMYPLTKAQYTSMAKMRLLQPKLAAMRERIGD 403

Query: 406 SPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDL 465
              Q + + M+ LYK+  +NPL GC P+L+Q+P+F A+Y ++  S+E+RHAPF+GWI+DL
Sbjct: 404 DK-QRMSQEMMALYKSEKVNPLGGCLPLLIQMPIFLALYYMLMGSVELRHAPFFGWIQDL 462

Query: 466 AAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMP 524
           +A DP                     I P++M ++MF+  KMSP    D  Q  I+ +MP
Sbjct: 463 SAQDPYY-------------------ILPVLMGVTMFVIQKMSPTTVTDPMQQKIMMYMP 503

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           VVF      FP+GL++Y+  SN+++I+QQ VI +
Sbjct: 504 VVFTVFFLWFPSGLVLYYIVSNLVTIIQQQVIYR 537


>gi|330964185|gb|EGH64445.1| membrane protein insertase [Pseudomonas syringae pv. actinidiae
           str. M302091]
          Length = 562

 Score =  352 bits (902), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 147/585 (25%), Positives = 241/585 (41%), Gaps = 53/585 (9%)

Query: 1   MERNWNYFVAIALSVIIVYA---WQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           M+      + +AL+++       W   Y    +   N    N           N+ +A  
Sbjct: 1   MDI-KRTILIVALAIVTYVGVLKWNQDYGQAAMPTQNVAASNTAPGIPDTAAGNNGSASA 59

Query: 58  IDDRAQ------------ALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNS 105
               A             AL+    + +K   L  +I+  G     L L  Y        
Sbjct: 60  DVPSATGNTTSAAPLETPALASKDLIHVKTDVLDLAIDPVGGDVVQLRLPLYPRRQDRPD 119

Query: 106 PIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFK 161
               L   +  +  + A+     T       +   V++             +  ++L F 
Sbjct: 120 VPFQLF-DNGGERTFLAQSGLTGTNGPDARASGRPVYSSAQKSYQLADGQDSMVVELKFS 178

Query: 162 NANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT----ATNTFGVQ 217
                  +R       Y   +   V N S      +   ++ R                 
Sbjct: 179 ENGVNYIKRFTFKRGLYDLVMTYVVDNQSAQPWAGNLFAQLKRDASSDPSSTTATGTATY 238

Query: 218 EGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKY 277
            G       +   +    DI+K  I        W+     Y+ + +IP    +   Q + 
Sbjct: 239 LGAALWTAAEPYKKVSMKDIDKGQIKEN-VQGGWVAWLQHYFVTAWIPDHNATNAVQTR- 296

Query: 278 LSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWG 337
             D    Y   F++  +++ PG    TT  L+AG K    +         P  E+ +D+G
Sbjct: 297 -KDSQGNYIIGFTSPTLSVAPGAQGETTATLYAGPKSQAVLKELS-----PGLELTVDYG 350

Query: 338 WFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKID 397
           + +FIA+P+F L+ + + ++GN+G +I++ T+ +K LFFPL+   Y S A M+ + PK+ 
Sbjct: 351 FLWFIAQPIFWLLQHIHAILGNWGWSIIVLTMLIKGLFFPLSAASYKSMARMRAVAPKLA 410

Query: 398 ELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAP 457
            L+E+      Q + +AM++LYK   INPL GC PIL+Q+PVF ++Y V+  S+EMR AP
Sbjct: 411 VLKEQHGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLSLYWVLLESVEMRQAP 469

Query: 458 FWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQA 517
           +  WI DL+  DP                     I PIIM  +MFIQ +++P P D  QA
Sbjct: 470 WILWITDLSIKDPFF-------------------ILPIIMGATMFIQQRLNPTPPDPMQA 510

Query: 518 MILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
            ++  MP++F F    FPAGL++YW  +N +SI QQA I +   A
Sbjct: 511 KVMKMMPIIFTFFFLWFPAGLVLYWVVNNTLSIAQQAYITRKIEA 555


>gi|217970730|ref|YP_002355964.1| hypothetical protein Tmz1t_2331 [Thauera sp. MZ1T]
 gi|217508057|gb|ACK55068.1| 60 kDa inner membrane insertion protein [Thauera sp. MZ1T]
          Length = 552

 Score =  352 bits (902), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 142/569 (24%), Positives = 243/569 (42%), Gaps = 39/569 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQT------VKQPNQVDNSYAA 55
                  + +  S  +V  W  +    +      +            V  P         
Sbjct: 1   MDQRRLILFLIFSFSLVMLWDGWIKQNQPPVAQQQAAAGSAAPADGAVPTPTLSATPGQP 60

Query: 56  VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSN 115
           V+  ++A   + +PR  ++   L   ++ +G     L L+ +     +    V LL    
Sbjct: 61  VVPGEQAAQAAAAPRAVVETDLLRAEVSAQGGDIVRLELKQHKASGEAGGNFV-LLDDGT 119

Query: 116 TKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISL- 174
           T++ Y A+   +                 +  K       ++L     N +   + +   
Sbjct: 120 TRHQYAAQSGLIGEGLPTHKTLFQLPAGELRLKDGENGVELRLQAPEQNGVQVTKVMRFA 179

Query: 175 DEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNT---FGVQEGFIAVLGDKSLVE 231
              YL  +   + N S   +      ++ R                 G           +
Sbjct: 180 RGSYLIDVSYEIRNGSGQALAPHAYFQLTRDGNPAEQVEAFGVTTFTGPAFYTDANKFQK 239

Query: 232 QKYSDIEKSSISNFHES-NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFS 290
            +++DI          + + W+ +   Y+   ++P          + L  G+  + A   
Sbjct: 240 VQFADITDGDAKFPKTAADGWVAMVQHYFVGAWLPKAGEQREYFARAL--GNNLFSAGVI 297

Query: 291 ANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLM 350
               +I  G     +  L+AG +E   +         P  ++++D+GW   IA P+F ++
Sbjct: 298 LPVASIATGAEGAVSTRLYAGPQEQDKLEGIA-----PGLDLVVDYGWLTVIAAPLFWVL 352

Query: 351 SYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQV 410
           S+F+NL GN+G AI+L TV +K +FFPL+   Y S A M+ + P++  ++E +     ++
Sbjct: 353 SWFHNLTGNWGWAIILVTVAIKAIFFPLSAASYKSMAKMRVLGPRLQRMKEMYGNDKAKM 412

Query: 411 LQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADP 470
            Q+ M+ LY+T  INPL GC PIL+QIPVF A+Y V+  S+EMRHAP+ GWI+DL+A DP
Sbjct: 413 -QQEMMNLYRTEKINPLGGCLPILVQIPVFIALYWVLLGSVEMRHAPWLGWIQDLSAKDP 471

Query: 471 TNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFA 530
                                I PIIM +SM +QMK++P P D  QA ++  MP++F F 
Sbjct: 472 YF-------------------ILPIIMGVSMLVQMKLNPTPPDPIQAKVMMAMPIIFTFM 512

Query: 531 LSSFPAGLIIYWSWSNVISIVQQAVIMKM 559
              FP+GL++YW  +N +SI QQ  I +M
Sbjct: 513 FLWFPSGLVLYWVVNNCLSIAQQWQITRM 541


>gi|146284522|ref|YP_001174675.1| putative inner membrane protein translocase component YidC
           [Pseudomonas stutzeri A1501]
 gi|166977401|sp|A4VS82|OXAA_PSEU5 RecName: Full=Inner membrane protein oxaA
 gi|145572727|gb|ABP81833.1| inner membrane protein, 60 kDa [Pseudomonas stutzeri A1501]
          Length = 556

 Score =  352 bits (902), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 143/584 (24%), Positives = 241/584 (41%), Gaps = 49/584 (8%)

Query: 1   MERNWNYFVAIALS---VIIVYAWQNFYVYPRIEEMNNERK----------NIQTVKQPN 47
           M+      + +AL+    ++V  W   Y    +     + +          +  T    N
Sbjct: 1   MDI-KRSILLVALAVVAYLMVLQWNQDYGQAALPTETAQSQPAAPALPDSPSATTEGNAN 59

Query: 48  QVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPI 107
            V              +   S  + ++   L  +I+ +G    +L+L  Y          
Sbjct: 60  DVPAVAGQQQASALPTSAPSSQLIRVRTDVLDLAIDPRGGDIVELHLPQYPRRQDRPDVP 119

Query: 108 VTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGK--ILTPTTPIKLVFKNANN 165
             L    +++  Y A+   +    +               +         + L +     
Sbjct: 120 FQLF-ERSSERTYEAQSGLIGDGPDKASGRPQYSSEKTEYQLAEGQDALVVDLNYSADGV 178

Query: 166 ILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHK---PQTATNTFGVQEGFIA 222
              +R      +Y  K+   + N S         G++ R K   P ++T T        A
Sbjct: 179 NYIKRFTLERGNYALKVNYLIDNQSQQPWTGYLFGQLKRDKSGDPSSSTATGTATYLGAA 238

Query: 223 VLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGH 282
           +        +                  W+     Y+ + +IP    +   Q +   D  
Sbjct: 239 LWTKDEPYRKVSMSNMDDKNLRETVQGGWIAWLQHYFVTAWIPQAGDTNQVQTR--KDSQ 296

Query: 283 ARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFI 342
             Y   F+   +T+  G    T   L+AG K    +         P   + +D+G  +FI
Sbjct: 297 GNYIIGFTGPAVTVPAGAQGETGATLYAGPKSQDKLEELS-----PGLRLTVDYGILWFI 351

Query: 343 AKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREK 402
           A+P+F L+   + L+GN+G +I++ T+ +KL FFPL+   Y S A M+ + PK+  L+E+
Sbjct: 352 AQPIFWLLQNIHALLGNWGWSIIVLTIVIKLAFFPLSAASYRSMARMRAVSPKMQALKEQ 411

Query: 403 FKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWI 462
           F     Q + +AM++LYK   INPL GC PIL+Q+PVF A+Y V+  S+EMR AP+  WI
Sbjct: 412 FGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLALYWVLLESVEMRQAPWMFWI 470

Query: 463 KDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNW 522
            DL+  DP                     I PIIM ++MFIQ +++P P D  QA ++  
Sbjct: 471 TDLSIKDPYF-------------------ILPIIMGVTMFIQQQLNPTPPDPMQARVMKL 511

Query: 523 MPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMH--GAEI 564
           +P++F F    FPAGL++YW  +N++SI QQ  I +    GA+ 
Sbjct: 512 LPIIFTFFFLWFPAGLVLYWVVNNILSIAQQWYITRQIEAGAKP 555


>gi|327482911|gb|AEA86221.1| putative inner membrane protein translocase component YidC
           [Pseudomonas stutzeri DSM 4166]
          Length = 556

 Score =  352 bits (902), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 143/584 (24%), Positives = 240/584 (41%), Gaps = 49/584 (8%)

Query: 1   MERNWNYFVAIALS---VIIVYAWQNFYVYPRIEEMNNE----------RKNIQTVKQPN 47
           M+      + +AL+    ++V  W   Y    +     +            +  T    N
Sbjct: 1   MDI-KRSILLVALAVVAYLMVLQWNQDYGQAALPTETAQGQPAAPALPDSPSATTEGNAN 59

Query: 48  QVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPI 107
            V              +   S  + ++   L  +I+ +G    +L+L  Y          
Sbjct: 60  DVPAVAGQQQASALPTSAPSSQLIRVRTDVLDLAIDPRGGDIVELHLPQYPRRQDRPDVP 119

Query: 108 VTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGK--ILTPTTPIKLVFKNANN 165
             L    +++  Y A+   +    +               +         + L +     
Sbjct: 120 FQLF-ERSSERTYEAQSGLIGDGPDKASGRPQYSSEKTEYQLAEGQDALVVDLNYSADGV 178

Query: 166 ILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHK---PQTATNTFGVQEGFIA 222
              +R      +Y  K+   + N S         G++ R K   P ++T T        A
Sbjct: 179 NYIKRFTLERGNYALKVNYLIDNQSQQPWTGYLFGQLKRDKSGDPSSSTATGTATYLGAA 238

Query: 223 VLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGH 282
           +        +                  W+     Y+ + +IP    +   Q +   D  
Sbjct: 239 LWTKDEPYRKVSMSNMDDKNLRETVQGGWIAWLQHYFVTAWIPQAGDTNQVQTR--KDSQ 296

Query: 283 ARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFI 342
             Y   F+   +T+  G    T   L+AG K    +         P   + +D+G  +FI
Sbjct: 297 GNYIIGFTGPAVTVPAGAQGETGATLYAGPKSQDKLEELS-----PGLRLTVDYGILWFI 351

Query: 343 AKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREK 402
           A+P+F L+   + L+GN+G +I++ T+ +KL FFPL+   Y S A M+ + PK+  L+E+
Sbjct: 352 AQPIFWLLQNIHALLGNWGWSIIVLTIVIKLAFFPLSAASYRSMARMRAVSPKMQALKEQ 411

Query: 403 FKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWI 462
           F     Q + +AM++LYK   INPL GC PIL+Q+PVF A+Y V+  S+EMR AP+  WI
Sbjct: 412 FGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLALYWVLLESVEMRQAPWMFWI 470

Query: 463 KDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNW 522
            DL+  DP                     I PIIM ++MFIQ +++P P D  QA ++  
Sbjct: 471 TDLSIKDPYF-------------------ILPIIMGVTMFIQQQLNPTPPDPMQARVMKL 511

Query: 523 MPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMH--GAEI 564
           +P++F F    FPAGL++YW  +N++SI QQ  I +    GA+ 
Sbjct: 512 LPIIFTFFFLWFPAGLVLYWVVNNILSIAQQWYITRQIEAGAKP 555


>gi|68171979|ref|ZP_00545283.1| 60 kDa inner membrane protein [Ehrlichia chaffeensis str. Sapulpa]
 gi|67998597|gb|EAM85346.1| 60 kDa inner membrane protein [Ehrlichia chaffeensis str. Sapulpa]
          Length = 585

 Score =  351 bits (901), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 213/585 (36%), Positives = 325/585 (55%), Gaps = 19/585 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M    N  +A+ LSV+I+  W+  Y      +   E         P   DN         
Sbjct: 7   MVEVRNLILAVILSVLIMMGWRFIYDKFFTTQHAIEDNTSSDAMIPEIDDN--FIHKTRS 64

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
                + + R++L N  + GSI+LKGAQFDDL  + YH+    NS  + LLSP  T+N Y
Sbjct: 65  EVIESNTNIRIKLSNEKMNGSISLKGAQFDDLIFKNYHVTPDKNSEGIVLLSPEETENVY 124

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF 180
           F E  ++   + I +P  +++WN      L+P  PI L + N   ++F+  I+LD  Y+F
Sbjct: 125 FIEFGWIDPQHKITVPTHSSIWNSDQST-LSPNNPITLTWDNKQGVVFKIKITLDNDYMF 183

Query: 181 KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS 240
           KI   VTNN+   I   P GRI R K     + +   EG +   G+ +L E  Y  I K 
Sbjct: 184 KIEQMVTNNTDSIINLIPYGRINRSKHTAEKSYWISHEGAVGSFGN-TLKEWTYKAITKE 242

Query: 241 SISNFHESNS------WLGISDKYWASVFIPSKETSFHSQFK---YLSDGHARYQAKFSA 291
                 + +       W+GI DKYW +  IP+     +  F       +   R+Q  FS 
Sbjct: 243 KNIKIQQQDINDNQNQWIGIGDKYWFTALIPNVSQKSNLNFHVKHAKHNSKDRFQVDFSH 302

Query: 292 NEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMS 351
           +     P  ++T+ N+LFAGAKE   +  Y+ +L I  F+  +D+G  YFI KP+F+L+ 
Sbjct: 303 DNYIAHPNNTVTSINYLFAGAKELKLLDTYKDNLNISLFDKAVDFGVLYFITKPVFLLLE 362

Query: 352 YFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVL 411
           YF N++GNFG+AI+L T+ +KL+ FPL+ K YVS   ++++QP I  ++E +K    ++ 
Sbjct: 363 YFNNVIGNFGLAILLLTIVIKLIMFPLSHKSYVSMLKLRHLQPDIVRIKELYKNDNDKM- 421

Query: 412 QKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPT 471
            K +  ++K +N+NP++G  P+L+QIPVFFA+YKV+ +++EMRHAPF+ WIKDL++ D  
Sbjct: 422 SKEISAIFKKNNVNPMSGFVPVLIQIPVFFALYKVLFVTIEMRHAPFYLWIKDLSSFDTA 481

Query: 472 NIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMS---PPPADKGQAMILNWMPVVFV 528
           NI T+FG+L F  P  + +GI P+I+ ++M IQ K++       DK QA  + ++P +F+
Sbjct: 482 NILTIFGLLKFNPP--ICIGILPVILGITMIIQQKLNNHSSLNQDKTQANFMKFLPYIFI 539

Query: 529 FALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRST 573
           F  SSFPAGLIIYW  SN I+IVQQ +I      +      ++  
Sbjct: 540 FIFSSFPAGLIIYWICSNSITIVQQLIIKHYVTKKFNFYKTVQQE 584


>gi|209693637|ref|YP_002261565.1| putative inner membrane protein translocase component YidC
           [Aliivibrio salmonicida LFI1238]
 gi|254772743|sp|B6EP40|OXAA_ALISL RecName: Full=Inner membrane protein oxaA
 gi|208007588|emb|CAQ77688.1| inner membrane protein [Aliivibrio salmonicida LFI1238]
          Length = 541

 Score =  351 bits (901), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 143/571 (25%), Positives = 247/571 (43%), Gaps = 43/571 (7%)

Query: 1   MERNWN-YFVAIAL-SVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           M+   N   +A+AL S ++   WQ      +   ++  ++  +    P     + +    
Sbjct: 1   MDTQRNILLLALALVSFLLFQQWQVETNPQQPATVSTVQQTHKNGDVP-----TSSTANS 55

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
           D    +      + +    L   ++  G    +  L  Y  ++ S +  V L + ++  +
Sbjct: 56  DAPVDSAQSDKLITITTDVLTLKVDTLGGDIIESVLNKYDAELDSKAKFVLLKNDAD--H 113

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPI---KLVFKNANNILFERTISLD 175
           +Y A+   +                  +  +L          L  +       +  I   
Sbjct: 114 SYIAQSGLIGPQGIDSNTGRAQFTAKKTDYVLADGQNELRIPLTLEKNGITYTKTLIVKR 173

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKY 234
           + Y   +  TV N S           + ++      + T     G      D    +  +
Sbjct: 174 DSYAIDVEYTVNNQSSAPATVEMYANLKQNLLDDGGSLTMPTYRGGAYSTEDTRYKKYSF 233

Query: 235 SDIEKSSISNFHES-NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANE 293
            D+E  ++S    +   W G+   Y+AS +IP          +   D             
Sbjct: 234 DDMEDKNLSIDMTNGQGWAGMLQHYFASAWIPRNVNDATLTTRVAGD---YGYIGVRMPS 290

Query: 294 ITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYF 353
           +TI  G+  T T  L+ G K  P +    K       ++ +D+GW +FIA P+  L+S+ 
Sbjct: 291 VTIPAGQEDTLTATLWTGPKLQPQMAATAK-----YLDLSVDYGWLWFIASPLHKLLSFI 345

Query: 354 YNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQK 413
            ++VGN+G+AIM+ T  V+   +PL K QY S A M+ +QPK+  +RE+      Q + +
Sbjct: 346 QSIVGNWGLAIMILTFIVRGAMYPLTKAQYTSMAKMRMLQPKLAAMRERIGD-DRQRMSQ 404

Query: 414 AMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNI 473
            M++LYK   +NPL GC PI+LQ+P+F ++Y  +  S+E+RHAPF+GWI DL+A DP   
Sbjct: 405 EMMELYKKEKVNPLGGCLPIVLQMPIFISLYWALMESVELRHAPFFGWITDLSAQDPYY- 463

Query: 474 FTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALS 532
                             I P++M  SMF+  KMSP    D  Q  I+ ++PV+F     
Sbjct: 464 ------------------ILPLLMGASMFLIQKMSPTTVTDPMQQKIMTFIPVMFTVFFL 505

Query: 533 SFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
            FPAGL++YW  SNV++++QQ +I +    +
Sbjct: 506 WFPAGLVLYWLVSNVVTLIQQTLIYRALEKK 536


>gi|331017731|gb|EGH97787.1| membrane protein insertase [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 562

 Score =  351 bits (901), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 146/585 (24%), Positives = 241/585 (41%), Gaps = 53/585 (9%)

Query: 1   MERNWNYFVAIALSVIIVYA---WQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           M+      + +AL+++       W   Y    +   N    N           N+ +A  
Sbjct: 1   MDI-KRTILIVALAIVTYVGVLKWNQDYGQAAMPTQNVAASNTAPGIPDTAAGNNGSASA 59

Query: 58  IDDRAQ------------ALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNS 105
               A             A++    + +K   L  +I+  G     L L  Y        
Sbjct: 60  DVPSATGNTASAAPLETPAVASKDLIHVKTDVLDLAIDPVGGDVVQLRLPLYPRRQDRPD 119

Query: 106 PIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFK 161
               L   +  +  + A+     T       +   V++             +  ++L F 
Sbjct: 120 VPFQLF-DNGGERTFLAQSGLTGTNGPDARASGRPVYSSAQKSYQLADGQDSMVVELKFS 178

Query: 162 NANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT----ATNTFGVQ 217
                  +R       Y   +   V N S      +   ++ R                 
Sbjct: 179 ENGVNYIKRFTFKRGLYDLVMTYVVDNQSAQPWAGNLFAQLKRDASSDPSSTTATGTATY 238

Query: 218 EGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKY 277
            G       +   +    DI+K  I        W+     Y+ + +IP    +   Q + 
Sbjct: 239 LGAALWTAAEPYKKVSMKDIDKGQIKEN-VQGGWVAWLQHYFVTAWIPDHNVTNAVQTR- 296

Query: 278 LSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWG 337
             D    Y   F++  +++ PG    TT  L+AG K    +         P  E+ +D+G
Sbjct: 297 -KDSQGNYIIGFTSPTLSVAPGAQGETTATLYAGPKSQAVLKELS-----PGLELTVDYG 350

Query: 338 WFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKID 397
           + +FIA+P+F L+ + + ++GN+G +I++ T+ +K LFFPL+   Y S A M+ + PK+ 
Sbjct: 351 FLWFIAQPIFWLLQHIHAILGNWGWSIIVLTMLIKGLFFPLSAASYKSMARMRAVAPKLA 410

Query: 398 ELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAP 457
            L+E+      Q + +AM++LYK   INPL GC PIL+Q+PVF ++Y V+  S+EMR AP
Sbjct: 411 VLKEQHGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLSLYWVLLESVEMRQAP 469

Query: 458 FWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQA 517
           +  WI DL+  DP                     I PIIM  +MFIQ +++P P D  QA
Sbjct: 470 WILWITDLSIKDPFF-------------------ILPIIMGATMFIQQRLNPTPPDPMQA 510

Query: 518 MILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
            ++  MP++F F    FPAGL++YW  +N +SI QQA I +   A
Sbjct: 511 KVMKMMPIIFTFFFLWFPAGLVLYWVVNNTLSIAQQAYITRKIEA 555


>gi|114322029|ref|YP_743712.1| protein translocase subunit yidC [Alkalilimnicola ehrlichii MLHE-1]
 gi|122310593|sp|Q0A4L5|OXAA_ALHEH RecName: Full=Inner membrane protein oxaA
 gi|114228423|gb|ABI58222.1| protein translocase subunit yidC [Alkalilimnicola ehrlichii MLHE-1]
          Length = 562

 Score =  351 bits (901), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 136/571 (23%), Positives = 245/571 (42%), Gaps = 38/571 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNF-----YVYPRIEEMNNERKNIQTVKQPNQVDNSYAA 55
           ME     F+ +ALS++ +  W ++           E +  E       + P++  +    
Sbjct: 1   MENQR-IFLFLALSILGLLLWTSWERDTRAPVATEEVVEAEDDVPAPAETPDEAPDPADG 59

Query: 56  VLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSN 115
                    +    RV +    +   I+ +G     ++L  +    + ++P   +    +
Sbjct: 60  ETPARDRAEVEDERRVRVVTDLMDLEISTRGGDIRRVDLLQHGTTATDDTPFRLMADDRD 119

Query: 116 TKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANN--ILFERTIS 173
                   L   S              +            ++L + + N    +      
Sbjct: 120 PLFIAQTGLIDDSDNRPDHRALFRAERDEYRLSEGEDEIQVRLTWADENRGIEVARVYTV 179

Query: 174 LDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKS--LVE 231
             + Y+  +   V N   ++ R     ++ R+     T  + +       +        +
Sbjct: 180 QRDSYVIDVRHQVRNAGDEEWRGYSYFQLRRNPDPPGTTPWYIYTFTGGSIYSPDDRFEK 239

Query: 232 QKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSA 291
             + D++ +S+S       W  +   Y+   +IP +  +     +  +     Y    S+
Sbjct: 240 ISFDDMDDTSLSRDIRD-GWAAMIQHYFLGAWIPPESQALRYYTRAQAGNE--YVLGMSS 296

Query: 292 NEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMS 351
              T+ PG      N LF G KE   +      +      + +D+G+   +AKP+F L+ 
Sbjct: 297 GRQTVQPGGEAEFVNRLFVGPKEQDRLRELHDSMT-----LSVDYGFLTVLAKPLFWLLD 351

Query: 352 YFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVL 411
              ++VGN+G+AI+L T+ +KL F+ L+   Y S A M+ +QP++ +L+E+      Q L
Sbjct: 352 NIQDIVGNWGVAIILVTLLIKLAFYKLSATSYRSMAKMRRVQPRMQQLKERHGDDK-QAL 410

Query: 412 QKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPT 471
            +AM++LYK   INPL GC PIL+QIPVF A+Y V+  S+E+RHAPF  WI+DL++ DP 
Sbjct: 411 NQAMMELYKKEKINPLGGCLPILVQIPVFIALYWVLLESVELRHAPFMLWIQDLSSRDPY 470

Query: 472 NIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFAL 531
                               + P++M  +MF+Q +++P P D  Q  I+  +P+VF    
Sbjct: 471 F-------------------VLPLLMGATMFLQQRLNPAPLDPIQQRIMMALPIVFTGFF 511

Query: 532 SSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
             FPAGL++YW  +N +SI QQ  IM+   A
Sbjct: 512 MLFPAGLVLYWLVNNGLSIAQQWYIMRNLEA 542


>gi|307547061|ref|YP_003899540.1| preprotein translocase subunit YidC [Halomonas elongata DSM 2581]
 gi|307219085|emb|CBV44355.1| K03217 preprotein translocase YidC subunit [Halomonas elongata DSM
           2581]
          Length = 566

 Score =  351 bits (900), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 133/580 (22%), Positives = 230/580 (39%), Gaps = 51/580 (8%)

Query: 15  VIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR------------- 61
            +IV  W   Y             +       +  D   + + +                
Sbjct: 17  YLIVVQWNQDYGQATQAPEAPAITSDSPASSQDAADTDSSDLSVPSSGTANAGNADMGSA 76

Query: 62  ----AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTK 117
                 A +    V +    L   I+ +G       L  +     ++ P V L    N  
Sbjct: 77  MPGDKAASNSRDLVAVATDVLDIRIDPQGGDIVYAALPQHKYAEDTDQPFVLL--SDNAT 134

Query: 118 NAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEH 177
            +Y A        +   +  +                 + L        + +R     + 
Sbjct: 135 RSYVARSGLQLEGHQGRIAFTPEK-TEYRLNEGDDQLQVDLSATVNGVDVIKRFTFDRDS 193

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNT----FGVQEGFIAVLGDKSLVEQK 233
           Y   +   + N S   +     G+++R      ++          G      +   ++  
Sbjct: 194 YAVNVAYLLDNPSETPVTARFVGQLVRDNSSDPSSGPKMGMRSFLGAAFSTPEDRYLKVD 253

Query: 234 YSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANE 293
           + DI      N      W+ +   Y+ S + P ++      F   +D   R  A F+   
Sbjct: 254 FDDIRDGKFENRDVEGGWVAMIQHYFTSAWAPPQDQKN--LFYTATDSQNRNVAAFAGPT 311

Query: 294 ITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYF 353
            T+      T    L+ G K    +         P  E+ +D+GW +FIA P+F L+ + 
Sbjct: 312 RTLGAESKATLAATLYVGPKIQDRLEAVA-----PNLELTVDFGWLWFIANPLFWLLDHI 366

Query: 354 YNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQK 413
            +++GN+G +I++ T+ VK    PL+ K Y S A M+ + P++  L+E++     Q + +
Sbjct: 367 QDVIGNWGWSIVILTLLVKTALLPLSAKAYKSMARMRKLGPEMQRLKEQYGD-DRQKMSQ 425

Query: 414 AMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNI 473
            M++ Y+   INPL GC PI++Q+PVF A+Y ++  S+E+RHAPF  WI DL+  DP   
Sbjct: 426 EMMKFYQKEKINPLGGCLPIVVQMPVFIALYWMLLESVELRHAPFMFWITDLSVKDPYF- 484

Query: 474 FTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSS 533
                             + PI+M  SMF+Q  ++P P D  QA I+  +PVVF F    
Sbjct: 485 ------------------VLPILMGASMFVQQLLNPTPPDPTQAKIMKLLPVVFTFFFLW 526

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRST 573
           FPAGL+IYW  +N+ SI QQ  I +   A+  +   +++ 
Sbjct: 527 FPAGLVIYWVVNNITSIAQQYFITRKVEADPNVGKGMKTK 566


>gi|213968445|ref|ZP_03396588.1| inner membrane protein, 60 kDa [Pseudomonas syringae pv. tomato T1]
 gi|301384267|ref|ZP_07232685.1| putative inner membrane protein translocase component YidC
           [Pseudomonas syringae pv. tomato Max13]
 gi|302131966|ref|ZP_07257956.1| putative inner membrane protein translocase component YidC
           [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|213926733|gb|EEB60285.1| inner membrane protein, 60 kDa [Pseudomonas syringae pv. tomato T1]
 gi|330876349|gb|EGH10498.1| membrane protein insertase [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
          Length = 562

 Score =  351 bits (900), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 146/585 (24%), Positives = 241/585 (41%), Gaps = 53/585 (9%)

Query: 1   MERNWNYFVAIALSVIIVYA---WQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           M+      + +AL+++       W   Y    +   N    N           N+ +A  
Sbjct: 1   MDI-KRTILIVALAIVTYVGVLKWNQDYGQAAMPTQNVAASNTAPGIPDTAAGNNGSASA 59

Query: 58  IDDRAQ------------ALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNS 105
               A             A++    + +K   L  +I+  G     L L  Y        
Sbjct: 60  DVPSATGNTTSAAPLETPAVASKDLIHVKTDVLDLAIDPVGGDVVQLRLPLYPRRQDRPD 119

Query: 106 PIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFK 161
               L   +  +  + A+     T       +   V++             +  ++L F 
Sbjct: 120 VPFQLF-DNGGERTFLAQSGLTGTNGPDARASGRPVYSSAQKSYQLADGQDSMVVELKFS 178

Query: 162 NANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT----ATNTFGVQ 217
                  +R       Y   +   V N S      +   ++ R                 
Sbjct: 179 ENGVNYIKRFTFKRGLYDLVMTYVVDNQSAQPWAGNLFAQLKRDASSDPSSTTATGTATY 238

Query: 218 EGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKY 277
            G       +   +    DI+K  I        W+     Y+ + +IP    +   Q + 
Sbjct: 239 LGAALWTAAEPYKKVSMKDIDKGQIKEN-VQGGWVAWLQHYFVTAWIPDHNVTNAVQTR- 296

Query: 278 LSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWG 337
             D    Y   F++  +++ PG    TT  L+AG K    +         P  E+ +D+G
Sbjct: 297 -KDSQGNYIIGFTSPTLSVAPGAQGETTATLYAGPKSQAVLKELS-----PGLELTVDYG 350

Query: 338 WFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKID 397
           + +FIA+P+F L+ + + ++GN+G +I++ T+ +K LFFPL+   Y S A M+ + PK+ 
Sbjct: 351 FLWFIAQPIFWLLQHIHAILGNWGWSIIVLTMLIKGLFFPLSAASYKSMARMRAVAPKLA 410

Query: 398 ELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAP 457
            L+E+      Q + +AM++LYK   INPL GC PIL+Q+PVF ++Y V+  S+EMR AP
Sbjct: 411 VLKEQHGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLSLYWVLLESVEMRQAP 469

Query: 458 FWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQA 517
           +  WI DL+  DP                     I PIIM  +MFIQ +++P P D  QA
Sbjct: 470 WILWITDLSIKDPFF-------------------ILPIIMGATMFIQQRLNPTPPDPMQA 510

Query: 518 MILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
            ++  MP++F F    FPAGL++YW  +N +SI QQA I +   A
Sbjct: 511 KVMKMMPIIFTFFFLWFPAGLVLYWVVNNTLSIAQQAYITRKIEA 555


>gi|192360367|ref|YP_001984274.1| inner membrane protein, 60 kDa [Cellvibrio japonicus Ueda107]
 gi|254772765|sp|B3PIU1|OXAA_CELJU RecName: Full=Inner membrane protein oxaA
 gi|190686532|gb|ACE84210.1| inner membrane protein, 60 kDa [Cellvibrio japonicus Ueda107]
          Length = 552

 Score =  351 bits (900), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 142/571 (24%), Positives = 251/571 (43%), Gaps = 41/571 (7%)

Query: 1   MERNWNYFVAI--ALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           M+   N  +A   A+ +++   W +F       +  N              +    + + 
Sbjct: 1   MDWQKNLLLAAIAAVILMLFIRWNHFQEQLPQHQAGNTPAGSSIAAIAPDSNGDIPSAVP 60

Query: 59  DDRAQALSMS-----PRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSP 113
                  + +       +++K  +L+ +IN  G     ++L  +   +++      LL  
Sbjct: 61  TASDTPQATADSSKVELIQVKTDNLLVTINPLGGDIASVSLPRHFAKLNTPDEPFVLLDN 120

Query: 114 SNTKNAYFAELDYVSTANNIELPNSNTVWNLISG---KILTPTTPIKLVFKNANNILFER 170
            N  + Y ++   + T             +  +    K  +    + L  +     + +R
Sbjct: 121 RNN-HTYVSQSGLIGTNGTDTAQGRPLFNSSSTSYELKEGSDGLVVDLTLQQGAVNITKR 179

Query: 171 TISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTAT---NTFGVQEGFIAVLGDK 227
                  YL  +   + N +         G+I R                 G      ++
Sbjct: 180 FSFKRGDYLIGVEYLIDNQAETPWSAQLYGQIKRDSQNFVKVSALEMNPYLGAAITTSEE 239

Query: 228 SLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA 287
           +  +  + DI K +         W+ +   Y+ S +IP   +  + + + L D    Y  
Sbjct: 240 NYKKIHFEDIAKQTFE-TSRQGGWVAMVQHYFISAWIPDASSQVNYKLRKLGD-QDLYLL 297

Query: 288 KFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMF 347
            F+   + + PG         +AG K+   +         P  ++ +D+GW ++IAKP+F
Sbjct: 298 GFTTQPVVVEPGSKGVIKASFYAGPKDTERLEEIS-----PYLDLTVDYGWLWWIAKPLF 352

Query: 348 MLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSP 407
             + + +  +GN+G+AI+  T+ VKLLFFPL+   Y S A M+ +QPK+ EL+E++    
Sbjct: 353 AFLKFIHGFLGNWGLAIIGLTLSVKLLFFPLSAASYRSMAKMRKLQPKLLELKERY-GED 411

Query: 408 PQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAA 467
            Q   + M++LYKT  +NP  GC P+L+Q+PVF A+Y V+  S+E+RHAPF+GWI+DL+ 
Sbjct: 412 RQKFSQEMMKLYKTEQVNPFGGCLPLLIQMPVFIALYWVLMESVELRHAPFFGWIEDLSR 471

Query: 468 ADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVF 527
            DP                     + PII   +M+I  K++P P D  QA I+N +P VF
Sbjct: 472 MDPYF-------------------VLPIIYGATMWIMQKLNPQPTDPMQARIMNMLPFVF 512

Query: 528 VFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
            F    FPAGL++YW  +N++SI QQ VI +
Sbjct: 513 TFMFLWFPAGLVLYWVTNNLLSIAQQYVITR 543


>gi|88658314|ref|YP_507580.1| putative inner membrane protein translocase component YidC
           [Ehrlichia chaffeensis str. Arkansas]
 gi|88599771|gb|ABD45240.1| inner-membrane protein, 60 kDa [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 579

 Score =  351 bits (899), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 213/585 (36%), Positives = 324/585 (55%), Gaps = 19/585 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M    N  +A+ LSV+I+  W+  Y      +   E         P   DN         
Sbjct: 1   MVEVRNLILAVILSVLIMMGWRFIYDKFFTTQHAIEDNTSSDAMIPEIDDN--FIHKTRS 58

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
                + + R++L N  + GSI+LKGAQFDDL  + YH+    NS  + LLSP  T+N Y
Sbjct: 59  EVIESNTNIRIKLSNEKMNGSISLKGAQFDDLIFKNYHVTPDKNSEGIVLLSPEETENVY 118

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLF 180
           F E  ++   + I +P  +++WN      L+P  PI L + N   ++F+  I+LD  Y+F
Sbjct: 119 FIEFGWIDPQHKITVPTHSSIWNSDQST-LSPNNPITLTWDNKQGVVFKIKITLDNDYMF 177

Query: 181 KIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS 240
           KI   VTNN+   I   P GRI R K     + +   EG +   G  +L E  Y  I K 
Sbjct: 178 KIEQMVTNNTDSIINLIPYGRINRSKHTAEKSYWISHEGAVGSFG-NTLKEWTYKAITKE 236

Query: 241 SISNFHESNS------WLGISDKYWASVFIPSKETSFHSQFK---YLSDGHARYQAKFSA 291
                 + +       W+GI DKYW +  IP+     +  F       +   R+Q  FS 
Sbjct: 237 KNIKIQQQDINDNQNQWIGIGDKYWFTALIPNVSQKSNLNFHVKHAKHNSKDRFQVDFSH 296

Query: 292 NEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMS 351
           +     P  ++T+ N+LFAGAKE   +  Y+ +L I  F+  +D+G  YFI KP+F+L+ 
Sbjct: 297 DNYIAHPNNTVTSINYLFAGAKELKLLDTYKDNLNISLFDKAVDFGVLYFITKPVFLLLE 356

Query: 352 YFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVL 411
           YF N++GNFG+AI+L T+ +KL+ FPL+ K YVS   ++++QP I  ++E +K    ++ 
Sbjct: 357 YFNNVIGNFGLAILLLTIVIKLIMFPLSHKSYVSMLKLRHLQPDIVRIKELYKNDNDKM- 415

Query: 412 QKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPT 471
            K +  ++K +N+NP++G  P+L+QIPVFFA+YKV+ +++EMRHAPF+ WIKDL++ D  
Sbjct: 416 SKEISAIFKKNNVNPMSGFVPVLIQIPVFFALYKVLFVTIEMRHAPFYLWIKDLSSFDTA 475

Query: 472 NIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMS---PPPADKGQAMILNWMPVVFV 528
           NI T+FG+L F  P  + +GI P+I+ ++M IQ K++       DK QA  + ++P +F+
Sbjct: 476 NILTIFGLLKFNPP--ICIGILPVILGITMIIQQKLNNHSSLNQDKTQANFMKFLPYIFI 533

Query: 529 FALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRST 573
           F  SSFPAGLIIYW  SN I+IVQQ +I      +      ++  
Sbjct: 534 FIFSSFPAGLIIYWICSNSITIVQQLIIKHYVTKKFNFYKTVQQE 578


>gi|77920733|ref|YP_358548.1| inner-membrane protein [Pelobacter carbinolicus DSM 2380]
 gi|77546816|gb|ABA90378.1| protein translocase subunit yidC [Pelobacter carbinolicus DSM 2380]
          Length = 542

 Score =  350 bits (898), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 147/571 (25%), Positives = 256/571 (44%), Gaps = 38/571 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
             N N  +A+ L V+I   +  F+V P    +N+E    ++             V   D 
Sbjct: 1   MENKNVIIALLLMVLIWTGYTTFFVKPAPAPVNDEPAVAESFPAVTPEVVGERVVPSVDH 60

Query: 62  AQALSMSPRV-----ELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNT 116
             A + S  +      +            G +   L L+ Y   +  +S +VTL+   N 
Sbjct: 61  VMAAAASSDIAPRDFVVDTEDFRAVFTNVGGRLKKLELKNYRETLKEDSGLVTLVDADNA 120

Query: 117 KNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE 176
            + +   L     A       +  V              ++     +N ++ E+  SL+ 
Sbjct: 121 LSTF-GILGQGDIALAENTVYATDVPAEGLTLGSDDKKDLRFTAVLSNGVVVEKVFSLNG 179

Query: 177 H-YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
             Y F +   V N     I+ S    +++   +    +     G      D+    +   
Sbjct: 180 KGYDFNLQVRVVNPGDRPIQGSLELLMVQPWSEDREGSRYSFVGPAIYADDELNTYK--V 237

Query: 236 DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
              +        S  W    DKY+ +  +P +        + + +         S+  ++
Sbjct: 238 KELEDGAIRHDNSGIWTAFEDKYFMTAAVPLRSEQHAFVLEKVGNAVKNI---VSSGNLS 294

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY- 354
           +   +S+T    L+AG ++   +            +  ID+G+F  +A+P+  ++ + + 
Sbjct: 295 VGGQQSVTLDYLLYAGPRDLDVLEQVNH-----GLDKAIDFGFFDMLARPLLSVLKFCHK 349

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
           NL+ N+G+AI+L TVF+K+LF+PL  K Y S  +M+ +QP++  LREK+K+   + + + 
Sbjct: 350 NLISNYGVAIILLTVFIKVLFWPLTHKSYKSMRDMQKLQPEMQRLREKYKKDK-ERMNRE 408

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           +++LY+ + +NP+ GC P+  QIPVFFA+YKV+  S+ +RH PF  WI+DLAA DP    
Sbjct: 409 IMELYRKNRVNPMGGCLPMFAQIPVFFALYKVLLGSIALRHEPFIFWIQDLAAKDPYY-- 466

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSF 534
                            I P+IM ++MF Q KMSP   D  QA I+ +MPV+F F   +F
Sbjct: 467 -----------------ITPLIMGVTMFFQQKMSPTTMDSQQAKIMLFMPVIFTFMFLNF 509

Query: 535 PAGLIIYWSWSNVISIVQQAVIMKMHGAEIG 565
           P+GL+IYW  +NV++I QQ  I +  G  + 
Sbjct: 510 PSGLVIYWLVNNVLTIAQQWFINREGGQPVK 540


>gi|261346746|ref|ZP_05974390.1| membrane protein insertase, YidC/Oxa1 family [Providencia
           rustigianii DSM 4541]
 gi|282565146|gb|EFB70681.1| membrane protein insertase, YidC/Oxa1 family [Providencia
           rustigianii DSM 4541]
          Length = 550

 Score =  350 bits (897), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 147/574 (25%), Positives = 271/574 (47%), Gaps = 56/574 (9%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL  +    WQ +      +++  E K +QT +Q   + NS    + + 
Sbjct: 1   MDSQRNLLL-IALLFVTFLVWQAW----ESDKVAQETKTVQTSQQKTDMPNSDGQAVTNS 55

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
                     + +K   L   IN +G   D+ +L  Y   ++S  P   L   +     Y
Sbjct: 56  -----EQGKLIAVKTDVLDVRINTRGGDIDEADLLAYPATLNSPDPFRLL--ETTPGFVY 108

Query: 121 FAELDYVST-------ANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTIS 173
            A+   +          NN + P           +       + + F + N +++++T  
Sbjct: 109 QAQSGLIGPHGPDNPANNNGQRPLYTADSASFELQAGQDELRVPMSFTDNNGVVYQKTYI 168

Query: 174 LD-EHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-----KPQTATNTFGVQEGFIAVL--G 225
           L    Y  ++  ++ N +   +  +  G++ +      +  T +N F +     A     
Sbjct: 169 LKRGKYTVEVEYSIQNPTAQPLSLAFFGQLKQTIALPEQRDTGSNNFALHTYRGAAYSSD 228

Query: 226 DKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARY 285
           + +  +  +SDIE  ++S       W+ +  +Y+A+ ++P       S F  +       
Sbjct: 229 ENNYKKYSFSDIEDKNLSLT-TKGGWVAMLQQYFATAWVPEATEQ--STFYTIDLDKKSA 285

Query: 286 QAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKP 345
              + +  +TI    + T ++ L+ G +    +         P  ++ +D+GW +FI++P
Sbjct: 286 IVGYKSEPVTIAANGAGTYSSTLWIGPEIQSEMAEVA-----PHLDLTVDYGWLWFISQP 340

Query: 346 MFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQ 405
           +F L+ + +  VGN+GIAI++ T  V+ + +PL K QY S A M+ +QPK+  +RE+   
Sbjct: 341 LFKLLKFIHGFVGNWGIAIIVITFIVRGIMYPLTKAQYTSMAKMRLLQPKLAAMRERIGD 400

Query: 406 SPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDL 465
              Q + + M+ +YK   +NPL GC P+L+Q+P+F A+Y ++  S+E+RHAPF+GWI+DL
Sbjct: 401 DK-QRMSQEMMAMYKAEKVNPLGGCLPLLIQMPIFLALYYMLMGSVELRHAPFFGWIQDL 459

Query: 466 AAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMP 524
           +A DP                     I P++M ++MF+  KMSP    D  Q  I+ +MP
Sbjct: 460 SAQDPYY-------------------ILPVLMGVTMFVIQKMSPTAVTDPMQQKIMTYMP 500

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           VVF      FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 501 VVFTVFFLWFPSGLVLYYIVSNLVTIIQQQIIYR 534


>gi|212632922|ref|YP_002309447.1| inner membrane protein, 60 kDa [Shewanella piezotolerans WP3]
 gi|254778162|sp|B8CH68|OXAA_SHEPW RecName: Full=Inner membrane protein oxaA
 gi|212554406|gb|ACJ26860.1| Inner membrane protein, 60 kDa, putative [Shewanella piezotolerans
           WP3]
          Length = 542

 Score =  350 bits (897), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 133/563 (23%), Positives = 239/563 (42%), Gaps = 36/563 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           ME   N  + I L  +    WQ +      + +   + ++      +   +         
Sbjct: 1   MESQRN-ILLIGLLFVSFLLWQQWQADKAPQPVAQTQSSVAPSTVADAHSSDVPDADSAL 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
                +    + +     +  I+  G       L  + L+   + P V L   ++    Y
Sbjct: 60  PETVTASKELITVTTDQFVLKIDPVGGDIVHSALLSHKLEQDGDDPFVLLEQTNDIY--Y 117

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL---TPTTPIKLVFKNANNILFERTISL-DE 176
            A+   +              ++  S +       T  + L +  AN + + +  +    
Sbjct: 118 IAQSGLIGRDGIDSSTTGRAHFDSASREYDLAGQDTLEVPLTYLAANGVTYTKLFTFYRG 177

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
            +   +   + N S  Q++    G+I     ++ ++         A     +  E+   D
Sbjct: 178 KHNVDVDYQINNTSDAQLQVQMYGQIKHSIKKSESSMMMPTYRGAAFSTADTRYEKYSFD 237

Query: 237 IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITI 296
                  N      W+ +   Y+ S ++P +           + G A     F      I
Sbjct: 238 DMADKNLNKSTLGGWVAMLQHYFVSAWVPPENDKNIIFSSVSAGGLAN--IGFRGALYDI 295

Query: 297 LPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNL 356
            PG   +     + G K+   +    +        +++D+G+ +++A P+  L+ ++ + 
Sbjct: 296 APGTEQSIKAQFYVGPKDQEALSALSES-----LNLVVDYGFLWWLAIPIHWLLMFYQSF 350

Query: 357 VGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMI 416
           VGN+G+AI+L T+ V+ + +PL K QY S A M+N+QPK+ +++E+F     Q + +AM+
Sbjct: 351 VGNWGVAIILITLTVRGMLYPLTKAQYTSMAKMRNLQPKLADMKERFGD-DRQKMGQAMM 409

Query: 417 QLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTL 476
           +LYK   +NP+ GC PILLQ+P+F A+Y V+  S E+RHAPF  WI DL+  DP      
Sbjct: 410 ELYKKEKVNPMGGCLPILLQMPIFIALYWVLLESYELRHAPFMLWITDLSVQDPYY---- 465

Query: 477 FGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSP--PPADKGQAMILNWMPVVFVFALSSF 534
                          + PI+M +SMFI  KM P  P  D  Q  ++ WMPV+F      F
Sbjct: 466 ---------------VMPILMGVSMFIMQKMQPMAPTMDPMQVKMMQWMPVIFTVFFLWF 510

Query: 535 PAGLIIYWSWSNVISIVQQAVIM 557
           PAGL++YW   N+++I QQ +I 
Sbjct: 511 PAGLVLYWLVGNLVAITQQKIIY 533


>gi|297539958|ref|YP_003675727.1| membrane protein insertase [Methylotenera sp. 301]
 gi|297259305|gb|ADI31150.1| membrane protein insertase, YidC/Oxa1 family domain containing
           protein [Methylotenera sp. 301]
          Length = 542

 Score =  350 bits (897), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 148/559 (26%), Positives = 247/559 (44%), Gaps = 32/559 (5%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
                  + +  S+ I+  W  +       E+  +  + QTV        + +  +  D 
Sbjct: 1   MDTKRLVLFVIFSMSILMLWDAWQRQHAPAEVVQQ--SSQTVAGATSSTAAVSGNVAVDS 58

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
              LS   R+ +        I   G     L L  +    +  +  V LL  S     Y 
Sbjct: 59  DFKLSAGQRISVTTDLYKADIETTGGDLRRLELLKHRASDNVKTNFV-LLDDSAKPMTYV 117

Query: 122 AELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHYLFK 181
           A+   +            +       +    T  ++L +      + +        Y   
Sbjct: 118 AQTGLIGADLPSHKAVFTSAAPTYQMQDGKDTLEVRLSWVGNGVTVDKVYTFHRNKYAID 177

Query: 182 IVDTVTNNSIDQIRFSPRGRIMR-HKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKS 240
           +   + N S   I      +I+  ++    +       G           +  + D+ K 
Sbjct: 178 VNYEIKNGSAAAITPVVYYQIVHDNESNQGSKLMPTFTGGTYYTEATKFKKLAFKDMAKE 237

Query: 241 SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGK 300
            +     ++ W+G+   Y+ S +IP        +F         Y+    +   TI PG 
Sbjct: 238 PLKVT-SNDGWVGLLQHYFVSAWIPKDG--LAREFYTEKLNEHMYRIGSKSTLSTIAPGA 294

Query: 301 SITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNF 360
           S+T    LF+G +    +         P  E  +D+GW   +A P+F ++S  ++LV N+
Sbjct: 295 SLTVPARLFSGPQTKKDLVETA-----PGLEYTVDYGWLKMVASPLFWVLSLIHSLVHNW 349

Query: 361 GIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYK 420
           G+AI+L T+ +K  F+PL+ K Y S A M+ + P+++ +++KF     Q +Q+AM++LYK
Sbjct: 350 GVAIILLTLLIKAAFYPLSAKSYRSMAQMRELAPRLESMKQKFGD-DRQKMQQAMMELYK 408

Query: 421 THNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGIL 480
           T  INP++GC PIL+QIPVF ++Y ++  S+E+RHAPF+GWI+DL+A DP          
Sbjct: 409 TEKINPMSGCLPILIQIPVFISLYWMLLGSIELRHAPFFGWIQDLSAVDPYY-------- 460

Query: 481 PFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLII 540
                      I PIIM +SM IQ K++P P D  QA ++ WMPV+F      FPAGL++
Sbjct: 461 -----------ILPIIMGISMIIQTKLNPKPTDPIQAKVMTWMPVIFSVFFFFFPAGLVL 509

Query: 541 YWSWSNVISIVQQAVIMKM 559
           YW  +N+ISI QQ  + K 
Sbjct: 510 YWVVNNIISIWQQWYVNKS 528


>gi|271502719|ref|YP_003335745.1| membrane protein insertase, YidC/Oxa1 family domain containing
           [Dickeya dadantii Ech586]
 gi|270346274|gb|ACZ79039.1| membrane protein insertase, YidC/Oxa1 family domain containing
           [Dickeya dadantii Ech586]
          Length = 543

 Score =  350 bits (897), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 150/570 (26%), Positives = 252/570 (44%), Gaps = 52/570 (9%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  V IAL  +    WQ +      E   N     QT +Q N      A   +  
Sbjct: 1   MDSQRNLLV-IALLFVTFMIWQQW------ETDKNPPATTQTTQQANGAVGDAANQGVP- 52

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
              A      + +K   L  +IN +G   ++ +L  Y  ++ SN P   L   S     Y
Sbjct: 53  ---ASGQGKLITVKTDVLSLNINTRGGDIEEADLLAYPAELGSNQPFKLL--ESTPAFTY 107

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL-----TPTTPIKLVFKNANNILFERTISLD 175
            A+             N        S              I L + +AN + F +T  L 
Sbjct: 108 QAQSGLTGKNGPDNPANGARPLYTASADRFELAAGQNELRIPLTYTDANGVSFTKTFVLK 167

Query: 176 -EHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-----KPQTATNTFGVQEGFIAVLGDKSL 229
              Y   +  +V N S   +  +  G++ +         T +N F +     A       
Sbjct: 168 RGEYALNVEYSVNNTSAQPLELTLFGQLKQSIDLPSHRDTGSNNFALHTYRGAAFSSSDD 227

Query: 230 VEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKF 289
             +KYS  +     N +    W+ +  +Y+A+ ++P    +  + F   + G+      F
Sbjct: 228 KYRKYSFSDMKENLNINTQGGWVAMLQQYFATAWVP--NAAASNTFYSANLGNGLAAIGF 285

Query: 290 SANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFML 349
            +  + + PG        L+ G +    +         P  ++ +D+GW +FI++P+F L
Sbjct: 286 KSPSVVVQPGSQQNLNATLWVGPEIQDKMAAVA-----PHLDLTVDYGWLWFISQPLFKL 340

Query: 350 MSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQ 409
           + + +  +GN+G +I+  T  V+ + +PL K QY S A M+ +QPK+  +RE+      Q
Sbjct: 341 LKFLHGFIGNWGFSIIAITFIVRGIMYPLTKAQYTSMAKMRMLQPKLQAMRERIGDDK-Q 399

Query: 410 VLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAAD 469
            + + M+ LYKT  +NPL GC+P+++Q+P+F A+Y ++  S+E+RHAPF  WI DL+A D
Sbjct: 400 RMSQEMMALYKTEKVNPLGGCFPLVIQMPIFLALYYMLMGSVELRHAPFALWIHDLSAQD 459

Query: 470 PTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFV 528
           P                     + PI+M L+MF   KMSP    D  Q  I+ +MPV+F 
Sbjct: 460 PYY-------------------VLPILMGLTMFFIQKMSPTTVTDPMQQKIMTYMPVIFT 500

Query: 529 FALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
                FP+GL++Y+  SN+++I QQ +I +
Sbjct: 501 VFFLWFPSGLVLYYIVSNLVTIAQQQLIYR 530


>gi|311696590|gb|ADP99463.1| inner membrane protein translocase component YidC [marine bacterium
           HP15]
          Length = 571

 Score =  350 bits (896), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 144/597 (24%), Positives = 250/597 (41%), Gaps = 64/597 (10%)

Query: 1   MERNWNYFVA--IALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQ------------- 45
           M+       A    +S ++V AW   Y  P       E +  QT                
Sbjct: 1   MDIQRIVLFAGLAIVSYLMVLAWNEDYHQPPETAQVAESQPSQTAGNMGNSDNMVLPEDS 60

Query: 46  --------PNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGY 97
                         +  AV+             + ++       I+          L  Y
Sbjct: 61  SAQVDGDGEFTTPETGQAVISSTETTTAVSDQFITVRTDVYDLQIDRVSGNLVKARLLDY 120

Query: 98  HLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKIL-----TP 152
              ++S  P+  L +  N    Y  E   +         N +                  
Sbjct: 121 DDTLNSEKPLTLLNNTQN--RLYVLESGLIGRDGPDSRKNGSAPVYSADAASYELAEGDN 178

Query: 153 TTPIKLVFKNANNILFERTISLDEH-YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTAT 211
              + L + + N +   +    + + Y   +   V N S ++ + +  G+I+R +    T
Sbjct: 179 QLQVDLTYTSDNGVQITKRYEFERNSYEISVKYLVENQSSEEWQANFTGKIVRDQSPDPT 238

Query: 212 NTFGV----QEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSK 267
           +   +      G +    +    +  + D++++ I+    +N WL     Y+ S ++P +
Sbjct: 239 SQTSMGIQAFLGLVISSPEDPYEKFDFGDLQENQINQ-SVTNGWLAFLQHYFLSAWVPER 297

Query: 268 ETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAI 327
           +     Q          Y   F     ++ PG++       + G K    +         
Sbjct: 298 DIPAQYQTTRRGPN---YVMGFVYPATSVAPGETAEIGARAYVGPKIIERLEGMA----- 349

Query: 328 PRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTA 387
           P  +  +D+GW +FI+ P+F+++ +F++LVGN+G++I+L TV VK +FF L+   Y S A
Sbjct: 350 PNLDRTVDFGWLFFISLPLFIILDWFHSLVGNWGVSIILLTVLVKAVFFHLSATSYKSMA 409

Query: 388 NMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVI 447
            M+ + P++  L+E +     Q + + M+ LYK   INPL GC PIL+Q+PVF ++Y V+
Sbjct: 410 KMRAVAPQLTRLKELYGD-DRQRMSQEMMALYKREKINPLGGCLPILVQMPVFISLYWVL 468

Query: 448 SISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKM 507
             S+++RHAPF  WI+DL+  DP                     I PI+M  SMF+QM +
Sbjct: 469 FESVQLRHAPFMLWIQDLSVMDPYF-------------------ILPILMGASMFLQMSL 509

Query: 508 SPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEI 564
           +P P D  QA I+  MP++F      FPAGL++YW  +N++SI QQ  I +   AE+
Sbjct: 510 NPTPPDPMQAKIMKMMPLIFTVFFLWFPAGLVLYWLVNNILSIAQQWYITRKIEAEM 566


>gi|170718320|ref|YP_001785332.1| inner membrane protein translocase component YidC [Haemophilus
           somnus 2336]
 gi|254772997|sp|B0URU3|OXAA_HAES2 RecName: Full=Inner membrane protein oxaA
 gi|168826449|gb|ACA31820.1| 60 kDa inner membrane insertion protein [Haemophilus somnus 2336]
          Length = 541

 Score =  350 bits (896), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 147/570 (25%), Positives = 254/570 (44%), Gaps = 45/570 (7%)

Query: 2   ERNWNYFVAIAL---SVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
             +    + +AL   S +I   WQ  Y  P+ E     + +           +       
Sbjct: 1   MDSKRSLLFMALLFISFLIYQQWQVDYNTPKPEVTEQAQVSEVNSTALTATSDIA----- 55

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
                  +    + L+N      +N  G       L  Y  ++ S++P V L   +N   
Sbjct: 56  ---NDTQAKGRVITLENDVFRLKVNTLGGDVIGSELLNYDAELHSSAPFVLL--QNNADK 110

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISL 174
            Y A+   V   N I+       + +               + L+F+    I  +  +  
Sbjct: 111 VYIAQSGLVG-KNGIDSRAGRANYQVEGDVFKLAEGQQELKVPLIFEKDGVIYRKVFVLK 169

Query: 175 DEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKY 234
              Y  ++   +TN S   I   P  ++     +++ +         A    ++  ++  
Sbjct: 170 PGSYALEVNFEITNQSPKPIELVPYAQLTHTLVESSGSMAMPTYTGGAYSSSETNYKKYS 229

Query: 235 SDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
            +  + +  + H    W+ +   Y+ S +IP+++ +        +  H      + +  I
Sbjct: 230 FEDMEKADLDIHTKAGWVALLQHYFVSAWIPNQDANNTLYTLTNTKKH-LGSIGYRSAPI 288

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
            I  G + T    L+ G K    +            ++ +D+GW +FIAKP+F L++   
Sbjct: 289 VIENGATETIHTQLWTGPKLQDQMADVAN-----HLDLTVDYGWAWFIAKPLFKLLTLIQ 343

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
           +LV N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + 
Sbjct: 344 SLVQNWGLAIIGVTLVVKAVLYPLTKAQYTSMAKMRMLQPKLQEMRERF-GEDRQRMSQE 402

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           M++LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GW++DL+A DP    
Sbjct: 403 MMKLYKEEKVNPLGGCLPILLQMPIFIALYWTFMEAVELRHAPFFGWVQDLSAQDPYF-- 460

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSS 533
                            I PI+M  SMF+  KMSP P AD  Q  ++ +MP++F+     
Sbjct: 461 -----------------ILPILMGASMFLLQKMSPTPVADPMQQKVMTFMPLIFMVFFLF 503

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           FPAGL++YW  SN+I+I QQ +I +    +
Sbjct: 504 FPAGLVLYWLASNLITIAQQWLIYRGLEKK 533


>gi|304313414|ref|YP_003813012.1| Preprotein translocase subunit [gamma proteobacterium HdN1]
 gi|301799147|emb|CBL47390.1| Preprotein translocase subunit [gamma proteobacterium HdN1]
          Length = 568

 Score =  350 bits (896), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 137/590 (23%), Positives = 244/590 (41%), Gaps = 54/590 (9%)

Query: 1   MERNWNYFVAI--ALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYA---- 54
           M+      + +   +S  ++Y W   Y   +      +     +      +  S      
Sbjct: 1   MDWQRTLLIGLLAIVSYAMIYTWNQDYGSKQHAASETKLPQSYSQGDTPVITESPKGSED 60

Query: 55  ------------AVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVS 102
                         L+ D   A      + ++   L   I+  G     + L+ Y + + 
Sbjct: 61  LPSVTNSEKQSLPALVSDAQSAKKAGGLIRVETDVLSVEISTLGGDVVSVRLKAYPISIE 120

Query: 103 SNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKIL--TPTTPIKLVF 160
                +++L+    +  Y A+                  +     +         + L F
Sbjct: 121 DKGTPISILA-ETAQTTYVAQSGLAGINGPDSNAAGRPQYTTDQTEYELKGDHLVVPLHF 179

Query: 161 KNANNILFERTISL-DEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGV--- 216
            + N +   +T       Y+ K    V N S      +   +I R               
Sbjct: 180 VDENGVKVTKTFEFAKGSYVIKNRYDVHNTSSQPWTAAFFAQIKRDNSPDPGVQHTTGFG 239

Query: 217 ---QEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHS 273
                G      +K   ++K+  + K+ +     +  W+ I   Y+ + +IP +   +  
Sbjct: 240 LPTFLGVAYWSPEKPYNKEKFDALVKTPLDLKGVTGGWMAIIQHYFLAAWIPDQNQQYDY 299

Query: 274 QFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEML 333
               +        A+   + +T+ PG S      L+ G K   T+            +++
Sbjct: 300 STAAVKGNT---IARIVGHSVTVAPGASQDYQASLYVGPKIQKTLEALVPGKG---LDLV 353

Query: 334 IDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQ 393
           +D+G  +FI+K +F L+S F+ L  N+G++I+L TV +K LFF  +   Y S A M+ +Q
Sbjct: 354 VDYGPLFFISKILFWLLSTFHALTANWGVSIILLTVTIKALFFYPSAISYRSMAKMRTVQ 413

Query: 394 PKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEM 453
           P +  LRE++     Q L + M++LY+ + INPL GC PIL+Q+PVF A+Y  +  S+E+
Sbjct: 414 PALLRLREQYAD-DRQKLSQEMMKLYRDNKINPLGGCLPILIQMPVFLALYWALLESVEL 472

Query: 454 RHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPAD 513
           R APF+GW+ DL+  DP                     I P+IM  +M+IQ  ++P P D
Sbjct: 473 RQAPFFGWLTDLSVMDPYF-------------------ILPLIMGGTMYIQTALNPAPPD 513

Query: 514 KGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
             QA ++ +MP++F      FPAGL++YW  +N +SI+QQ +I +   AE
Sbjct: 514 PMQAKLMKFMPIIFTVMFLWFPAGLVVYWITNNSLSILQQWIITRKIEAE 563


>gi|326797441|ref|YP_004315261.1| membrane protein oxaA [Marinomonas mediterranea MMB-1]
 gi|326548205|gb|ADZ93425.1| Membrane protein oxaA [Marinomonas mediterranea MMB-1]
          Length = 553

 Score =  350 bits (896), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 146/583 (25%), Positives = 249/583 (42%), Gaps = 53/583 (9%)

Query: 1   MERNWNYFVAIALS---VIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDN------ 51
           M+    YF+  AL     ++   W   Y           +         N   +      
Sbjct: 1   MDF-RRYFLWGALFVSGYLLFLQWNQDYGPQSQTSQPVAQNQTTVNTATNAESDLPNSVS 59

Query: 52  ----SYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPI 107
                 +   +   A+AL+    +++K  +L  SI+  G      +L  Y   + ++ P 
Sbjct: 60  NTTLPASDTDVPANAKALASGQLIDVKTDTLDISIDPVGGDLVGASLLQYKKTLDASDPF 119

Query: 108 VTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTP---TTPIKLVFKNAN 164
           V L   +NT   Y ++   +            T     +  +L     T  + L F +  
Sbjct: 120 VIL--ENNTTRTYVSQSGLIGQDGIDNSKGRPTYHADKTQYVLADGENTLDVNLYFTDEK 177

Query: 165 NILFERTISL-DEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT----ATNTFGVQEG 219
            + + +T       Y  +   TV N S D  R     +I R   +      +       G
Sbjct: 178 GVEYTKTYRFTRGVYSVEQSITVNNTSADDWRGKQFAQIKRDSTEDPSTATSLGLQPYLG 237

Query: 220 FIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLS 279
                 +    +  +SD+ +   +    ++ W+ +   Y+ S +IP +  +   Q +  +
Sbjct: 238 GAISTDEVRYEKVSFSDM-EEKPAKITTNSGWIALLQHYFVSAWIPKQGETVTLQTRSNN 296

Query: 280 DGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWF 339
                    F+  E+ +  G+  T +   + G K    +     +      +  +D+G  
Sbjct: 297 G---INFIGFTGPEVEVPAGQKGTLSATFYVGPKLQDQLAATAAN-----LDKTVDYGML 348

Query: 340 YFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDEL 399
           +++A+P+F L++   ++V N+G+AI+L  V VK +FF L+   Y S A M+   P++  L
Sbjct: 349 WWLAEPLFWLLTAIQSVVINWGVAIILIVVCVKAVFFKLSAASYRSMAKMRKFGPELTRL 408

Query: 400 REKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFW 459
           RE++     Q + +AM+ LYK   INPL GC PIL+Q+PVF ++Y V+  S+E+RHAPF 
Sbjct: 409 REQYGD-DRQKMSQAMMTLYKKEKINPLGGCLPILVQMPVFLSLYWVLMESVELRHAPFM 467

Query: 460 GWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMI 519
            WI DL+  DP                     + PI+M LSM  Q  ++P P D  QA I
Sbjct: 468 LWINDLSYMDPYY-------------------VLPILMGLSMLGQQMLNPTPPDPMQARI 508

Query: 520 LNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           +  MP+ F F    FP+GL++YW  +N +SI+QQ VI K   A
Sbjct: 509 MKIMPIAFTFFFLWFPSGLVLYWVVNNTLSIIQQYVITKRIEA 551


>gi|226942148|ref|YP_002797222.1| inner membrane protein translocase component YidC [Laribacter
           hongkongensis HLHK9]
 gi|254772999|sp|C1D6H8|OXAA_LARHH RecName: Full=Inner membrane protein oxaA
 gi|226717075|gb|ACO76213.1| YidC [Laribacter hongkongensis HLHK9]
          Length = 550

 Score =  350 bits (896), Expect = 6e-94,   Method: Composition-based stats.
 Identities = 134/570 (23%), Positives = 234/570 (41%), Gaps = 45/570 (7%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
                  V I LS  +++ WQ ++      +             P     + +       
Sbjct: 1   MDTKRLIVFIVLSFGLLFVWQEYFAPKPQPKPVAAAVQPDGTPAPATARPADSPATGK-- 58

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
              L+ +  + +    +   IN  G     L L       + + P   +L        Y 
Sbjct: 59  ---LTSAQTITVTTDLVKAQINTAGGDIRSLELLTQGAIDNPDKPF--MLMTEQGGRTYV 113

Query: 122 AELDYVSTANNIELPNSNTVWNLISGKILTPTTP--IKLVFKNANNILFERTISLD-EHY 178
           A+   +S+  ++    +    +  +  +L       + L     N +  ++  +   + Y
Sbjct: 114 AQSGLLSSDASLPTHKTLYAADKTAYTLLPDQNTLTVTLAAAPVNGVEVKKIFTFKRDSY 173

Query: 179 LFKIVDTVTNNSIDQIRFSPRGRIMRHK--PQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
           +  +   + N+S   +  +   R++R    P+  ++      G           +  + D
Sbjct: 174 VIDVRYDIINHSDKPVDATAYYRLLRDGKAPEGESSMAHTFTGPAVYTETGKFQKVSFED 233

Query: 237 IEKSSISNFHE-SNSWLGISDKYWASVFIPSKETSFHS-------QFKYLSDGHARYQAK 288
           + K       +  N W+ +   Y+ S +I                QF+        Y A 
Sbjct: 234 LAKGKGDYVRQADNGWVAMVQHYFVSAWILKTNDGKSVCSSAEACQFELKPAAGDLYSAG 293

Query: 289 FSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFM 348
                  +  G+  +    L+AG ++   +         P   +  D+GW   IA P+F 
Sbjct: 294 VLVKLPVVAAGQQYSIDMPLYAGPEDTRRMATVA-----PGLVLTKDYGWVTIIATPLFW 348

Query: 349 LMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPP 408
           L+   Y LV N+G AI+L TV VK  F+PL+   Y S A MK + P++  L+E++     
Sbjct: 349 LLDKLYGLVHNWGWAIVLLTVLVKAAFYPLSAASYRSMAKMKALAPRMQRLKEQYGD-DR 407

Query: 409 QVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAA 468
           Q  Q+A +++YKT  +NPL GC PI++QIPVF  +Y  +  S+E+R AP+  WI DLA  
Sbjct: 408 QKFQQATMEMYKTEKVNPLGGCLPIVVQIPVFIGLYWALLASVELRQAPWILWIHDLAKP 467

Query: 469 DPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFV 528
           DP                     I P +M+ +M++Q  ++PPPAD  QA ++  MP+ F 
Sbjct: 468 DPYY-------------------ILPALMAATMYLQTFLNPPPADPLQAKMMKIMPLAFS 508

Query: 529 FALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
                FPAGL++YW  +N++SI QQ  + K
Sbjct: 509 VMFFFFPAGLVLYWLVNNILSIAQQWWVNK 538


>gi|15603030|ref|NP_246102.1| putative inner membrane protein translocase component YidC
           [Pasteurella multocida subsp. multocida str. Pm70]
 gi|38503177|sp|Q9CLQ2|OXAA_PASMU RecName: Full=Inner membrane protein oxaA
 gi|12721513|gb|AAK03249.1| YidC [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 541

 Score =  349 bits (895), Expect = 7e-94,   Method: Composition-based stats.
 Identities = 147/571 (25%), Positives = 255/571 (44%), Gaps = 45/571 (7%)

Query: 1   MERNWNY--FVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           M+   +      + +S ++   WQ  Y  P+       + +           +  A    
Sbjct: 1   MDSRRSLLVIALLFISFLVYQQWQLDYHTPKPVATEQVKVSSDVPASSASSSSDIATT-- 58

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
                A +    + L+N      ++  G       L  Y  +++SN+P   L + +N  +
Sbjct: 59  -----AQAQGRIITLENDVFRLEVDTLGGDVVHSELLKYDAELNSNTPFTLLTNKAN--H 111

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKL---VFKNANNILFERTISLD 175
            Y A+   V     I+       + +            +L        + + F +   L 
Sbjct: 112 VYIAQSGLVGKDG-IDTKAGRANYQVDGDTFKLADGQNELAVPFVFEKDGVTFRKIFVLK 170

Query: 176 -EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNT-FGVQEGFIAVLGDKSLVEQK 233
              Y   +   + N S   I   P G++     +   N       G      + +  +  
Sbjct: 171 RGAYDIAVNFEIDNQSDKTIEVEPYGQLRHTLVEDTGNVAMPTYTGGAYSSSETNYKKYS 230

Query: 234 YSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANE 293
           ++D+EK+++S       W+ +   Y+ S +IP+++      +      +      +    
Sbjct: 231 FADMEKANLS-ISTKAGWVAVLQHYFVSAWIPNQDADNQL-YSLTDKANNLASIGYRGPV 288

Query: 294 ITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYF 353
             I  G   T  + L+ G K    +            ++ +D+GW +FIAKP+F L+++ 
Sbjct: 289 TAIPAGAKETIRSSLWTGPKLQDQMATVAN-----HLDLSVDYGWAWFIAKPLFWLLTFI 343

Query: 354 YNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQK 413
            ++V N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + +
Sbjct: 344 QSIVQNWGLAIIGVTLVVKAILYPLTKAQYTSMAKMRMLQPKLQEMRERF-GEDRQRMSQ 402

Query: 414 AMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNI 473
            M++LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A DP   
Sbjct: 403 EMMKLYKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQDPYY- 461

Query: 474 FTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALS 532
                             I PI+M  SMF+  KMSP P AD  Q  I+N+MP++F+    
Sbjct: 462 ------------------ILPILMGASMFLLQKMSPTPVADPTQQKIMNFMPLIFMVFFL 503

Query: 533 SFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
            FP+GL++YW  SN+I+I QQ +I +    +
Sbjct: 504 WFPSGLVLYWLVSNLITIAQQQLIYRGLEKK 534


>gi|74318843|ref|YP_316583.1| protein translocase subunit yidC [Thiobacillus denitrificans ATCC
           25259]
 gi|123611090|sp|Q3SF38|OXAA_THIDA RecName: Full=Inner membrane protein oxaA
 gi|74058338|gb|AAZ98778.1| preprotein translocase subunit YidC [Thiobacillus denitrificans
           ATCC 25259]
          Length = 546

 Score =  349 bits (894), Expect = 8e-94,   Method: Composition-based stats.
 Identities = 145/563 (25%), Positives = 236/563 (41%), Gaps = 35/563 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+      + I  S  ++  W+ +                           +  A     
Sbjct: 1   MDNQR-LILFIVFSFSLLLLWEAWQDKQAPAPATRPVAGAPAGSAAPTPSTALNAPAAAP 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
                +   R  ++   L  +I+  G    +L L GY      N   V  L   +    Y
Sbjct: 60  AQTGFAKGARAVVETDVLRATIDANGGDLRELQLLGYRETEDKN--RVFTLFEDSRTRPY 117

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNA--NNILFERTISLDEHY 178
            A+  +V                            + LV+ +A     + +  I     +
Sbjct: 118 LAQSGFVGGGLPTHRSTFELTPGTYRLTGGAARLEVPLVWNDAARGVRVEKTFIFTRGSH 177

Query: 179 LFKIVDTVTNNSIDQIRFSPRGRIMRHK--PQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
              +   V N   + +  +P  +  RH   P+  +       G       K   +  ++D
Sbjct: 178 EVAVRTRVVNRGKEPLDLTPYYQFTRHGEAPRGESFFLYTYTGPAFYTDAKKFQKVPFTD 237

Query: 237 IEKSSISNFHE-SNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
           I+  S       +N W+G+   ++ + ++P +        + L +G   Y A     E  
Sbjct: 238 IQDGSAEFEKTATNGWVGLVQHHFVAAWLPEESVKREYYARSLGEG--LYSAGVILAEGQ 295

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           + PG+  T T  L+AG +    +     + A P  ++  D+GW   +A P+F  +     
Sbjct: 296 LAPGQQKTFTVPLYAGPQSQAVL-----EKAAPGLDLARDYGWLTPLAYPIFWSLEKIER 350

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
           LVGN+G AI++ T+ +KL  +PL+   Y S A MK + P++ +L+E +     + L +AM
Sbjct: 351 LVGNWGWAIIILTILIKLALYPLSAAGYKSMAKMKKLTPRLQQLKETYGDDRAK-LHQAM 409

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
            ++YKT  INPL GC PIL+QIPVF A+Y V+  ++EMR AP+ GWI DL A DP     
Sbjct: 410 AEMYKTEKINPLGGCLPILIQIPVFIALYWVLLAAVEMRGAPWLGWITDLTAPDPWY--- 466

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFP 535
                           I PIIM ++  +Q+K++P P D  QA I+  MPV F      FP
Sbjct: 467 ----------------ILPIIMGVTSILQVKLNPQPMDPMQAKIMMIMPVAFTVMFVFFP 510

Query: 536 AGLIIYWSWSNVISIVQQAVIMK 558
           AGL++YW  +N++SI QQ  I K
Sbjct: 511 AGLVLYWVVNNILSIAQQWAINK 533


>gi|268593484|ref|ZP_06127705.1| membrane protein insertase, YidC/Oxa1 family [Providencia rettgeri
           DSM 1131]
 gi|291310905|gb|EFE51358.1| membrane protein insertase, YidC/Oxa1 family [Providencia rettgeri
           DSM 1131]
          Length = 549

 Score =  349 bits (894), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 143/572 (25%), Positives = 260/572 (45%), Gaps = 53/572 (9%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL  +    WQ +      +++  + K +QT +Q +   +   AV    
Sbjct: 1   MDSQRNLLL-IALLFVSFLVWQAW----ESDKVAQDVKTVQTSQQADMPSSDAQAVTG-- 53

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLL-SPSNTKNA 119
                     + +K   L   IN +G   D+ +L  Y   + S SP   L  +P     A
Sbjct: 54  ----SGQGKLITVKTDVLDIRINTRGGDIDEADLLAYPATLHSESPFRLLETNPGFVYQA 109

Query: 120 YFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKN-----ANNILFERTISL 174
               +      N         +++  S           L            +  +  I  
Sbjct: 110 QSGLIGLHGPDNPANNNGERPLYSADSTTFTLEKGQDVLRVPMTFTDNNGVVYQKTYIVK 169

Query: 175 DEHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-----KPQTATNTFGVQEGFIAVL--GDK 227
              Y  ++  ++ N +   +  +  G++ +      +  T ++ F +     A     + 
Sbjct: 170 RGQYTVEVEYSIQNPTAQPLSLAFFGQLKQTIELPKERDTGSSNFALHTYRGAAYSSDEN 229

Query: 228 SLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA 287
           +  +  + DIE  ++        W+ +  +Y+A+ +IP+      S F  +         
Sbjct: 230 NYKKYSFGDIEDKNLDLT-TKGGWVAMLQQYFATAWIPASAE--KSTFYTIDLDKKSAII 286

Query: 288 KFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMF 347
            + +  +TI    + T ++ L+ G +    +         P  ++ +D+GW +FI++P+F
Sbjct: 287 GYKSEPMTIAANGAGTYSSTLWVGPEIQSEMAAVA-----PHLDLTVDYGWLWFISQPLF 341

Query: 348 MLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSP 407
            L+ + +  VGN+GIAI++ T  V+ + +PL K QY S A M+ +QPK+  +RE+     
Sbjct: 342 KLLKFIHGFVGNWGIAIIVITFIVRGIMYPLTKAQYTSMAKMRLLQPKLAAMRERIGDDK 401

Query: 408 PQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAA 467
            Q + + M+ +YK   +NPL GC P+L+Q+P+F A+Y ++  S+E+RHAPF+GWI+DL+A
Sbjct: 402 -QRMSQEMMAMYKAEKVNPLGGCLPLLIQMPIFLALYYMLMGSVELRHAPFFGWIQDLSA 460

Query: 468 ADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVV 526
            DP                     I P++M ++MF+  KMSP    D  Q  I+ +MPVV
Sbjct: 461 QDPYY-------------------ILPVLMGVTMFVIQKMSPTAVTDPMQQKIMTYMPVV 501

Query: 527 FVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           F      FP+GL++Y+  SN+++I+QQ VI +
Sbjct: 502 FTIFFLWFPSGLVLYYIVSNLVTIIQQQVIYR 533


>gi|237801668|ref|ZP_04590129.1| membrane protein insertase [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331024527|gb|EGI04583.1| membrane protein insertase [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 562

 Score =  349 bits (894), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 143/585 (24%), Positives = 237/585 (40%), Gaps = 53/585 (9%)

Query: 1   MERNWNYFVAIALSVIIVYA---WQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           M+      + +AL+++       W   Y    +   N                 + +A  
Sbjct: 1   MDI-KRTILIVALAIVTYVGVLKWNQDYGQAAMPTQNVAASTPAPGIPDTAAGTNGSASA 59

Query: 58  IDDR------------AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNS 105
                             A++    + +K   L  +I+  G     L L  Y        
Sbjct: 60  DVPSATANTTAAAPLETPAVASKDLIHVKTDVLDLAIDPVGGDVVQLRLPLYPRRQDRPD 119

Query: 106 PIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFK 161
               L   +  +  + A+     T           V++             +  ++L F 
Sbjct: 120 VPFQLF-DNGGERTFLAQSGLTGTNGPDARAAGRPVYSSAQKTYQLADGQDSMVVELKFS 178

Query: 162 NANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT----ATNTFGVQ 217
                  +R       Y   +   V N S      +   ++ R                 
Sbjct: 179 ENGVNYIKRFTFKRGLYDLVMTYVVDNQSAQPWAGNLFAQLKRDASSDPSSTTATGTATY 238

Query: 218 EGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKY 277
            G       +   +    DI+K  I        W+     Y+ + +IP    +   Q + 
Sbjct: 239 LGAALWTAAEPYKKVSMKDIDKGQIKET-VQGGWVAWLQHYFVTAWIPDHNATNSVQTR- 296

Query: 278 LSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWG 337
             D    Y   F++  +T+ PG    T+  L+AG K    +         P  E+ +D+G
Sbjct: 297 -KDSQGNYIIGFTSPTLTVAPGAQGETSATLYAGPKSQAVLKELS-----PGLELTVDYG 350

Query: 338 WFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKID 397
           + +FIA+P+F L+ + + ++GN+G +I++ T+ +K LFFPL+   Y S A M+ + PK+ 
Sbjct: 351 FLWFIAQPIFWLLQHIHAILGNWGWSIIVLTMLIKGLFFPLSAASYKSMARMRAVAPKLA 410

Query: 398 ELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAP 457
            L+E+      Q + +AM++LYK   INPL GC PIL+Q+PVF ++Y V+  S+EMR AP
Sbjct: 411 VLKEQHGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLSLYWVLLESVEMRQAP 469

Query: 458 FWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQA 517
           +  WI DL+  DP                     I PIIM  +MFIQ +++P P D  QA
Sbjct: 470 WILWITDLSIKDPFF-------------------ILPIIMGATMFIQQRLNPTPPDPMQA 510

Query: 518 MILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
            ++  MP++F F    FPAGL++YW  +N +SI QQA I +   A
Sbjct: 511 KVMKLMPIIFTFFFLWFPAGLVLYWVVNNTLSIAQQAYITRKIEA 555


>gi|289677544|ref|ZP_06498434.1| putative inner membrane protein translocase component YidC
           [Pseudomonas syringae pv. syringae FF5]
 gi|302185836|ref|ZP_07262509.1| putative inner membrane protein translocase component YidC
           [Pseudomonas syringae pv. syringae 642]
 gi|330898611|gb|EGH30030.1| membrane protein insertase [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330937304|gb|EGH41312.1| membrane protein insertase [Pseudomonas syringae pv. pisi str.
           1704B]
 gi|330976398|gb|EGH76455.1| membrane protein insertase [Pseudomonas syringae pv. aptata str.
           DSM 50252]
          Length = 563

 Score =  349 bits (894), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 141/586 (24%), Positives = 233/586 (39%), Gaps = 54/586 (9%)

Query: 1   MERNWNYFVAIALSVIIVYA---WQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           M+      + +AL+++       W   Y    +   N                 + +A  
Sbjct: 1   MDI-KRTILIVALAIVTYVGVLKWNQDYGQAAMPTQNVAASTTAPGIPDTAAGTNGSASA 59

Query: 58  IDDR-------------AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
                              A++    + +K   L  +I+  G     L L  Y       
Sbjct: 60  DVPSANATANTAAAPLETPAVASKDLIHVKTDVLDLAIDPVGGDVVQLRLPLYPRRQDRP 119

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIK----LVF 160
                L   +  +  + A+     T           V+                   L F
Sbjct: 120 DVPFQLF-DNGGERTFLAQSGLTGTNGPDARAAGRPVYTSTQKTYQLADGQDTMVVDLKF 178

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT----ATNTFGV 216
                   +R       Y   +   V N S      +   ++ R                
Sbjct: 179 SENGVNYIKRFTFKRGLYDLVMTYVVDNQSAQPWSGNLFAQLKRDASSDPSSTTATGTAT 238

Query: 217 QEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFK 276
             G       +   +    DI+K  +        W+     Y+ + +IP    +   Q +
Sbjct: 239 YLGAALWTAAEPYKKVSMKDIDKGQVKET-VQGGWVAWLQHYFVTAWIPDHNATNAVQTR 297

Query: 277 YLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDW 336
              D    Y   F++  +++ PG    T+  L+AG K    +         P  E+ +D+
Sbjct: 298 --KDSQGNYIIGFTSPTLSVAPGAQGETSATLYAGPKSQAVLKELS-----PGLELTVDY 350

Query: 337 GWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKI 396
           G+ +FIA+P+F L+ + + ++GN+G +I++ T+ +K LFFPL+   Y S A M+ + PK+
Sbjct: 351 GFLWFIAQPIFWLLQHIHAILGNWGWSIIVLTMLIKGLFFPLSAASYKSMARMRAVAPKL 410

Query: 397 DELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHA 456
             L+E+      Q + +AM++LYK   INPL GC PIL+Q+PVF ++Y V+  S+EMR A
Sbjct: 411 ALLKEQHGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLSLYWVLLESVEMRQA 469

Query: 457 PFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQ 516
           P+  WI DL+  DP                     I PIIM  +MFIQ +++P P D  Q
Sbjct: 470 PWILWITDLSIKDPFF-------------------ILPIIMGATMFIQQRLNPTPPDPMQ 510

Query: 517 AMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           A ++  MP++F F    FPAGL++YW  +N +SI QQA I +   A
Sbjct: 511 AKVMKMMPIIFTFFFLWFPAGLVLYWVVNNTLSIAQQAYITRKIEA 556


>gi|113460279|ref|YP_718337.1| putative inner membrane protein translocase component YidC
           [Haemophilus somnus 129PT]
 gi|123131891|sp|Q0I0Z1|OXAA_HAES1 RecName: Full=Inner membrane protein oxaA
 gi|112822322|gb|ABI24411.1| protein translocase subunit yidC [Haemophilus somnus 129PT]
          Length = 541

 Score =  349 bits (894), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 147/570 (25%), Positives = 253/570 (44%), Gaps = 45/570 (7%)

Query: 2   ERNWNYFVAIAL---SVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
             +    + +AL   S +I   WQ  Y  P+ E     + +           +       
Sbjct: 1   MDSKRSLLFMALLFISFLIYQQWQVDYNTPKPEMTEQAQVSEVNSTALTATSDIA----- 55

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
                  +    + L+N      +N  G       L  Y  ++ S++P V L   +N   
Sbjct: 56  ---NDTQAKGRVITLENDVFRLKVNTLGGDVIGSELLNYDAELHSSAPFVLL--QNNADK 110

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLV----FKNANNILFERTISL 174
            Y A+   V   N I+       + +            +L     F+    I  +  +  
Sbjct: 111 VYIAQSGLVG-KNGIDSRAGRANYQVEGDVFKLAEGQQELKVPLVFEKDGVIYRKVFVLK 169

Query: 175 DEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKY 234
              Y  ++   +TN S   I   P  ++     +++ +         A    ++  ++  
Sbjct: 170 PGSYALEVNFEITNQSPKPIEVVPYAQLTHTLVESSGSMAMPTYTGGAYSSSETNYKKYS 229

Query: 235 SDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
            +  + +  + H    W+ +   Y+ S +IP+++ +        +  H      + +  I
Sbjct: 230 FEDMEKADLDIHTKAGWVALLQHYFVSAWIPNQDANNTLYTLTNTKKH-LGSIGYRSAPI 288

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
            I  G + T    L+ G K    +            ++ +D+GW +FIAKP+F L++   
Sbjct: 289 VIENGATETIHTQLWTGPKLQDQMADVAN-----HLDLTVDYGWAWFIAKPLFKLLTLIQ 343

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
           +LV N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + 
Sbjct: 344 SLVQNWGLAIIGVTLVVKAILYPLTKAQYTSMAKMRMLQPKLQEMRERF-GEDRQRMSQE 402

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           M++LYK   +NPL GC PILLQ+P+F A+Y     ++E+RHAPF+GW++DL+A DP    
Sbjct: 403 MMKLYKEEKVNPLGGCLPILLQMPIFIALYWTFMEAVELRHAPFFGWVQDLSAQDPYF-- 460

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSS 533
                            I PI+M  SMF+  KMSP P AD  Q  ++ +MP++F+     
Sbjct: 461 -----------------ILPILMGASMFLLQKMSPTPVADPMQQKVMTFMPLIFMVFFLF 503

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           FPAGL++YW  SN+I+I QQ +I +    +
Sbjct: 504 FPAGLVLYWLASNLITIAQQWLIYRGLEKK 533


>gi|66048358|ref|YP_238199.1| putative inner membrane protein translocase component YidC
           [Pseudomonas syringae pv. syringae B728a]
 gi|81307749|sp|Q4ZL11|OXAA_PSEU2 RecName: Full=Inner membrane protein oxaA
 gi|63259065|gb|AAY40161.1| 60 kDa inner membrane protein [Pseudomonas syringae pv. syringae
           B728a]
 gi|330970321|gb|EGH70387.1| membrane protein insertase [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 563

 Score =  349 bits (894), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 141/586 (24%), Positives = 233/586 (39%), Gaps = 54/586 (9%)

Query: 1   MERNWNYFVAIALSVIIVYA---WQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           M+      + +AL+++       W   Y    +   N                 + +A  
Sbjct: 1   MDI-KRTILIVALAIVTYVGVLKWNQDYGQAAMPTQNVAASTTAPGIPDTAAGTNGSASA 59

Query: 58  IDDR-------------AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
                              A++    + +K   L  +I+  G     L L  Y       
Sbjct: 60  DVPSANATANTAAAPLETPAVASKDLIHVKTDVLDLAIDPVGGDVVQLRLPLYPRRQDRP 119

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIK----LVF 160
                L   +  +  + A+     T           V+                   L F
Sbjct: 120 DVPFQLF-DNGGERTFLAQSGLTGTNGPDARAAGRPVYTSTQKTYQLADGQDTMVVDLKF 178

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT----ATNTFGV 216
                   +R       Y   +   V N S      +   ++ R                
Sbjct: 179 SENGVNYIKRFTFKRGLYDLVMTYVVDNQSAQPWSGNLFAQLKRDASSDPSSTTATGTAT 238

Query: 217 QEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFK 276
             G       +   +    DI+K  +        W+     Y+ + +IP    +   Q +
Sbjct: 239 YLGAALWTAAEPYKKVSMKDIDKGQVKET-VQGGWVAWLQHYFVTAWIPDHNATNAVQTR 297

Query: 277 YLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDW 336
              D    Y   F++  +++ PG    T+  L+AG K    +         P  E+ +D+
Sbjct: 298 --KDSQGNYIIGFTSPTLSVAPGAQGETSATLYAGPKSQAVLKELS-----PGLELTVDY 350

Query: 337 GWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKI 396
           G+ +FIA+P+F L+ + + ++GN+G +I++ T+ +K LFFPL+   Y S A M+ + PK+
Sbjct: 351 GFLWFIAQPIFWLLQHIHAILGNWGWSIIVLTMLIKGLFFPLSAASYKSMARMRAVAPKL 410

Query: 397 DELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHA 456
             L+E+      Q + +AM++LYK   INPL GC PIL+Q+PVF ++Y V+  S+EMR A
Sbjct: 411 ALLKEQHGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLSLYWVLLESVEMRQA 469

Query: 457 PFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQ 516
           P+  WI DL+  DP                     I PIIM  +MFIQ +++P P D  Q
Sbjct: 470 PWILWITDLSIKDPFF-------------------ILPIIMGATMFIQQRLNPTPPDPMQ 510

Query: 517 AMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           A ++  MP++F F    FPAGL++YW  +N +SI QQA I +   A
Sbjct: 511 AKVMKMMPIIFTFFFLWFPAGLVLYWVVNNTLSIAQQAYITRKIEA 556


>gi|289628218|ref|ZP_06461172.1| putative inner membrane protein translocase component YidC
           [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|289649108|ref|ZP_06480451.1| putative inner membrane protein translocase component YidC
           [Pseudomonas syringae pv. aesculi str. 2250]
 gi|298484605|ref|ZP_07002710.1| integral membrane protein [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|298160862|gb|EFI01878.1| integral membrane protein [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|330870071|gb|EGH04780.1| membrane protein insertase [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 563

 Score =  348 bits (893), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 141/586 (24%), Positives = 233/586 (39%), Gaps = 54/586 (9%)

Query: 1   MERNWNYFVAIALSVIIVYA---WQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           M+      + +AL+++       W   Y    +   N                 + +A  
Sbjct: 1   MDI-KRTILIVALAIVTYVGVLKWNQDYGQAAMPTQNVAASTTAPGIPDTAAGTNGSASA 59

Query: 58  IDD-------------RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
                              A++    + +K   L  +I+  G     L L  Y       
Sbjct: 60  DVPSASATANTAAAPLETPAVASKDLIHVKTDVLDLAIDPVGGDVVQLRLPLYPRRQDRP 119

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIK----LVF 160
                L   +  +  + A+     T           V+                   L F
Sbjct: 120 DVPFQLF-DNGGERTFLAQSGLTGTNGPDARAAGRPVYTSTQKTYQLADGQDTMVVDLKF 178

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT----ATNTFGV 216
                   +R       Y   +   V N S      +   ++ R                
Sbjct: 179 SENGVNYIKRFTFKRGLYDLVMTYVVDNQSAQPWAGNLFAQLKRDASSDPSSTTATGTAT 238

Query: 217 QEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFK 276
             G       +   +    DI+K  +        W+     Y+ + +IP    +   Q +
Sbjct: 239 YLGAALWTAAEPYKKVSMKDIDKGQVKET-VQGGWVAWLQHYFVTAWIPDHNATNAVQTR 297

Query: 277 YLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDW 336
              D    Y   F++  +++ PG    T+  L+AG K    +         P  E+ +D+
Sbjct: 298 --KDSQGNYIIGFTSPTLSVAPGAQGETSATLYAGPKSQAVLKELS-----PGLELTVDY 350

Query: 337 GWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKI 396
           G+ +FIA+P+F L+ + + ++GN+G +I++ T+ +K LFFPL+   Y S A M+ + PK+
Sbjct: 351 GFLWFIAQPIFWLLQHIHAILGNWGWSIIVLTMLIKGLFFPLSAASYKSMARMRAVAPKL 410

Query: 397 DELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHA 456
             L+E+      Q + +AM++LYK   INPL GC PIL+Q+PVF ++Y V+  S+EMR A
Sbjct: 411 ALLKEQHGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLSLYWVLLESVEMRQA 469

Query: 457 PFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQ 516
           P+  WI DL+  DP                     I PIIM  +MFIQ +++P P D  Q
Sbjct: 470 PWILWITDLSIKDPFF-------------------ILPIIMGATMFIQQRLNPTPPDPMQ 510

Query: 517 AMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           A ++  MP++F F    FPAGL++YW  +N +SI QQA I +   A
Sbjct: 511 AKVMKMMPIIFTFFFLWFPAGLVLYWVVNNTLSIAQQAYITRKIEA 556


>gi|319945014|ref|ZP_08019276.1| YidC/Oxa1 family membrane protein insertase [Lautropia mirabilis
           ATCC 51599]
 gi|319741584|gb|EFV94009.1| YidC/Oxa1 family membrane protein insertase [Lautropia mirabilis
           ATCC 51599]
          Length = 561

 Score =  348 bits (893), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 153/586 (26%), Positives = 262/586 (44%), Gaps = 53/586 (9%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEE-----------------MNNERKNIQTV 43
           M+++    + +   + +++ W N+  Y                         +  +    
Sbjct: 1   MQQSHKTVLWVVFILSLLFLWNNWQQYNGQPAMFGGSQQAQTAQQNTASAPQDGADTSIP 60

Query: 44  KQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGY-HLDVS 102
             P+Q  N   A +  D+A+       + LKN  +   I+  G Q     L  + H   +
Sbjct: 61  GAPSQAGNDAPASVPADQAEQAKAGQTITLKNDVIELGIDTVGGQIVSSKLLKHIHDTRN 120

Query: 103 SNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKN 162
            +S  + + S           +         + PN  T   ++            ++   
Sbjct: 121 PDSGNLVIQSDRKGSF----FVGQTGLVGVKDAPNHTTPMTVVRTIETDGQVTGVVLAAE 176

Query: 163 ANNILFERTISL-DEHYLFKIVDTVTNNSIDQIRFSPRGRIMR--HKPQTATNTFGVQEG 219
              +  ERT  L    Y  K+ + VTN     +  S   ++ R  H+    +  +    G
Sbjct: 177 GGGLRIERTYQLSPGSYEIKVDNRVTNIGEQPLSPSLYLQLTRDTHEAPGQSGYYKTYVG 236

Query: 220 FIAVLGDKSLVEQKYSDIEKSSISNF-HESNSWLGISDKYWASVFIPSKETSFHSQFKYL 278
                      +  + DIEK    +    ++ W+GI   Y+ S ++P +        + +
Sbjct: 237 PAIYTDADKFQKVSFDDIEKGKAKHSGRANDGWVGIIQHYFVSAWVPKQGQPREYYTRRV 296

Query: 279 SDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGW 338
             G + Y A        I  G+S+  +  LF G ++   +         P  ++++D+GW
Sbjct: 297 --GPSTYSAGAYEQLGQISAGQSVDASETLFIGPQDQDVLAKVA-----PGLDLVVDYGW 349

Query: 339 FYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDE 398
              IAKP+F L+++ + +VGN+G AI+  T+ VKL FFPL    Y S A M+ +QP+++ 
Sbjct: 350 LTAIAKPLFWLLTFLHGIVGNWGWAIVALTILVKLAFFPLQAASYRSMAKMRKVQPRLNA 409

Query: 399 LREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF 458
           +RE++       L +AM++LYKT  INPL GC PIL+QIPVF A+Y V+  S+E+R+AP+
Sbjct: 410 IRERYGD-DRMNLNQAMMELYKTEKINPLGGCLPILVQIPVFIALYWVLLASVEIRNAPW 468

Query: 459 WGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAM 518
            GWI DL++ DP                     I PI+M+ +MF+Q  ++P PAD  QA 
Sbjct: 469 IGWIHDLSSPDPLY-------------------ILPILMAGTMFLQTHLNPKPADPVQAK 509

Query: 519 ILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEI 564
           ++ +MP++F      FP+GL++YW  SN+ SI QQ VI +    + 
Sbjct: 510 MMTFMPLIFSVMFFFFPSGLVLYWVVSNIFSIAQQWVITRQIEGKP 555


>gi|258541762|ref|YP_003187195.1| translocase inner membrane component YidC [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256632840|dbj|BAH98815.1| translocase inner membrane component YidC [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256635897|dbj|BAI01866.1| translocase inner membrane component YidC [Acetobacter pasteurianus
           IFO 3283-03]
 gi|256638952|dbj|BAI04914.1| translocase inner membrane component YidC [Acetobacter pasteurianus
           IFO 3283-07]
 gi|256642006|dbj|BAI07961.1| translocase inner membrane component YidC [Acetobacter pasteurianus
           IFO 3283-22]
 gi|256645061|dbj|BAI11009.1| translocase inner membrane component YidC [Acetobacter pasteurianus
           IFO 3283-26]
 gi|256648116|dbj|BAI14057.1| translocase inner membrane component YidC [Acetobacter pasteurianus
           IFO 3283-32]
 gi|256651169|dbj|BAI17103.1| translocase inner membrane component YidC [Acetobacter pasteurianus
           IFO 3283-01-42C]
 gi|256654160|dbj|BAI20087.1| translocase inner membrane component YidC [Acetobacter pasteurianus
           IFO 3283-12]
          Length = 583

 Score =  348 bits (893), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 171/581 (29%), Positives = 298/581 (51%), Gaps = 18/581 (3%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
                  +A ALS +++  +   +   +         +      P     +  A      
Sbjct: 1   MDPKRLILATALSALVLIGYDYLFPQHQPVPPPQPGVHAVAPPAPASSGAAAPAENTQAE 60

Query: 62  AQAL---SMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
           A A        RV +  P++ G++NL+GA+ DDL L+ Y   V  +SP V +L+ ++T  
Sbjct: 61  AAAPVKDGPETRVAINAPAVQGTLNLRGARLDDLVLKHYRETVKPDSPDVRVLNSASTHA 120

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHY 178
            Y        +  ++ LP++NT+W   SG  +    P+ L + N   + F+  +S+D++Y
Sbjct: 121 DYVDFGWRAPSDVSVRLPDANTLWK-ASGTQMDAEHPLTLSWDNGQGLTFDIRMSVDQNY 179

Query: 179 LFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFI----AVLGDKSLVEQKY 234
           +F I   V N++   +   P  R+ R      T    V EG I      L + S    + 
Sbjct: 180 MFTISQQVHNSTGQAVALYPFYRVNRGYTPEGTGGMLVHEGPISVIDGRLNEGSYKTVRT 239

Query: 235 SDIEKSSISNFHE-SNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANE 293
             +   +I+  H+ +  W GI+DKYW    +P +  +    + + +   A      +   
Sbjct: 240 GGVPPDNIAWSHQGTGGWAGITDKYWLMAVLPDQNANVIGTYGFQAAQGAYQVGFTATAP 299

Query: 294 ITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYF 353
           + +  G++ +T   +FAGAKE   +  YEKDL +P F   +D+GW  F+ +P+F ++ + 
Sbjct: 300 VQVAAGQTASTEAHVFAGAKEVRLLEQYEKDLHVPMFWKAVDFGWLSFLTRPVFFVLDWL 359

Query: 354 YNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQK 413
              +G+FG+A++  TV VK+ F PL  KQ   T     ++P++D +R + K   P  +Q+
Sbjct: 360 NEHLGSFGLALLTFTVIVKVAFLPLTIKQMRMTWKTARLKPQVDLIRSRLKD-DPMAMQQ 418

Query: 414 AMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNI 473
            ++ LY+  N+N   G  P+L+Q PVF+ +YK + +++EMRHAPF GW+KDL+A DPTN+
Sbjct: 419 QIMALYRQENVNLFGGFLPLLIQAPVFWCLYKDLYVTIEMRHAPFVGWVKDLSAPDPTNL 478

Query: 474 FTLFGILPFYL---PGFMHVGIWPIIMSLSMFIQMKM--SPPPADKGQAMILNWMPVVFV 528
           F LFG++PF       F+ +G WPI+   ++F+  K+  S    D  Q  ++ ++P++F 
Sbjct: 479 FNLFGLVPFDPTHITPFLALGAWPIMYGATLFLMQKVSSSSANMDPSQQKVMMFIPLLFT 538

Query: 529 FALSSFPAGLIIYWSWSNVISIVQQAVIMKMHG---AEIGL 566
           F ++  P GL+IY+ WSN+++ VQQ +I+       A+  L
Sbjct: 539 FFMARQPVGLVIYYCWSNILTAVQQVIIISRLKAADAKPQL 579


>gi|330952338|gb|EGH52598.1| membrane protein insertase [Pseudomonas syringae Cit 7]
          Length = 563

 Score =  348 bits (893), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 141/586 (24%), Positives = 234/586 (39%), Gaps = 54/586 (9%)

Query: 1   MERNWNYFVAIALSVIIVYA---WQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           M+      + +AL+++       W   Y    +   N    +            + +A  
Sbjct: 1   MDI-KRTILIVALAIVTYVGVLKWNQDYGQAAMPTQNVAASSTAPGIPDTAAGTNGSASA 59

Query: 58  IDD-------------RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
                              A++    + +K   L  +I+  G     L L  Y       
Sbjct: 60  DVPSASATANTAAAPLETPAVASKDLIHVKTDVLDLAIDPVGGDVVQLRLPLYPRRQDRP 119

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIK----LVF 160
                L   +  +  + A+     T           V+                   L F
Sbjct: 120 DVPFQLF-DNGGERTFLAQSGLTGTNGPDARAAGRPVYTSTQKTYQLADGQDTMVVDLKF 178

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT----ATNTFGV 216
                   +R       Y   +   V N S      +   ++ R                
Sbjct: 179 SENGVNYIKRFTFKRGLYDLVMTYVVDNQSAQPWSGNLFAQLKRDASSDPSSTTATGTAT 238

Query: 217 QEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFK 276
             G       +   +    DI+K  +        W+     Y+ + +IP    +   Q +
Sbjct: 239 YLGAALWTAAEPYKKVSMKDIDKGQVKET-VQGGWVAWLQHYFVTAWIPDHNATNAVQTR 297

Query: 277 YLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDW 336
              D    Y   F++  +++ PG    T+  L+AG K    +         P  E+ +D+
Sbjct: 298 --KDSQGNYIIGFTSPTLSVAPGAQGETSATLYAGPKSQAVLKELS-----PGLELTVDY 350

Query: 337 GWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKI 396
           G+ +FIA+P+F L+ + + ++GN+G +I++ T+ +K LFFPL+   Y S A M+ + PK+
Sbjct: 351 GFLWFIAQPIFWLLQHIHAILGNWGWSIIVLTMLIKGLFFPLSAASYKSMARMRAVAPKL 410

Query: 397 DELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHA 456
             L+E+      Q + +AM++LYK   INPL GC PIL+Q+PVF ++Y V+  S+EMR A
Sbjct: 411 ALLKEQHGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLSLYWVLLESVEMRQA 469

Query: 457 PFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQ 516
           P+  WI DL+  DP                     I PIIM  +MFIQ +++P P D  Q
Sbjct: 470 PWILWITDLSIKDPFF-------------------ILPIIMGATMFIQQRLNPTPPDPMQ 510

Query: 517 AMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           A ++  MP++F F    FPAGL++YW  +N +SI QQA I +   A
Sbjct: 511 AKVMKMMPIIFTFFFLWFPAGLVLYWVVNNTLSIAQQAYITRKIEA 556


>gi|253991870|ref|YP_003043226.1| inner membrane protein translocase component YidC [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253783320|emb|CAQ86485.1| similar to 60 kda inner-membrane protein yidc of escherichia coli
           [Photorhabdus asymbiotica]
          Length = 546

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 134/571 (23%), Positives = 246/571 (43%), Gaps = 54/571 (9%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL  +    WQ +      E   N +       Q   + +     +   
Sbjct: 1   MDSQRNLLL-IALLFVSFLVWQAW------EADKNPQPTTVQATQQTDMPSGENQAVPGS 53

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
                     + +K   L  +IN +G   ++ +L  Y   + SN P   L   +     Y
Sbjct: 54  -----GKGKLITVKTDVLSLTINTRGGDIEEADLLAYPDTLGSNQPFKLL--ETTPAFTY 106

Query: 121 FAELDYVSTANNIELPNSNTV-WNLISGKILTPTTPIKLVFK-----NANNILFERTISL 174
            A+             NS    +       +      +L            +  +  +  
Sbjct: 107 QAQSGLTGKDGPDNPTNSERPLYTTAQDSYVLDNGQDELRIPLNFVAKDGVVYVKTFVLK 166

Query: 175 DEHYLFKIVDTVTNNSIDQIRFSPRGRIMR------HKPQTATNTFGVQEGFIAVLGDKS 228
              Y   +   + N +   ++ +  G++ +      H+   ++N         A   D +
Sbjct: 167 RGEYAISVDYRIHNTTEKPLQMTFFGQLKQNVELPKHRDTGSSNFALHTYRGAAYSSDDN 226

Query: 229 LVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAK 288
             ++      +S   +      W+ +  +Y+A+ +IPS      S F   S         
Sbjct: 227 KYKKHSFSDIESEPLSVTTKGGWVAMLQQYFATAWIPSANE--TSTFYTASLDKKMAAIG 284

Query: 289 FSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFM 348
           + +  I++      T ++ L+ G +    +         P  ++ +D+GW +FI++P+F 
Sbjct: 285 YKSAPISVAANSEKTVSSTLWIGPEIQDEMAAVA-----PHLDLSVDYGWLWFISQPLFK 339

Query: 349 LMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPP 408
           L+ + +  +GN+G +I++ T  V+ + +PL K QY S A M+ +QPK+  +RE+      
Sbjct: 340 LLKFLHGFIGNWGFSIIVITFIVRGIMYPLTKAQYTSMAKMRLLQPKLAAMRERIGD-DR 398

Query: 409 QVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAA 468
           Q + + M+ LYK   +NPL GC P+L+Q+P+F A+Y ++  S+E+RHAPF GWI DL+A 
Sbjct: 399 QRMSQEMMALYKAEKVNPLGGCLPLLIQMPIFLALYYMLMGSVELRHAPFAGWINDLSAQ 458

Query: 469 DPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVF 527
           DP                     I P++M ++MF+  KMSP    D  Q  I+ +MPV+F
Sbjct: 459 DPYY-------------------ILPLLMGVTMFVIQKMSPTTITDPMQQKIMTYMPVMF 499

Query: 528 VFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
                 FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 500 TIFFLWFPSGLVLYYIVSNLVTIIQQQLIYR 530


>gi|270264115|ref|ZP_06192382.1| putative inner membrane protein translocase component YidC
           [Serratia odorifera 4Rx13]
 gi|270041764|gb|EFA14861.1| putative inner membrane protein translocase component YidC
           [Serratia odorifera 4Rx13]
          Length = 545

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 142/572 (24%), Positives = 247/572 (43%), Gaps = 56/572 (9%)

Query: 1   MERNWNYFVAIAL--SVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           M+   N F+   L  S +I  AWQ       + +   +  N  T    +Q          
Sbjct: 1   MDSQRNLFLIALLFVSFMIWQAWQTDNAPQPVAQTTQQTSNTATGDAASQAVP------- 53

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
                A      + +    L  +IN +G   +   L  Y   + S++P   L   +    
Sbjct: 54  -----ASGQGKLITVNTDVLSLTINTRGGDIEQAKLLAYPDTLGSSTPFQLL--ENTPSF 106

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKILT-----PTTPIKLVFKNANNILFERTIS 173
            Y A+             N        +    T         I L F   +  ++ +T  
Sbjct: 107 VYQAQSGLTGRNGPDNPANGERPLFQAAQDNYTLPEGQDELRIPLTFTGKDGAVYTKTFV 166

Query: 174 LDEHYL-FKIVDTVTNNSIDQIRFSPRGRIMRH-----KPQTATNTFGVQEGFIAVLGDK 227
           L  ++    +   V N S   +  +  G++ +         T +N F +     A     
Sbjct: 167 LKRNHYAVGVDYNVDNKSTAPLELTLFGQLKQTTELPKHRDTGSNNFALHTFRGAAYSSS 226

Query: 228 SLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA 287
               QKY+  +K    N      W+ +  +Y+A+ ++P+  T   + F     G      
Sbjct: 227 EDKYQKYA-FDKDENLNVTTQGGWVAMLQQYFATAWVPA--TQGSNTFYTAKPGDNLSTI 283

Query: 288 KFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMF 347
            F +  + + PG        L+ G +    +         P  ++ +D+GW +FI++P+F
Sbjct: 284 GFKSTPVVVQPGAQQQLNATLWVGPELQDQMAQLA-----PHLDLTVDYGWLWFISQPLF 338

Query: 348 MLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSP 407
            L+ + +  +GN+G +I++ T  V+ + +PL K QY S A M+ +QPK+  +RE+     
Sbjct: 339 KLLKFIHGFIGNWGFSIIIITFIVRGIMYPLTKAQYTSMAKMRMLQPKLQAMRERIGDDK 398

Query: 408 PQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAA 467
            Q + + M+ LYK+  +NPL GC P+++Q+P+F A+Y ++  S+E+RHAPF  WI DL+A
Sbjct: 399 -QRMSQEMMALYKSEKVNPLGGCLPLVIQMPIFLALYYMLMGSVELRHAPFALWIHDLSA 457

Query: 468 ADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVV 526
            DP                     I PI+M ++MF   KMSP    D  Q  I+ +MPV+
Sbjct: 458 QDPYY-------------------ILPILMGVTMFFIQKMSPTTVTDPMQQKIMTFMPVI 498

Query: 527 FVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           F      FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 499 FTVFFLWFPSGLVLYYIVSNLVTILQQQLIYR 530


>gi|307133251|ref|YP_003885267.1| cytoplasmic insertase into membrane protein, Sec system [Dickeya
           dadantii 3937]
 gi|306530780|gb|ADN00711.1| cytoplasmic insertase into membrane protein, Sec system [Dickeya
           dadantii 3937]
          Length = 543

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 147/570 (25%), Positives = 249/570 (43%), Gaps = 52/570 (9%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL  +    WQ +      E   N     QT +Q N      A   +  
Sbjct: 1   MDSQRNLLL-IALLFVTFMIWQQW------ETDKNPPAATQTTQQANGAVGDAANQGVP- 52

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
              A      + +K   L  +IN +G   ++ +L  Y  ++ S+ P   L   +     Y
Sbjct: 53  ---ASGQGKLITVKTDVLSLNINTRGGDIEEADLLAYPAELGSSQPFKLL--ETTPAFTY 107

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL-----TPTTPIKLVFKNANNILFERTISLD 175
            A+             N +                     I L + +AN + F +T  L 
Sbjct: 108 QAQSGLTGKNGPDNPANGSRPLYTAPADRFELAAGQNELRIPLTYTDANGVSFTKTFVLK 167

Query: 176 -EHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-----KPQTATNTFGVQEGFIAVLGDKSL 229
              Y   +   V N S   +  +  G++ +         T +N F +     A       
Sbjct: 168 RGEYALNVEYGVNNASAQPLELTLFGQLKQSIDLPSHRDTGSNNFALHTYRGAAFSSSDD 227

Query: 230 VEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKF 289
             +KYS  +     N      W+ +  +Y+A+ ++P+   +    F   + G+      F
Sbjct: 228 KYRKYSFSDMKENLNITTQGGWVAMLQQYFATAWVPAAAGNNT--FYSANLGNGLAAIGF 285

Query: 290 SANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFML 349
            A  + + PG        L+ G +    +         P  ++ +D+GW +FI++P+F L
Sbjct: 286 KAPPVIVQPGSQQNLNATLWVGPEIQDKMATVA-----PHLDLTVDYGWLWFISQPLFKL 340

Query: 350 MSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQ 409
           + + +  +GN+G +I+  T  V+ + +PL K QY S A M+ +QPK+  +RE+      Q
Sbjct: 341 LKFLHGFIGNWGFSIIAITFIVRGIMYPLTKAQYTSMAKMRMLQPKLQAMRERIGDDK-Q 399

Query: 410 VLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAAD 469
            + + M+ LYK   +NPL GC+P+L+Q+P+F A+Y ++  S+E+RHAPF  WI DL+A D
Sbjct: 400 RMSQEMMALYKAEKVNPLGGCFPLLIQMPIFLALYYMLMGSVELRHAPFALWIHDLSAQD 459

Query: 470 PTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFV 528
           P                     + PI+M L+MF   KMSP    D  Q  I+ +MPV+F 
Sbjct: 460 PYY-------------------VLPILMGLTMFFIQKMSPTTVTDPMQQKIMTYMPVIFT 500

Query: 529 FALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
                FP+GL++Y+  SN+++I QQ +I +
Sbjct: 501 VFFLWFPSGLVLYYIVSNLVTIAQQQLIYR 530


>gi|71736510|ref|YP_277293.1| inner membrane protein translocase component YidC [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|123634467|sp|Q48BF2|OXAA_PSE14 RecName: Full=Inner membrane protein oxaA
 gi|71557063|gb|AAZ36274.1| inner membrane protein, 60 kDa [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 563

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 142/586 (24%), Positives = 233/586 (39%), Gaps = 54/586 (9%)

Query: 1   MERNWNYFVAIALSVIIVYA---WQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           M+      + +AL+++       W   Y    +   N                 + +A  
Sbjct: 1   MDI-KRTILIVALAIVTYVGVLKWNQDYGQAAMPTQNVAASTTAPGIPDTAAGTNGSASA 59

Query: 58  IDD-------------RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
                              A++    + +K   L  +I+  G     L L  Y       
Sbjct: 60  DVPSASATANTAAAPLETPAVASKDLIHVKTDVLDLAIDPVGGDVVQLRLPLYPRRQDRP 119

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIK----LVF 160
                L   +  +  + A+     T           V+                   L F
Sbjct: 120 DVPFQLF-DNGGERTFLAQSGLTGTNGPDARAAGRPVYTSTQKTYQLADGQDTMVVDLKF 178

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT----ATNTFGV 216
                   +R       Y   +   V N S      +   ++ R                
Sbjct: 179 SENGVNYIKRFTFKRGLYDLVMTYVVDNQSAQPWAGNLFAQLKRDASSDPSSTTATGTAT 238

Query: 217 QEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFK 276
             G       +   +    DI+K  I        W+     Y+ + +IP    +   Q +
Sbjct: 239 YLGAALWTAAEPYKKVSMKDIDKGQIKET-VQGGWVAWLQHYFVTAWIPDHNATNAVQTR 297

Query: 277 YLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDW 336
              D    Y   F++  +++ PG    T+  L+AG K    +         P  E+ +D+
Sbjct: 298 --KDSQGNYIIGFTSPTLSVAPGAQGETSATLYAGPKSQAVLKELS-----PGLELTVDY 350

Query: 337 GWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKI 396
           G+ +FIA+P+F L+ + + ++GN+G +I++ T+ +K LFFPL+   Y S A M+ + PK+
Sbjct: 351 GFLWFIAQPIFWLLQHIHAILGNWGWSIIVLTMLIKGLFFPLSAASYKSMARMRAVAPKL 410

Query: 397 DELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHA 456
             L+E+      Q + +AM++LYK   INPL GC PIL+Q+PVF ++Y V+  S+EMR A
Sbjct: 411 ALLKEQHGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLSLYWVLLESVEMRQA 469

Query: 457 PFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQ 516
           P+  WI DL+  DP                     I PIIM  +MFIQ +++P P D  Q
Sbjct: 470 PWILWITDLSIKDPFF-------------------ILPIIMGATMFIQQRLNPTPPDPMQ 510

Query: 517 AMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           A ++  MP++F F    FPAGL++YW  +N +SI QQA I +   A
Sbjct: 511 AKVMKMMPIIFTFFFLWFPAGLVLYWVVNNTLSIAQQAYITRKIEA 556


>gi|257485603|ref|ZP_05639644.1| putative inner membrane protein translocase component YidC
           [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|331011891|gb|EGH91947.1| membrane protein insertase [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 563

 Score =  348 bits (892), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 141/586 (24%), Positives = 233/586 (39%), Gaps = 54/586 (9%)

Query: 1   MERNWNYFVAIALSVIIVYA---WQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           M+      + +AL+++       W   Y    +   N                 + +A  
Sbjct: 1   MDI-KRTILIVALAIVTYVGVLKWNQDYGQAAMPTQNVAASTTAPGIPDTAAGTNGSASA 59

Query: 58  IDD-------------RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
                              A++    + +K   L  +I+  G     L L  Y       
Sbjct: 60  DVPSASATANTAAAPLETPAVASKDLIHVKTDVLDLAIDPVGGDVVQLRLPLYPRRQDRP 119

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIK----LVF 160
                L   +  +  + A+     T           V+                   L F
Sbjct: 120 DVPFQLF-DNGGERTFLAQSGLTGTNGPDARAAGRPVYTSTQKTYQLADGQDTMVVDLKF 178

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT----ATNTFGV 216
                   +R       Y   +   V N S      +   ++ R                
Sbjct: 179 SENGINYIKRFTFKRGLYDLVMTYVVDNQSAQPWAGNLFAQLKRDASSDPSSTTATGTAT 238

Query: 217 QEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFK 276
             G       +   +    DI+K  +        W+     Y+ + +IP    +   Q +
Sbjct: 239 YLGAALWTAAEPYKKVSMKDIDKGQVKET-VQGGWVAWLQHYFVTAWIPDHNATNAVQTR 297

Query: 277 YLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDW 336
              D    Y   F++  +++ PG    T+  L+AG K    +         P  E+ +D+
Sbjct: 298 --KDSQGNYIIGFTSPTLSVAPGAQGETSATLYAGPKSQAVLKELS-----PGLELTVDY 350

Query: 337 GWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKI 396
           G+ +FIA+P+F L+ + + ++GN+G +I++ T+ +K LFFPL+   Y S A M+ + PK+
Sbjct: 351 GFLWFIAQPIFWLLQHIHAILGNWGWSIIVLTMLIKGLFFPLSAASYKSMARMRAVAPKL 410

Query: 397 DELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHA 456
             L+E+      Q + +AM++LYK   INPL GC PIL+Q+PVF ++Y V+  S+EMR A
Sbjct: 411 ALLKEQHGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLSLYWVLLESVEMRQA 469

Query: 457 PFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQ 516
           P+  WI DL+  DP                     I PIIM  +MFIQ +++P P D  Q
Sbjct: 470 PWILWITDLSIKDPFF-------------------ILPIIMGATMFIQQRLNPTPPDPMQ 510

Query: 517 AMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           A ++  MP++F F    FPAGL++YW  +N +SI QQA I +   A
Sbjct: 511 AKVMKMMPIIFTFFFLWFPAGLVLYWVVNNTLSIAQQAYITRKIEA 556


>gi|261868618|ref|YP_003256540.1| putative inner membrane protein translocase component YidC
           [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261413950|gb|ACX83321.1| putative inner membrane protein translocase component YidC
           [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 543

 Score =  348 bits (891), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 144/569 (25%), Positives = 247/569 (43%), Gaps = 40/569 (7%)

Query: 1   MERNWNY--FVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           M+          + +S I+   WQ  Y  P+         +   V   +   N+  A   
Sbjct: 1   MDSRRGLLVIALLFMSFIVYQQWQLDYHTPKPVTTEQTAASASDVPASSNAGNAVIAT-- 58

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
                  +    + L+N      IN  G       L  Y  ++ SN+P + L   +  ++
Sbjct: 59  ----DTQAKGKIITLENDVFCLKINTLGGDVVSSELLKYDAELDSNTPFMLL--QNTPQH 112

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKILTPTT---PIKLVFKNANNILFERTISLD 175
            Y A+   +                      L        + LV+        +      
Sbjct: 113 VYIAQSGLIGKDGIDTKSGRADYQADGDNFKLADGQNELSVPLVYVKDGVTYRKVFTLKR 172

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
             Y   +   + N S   I   P G++     +++ N         A    ++  ++   
Sbjct: 173 GEYNIAVNYEINNQSDKTIEVEPYGQLRHTLVESSGNVAMPTYTGGAYSSSETNYKKYSF 232

Query: 236 DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
              +++  + +    W+ +   Y+ S +IP+++                    +     +
Sbjct: 233 SDMENANLSINTKAGWVAVLQHYFVSAWIPNQDADNQLYTLIDKAN-NIGSIGYRGPVTS 291

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           I P  + T T+ L+ G K    +            ++ +D+GW +FIAKP+F L+++   
Sbjct: 292 IQPNTTETLTSKLWTGPKLQNEMAQVAN-----HLDLTVDYGWAWFIAKPLFWLLTFIQK 346

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
           LV N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M
Sbjct: 347 LVHNWGVAIICVTLVVKAILYPLTKAQYTSMAKMRMLQPKLREMRERF-GEDRQRMSQEM 405

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           ++LYK   +NPL GC P+LLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A DP     
Sbjct: 406 MKLYKDEKVNPLGGCLPLLLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQDPYY--- 462

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSF 534
                           I PI+M  SMF+  KMSP P AD  Q  ++ +MP++F+     F
Sbjct: 463 ----------------ILPILMGASMFLLQKMSPTPVADPMQQKVMTFMPLIFMVFFLWF 506

Query: 535 PAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           PAGL++YW  SN+I+I+QQ +I +    +
Sbjct: 507 PAGLVLYWLVSNLITIIQQQLIYRGLEKK 535


>gi|330987015|gb|EGH85118.1| membrane protein insertase [Pseudomonas syringae pv. lachrymans
           str. M301315]
          Length = 563

 Score =  348 bits (891), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 141/586 (24%), Positives = 234/586 (39%), Gaps = 54/586 (9%)

Query: 1   MERNWNYFVAIALSVIIVYA---WQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           M+      + +AL+++       W   Y    +   N                 + +A  
Sbjct: 1   MDI-KRTILIVALAIVTYVGVLKWNQDYGQAAMPTQNVAASTTAPGIPDTAAGTNGSASA 59

Query: 58  IDD-------------RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
                              A++    + +K   L  +I+  G     L L  Y       
Sbjct: 60  DVPSASATANTAAAPLETPAVASKDLIHVKTDVLDLAIDPVGGDVVQLRLPLYPRRQDRP 119

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIK----LVF 160
                L   +  +  + A+     T           V+                   L F
Sbjct: 120 DVPFQLF-DNGGERTFLAQSGLTGTNGPDARAAGRPVYTSTQKTYQLADGQDTMVVDLKF 178

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT----ATNTFGV 216
                   +R       Y   +   V N S  +   +   ++ R                
Sbjct: 179 SENGVNYIKRFTFKRGLYDLVMTYVVDNQSAQRWAGNLFAQLKRDASSDPSSTTATGTAT 238

Query: 217 QEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFK 276
             G       +   +    DI+K  +        W+     Y+ + +IP    +   Q +
Sbjct: 239 YLGAALWTAAEPYKKVSMKDIDKGQVKET-VQGGWVAWLQHYFVTAWIPDHNATNAVQTR 297

Query: 277 YLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDW 336
              D    Y   F++  +++ PG    T+  L+AG K    +         P  E+ +D+
Sbjct: 298 --KDSQGNYIIGFTSPTLSVAPGAQGETSATLYAGPKSQAVLKELS-----PGLELTVDY 350

Query: 337 GWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKI 396
           G+ +FIA+P+F L+ + + ++GN+G +I++ T+ +K LFFPL+   Y S A M+ + PK+
Sbjct: 351 GFLWFIAQPIFWLLQHIHAILGNWGWSIIVLTMLIKGLFFPLSAASYKSMARMRAVAPKL 410

Query: 397 DELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHA 456
             L+E+      Q + +AM++LYK   INPL GC PIL+Q+PVF ++Y V+  S+EMR A
Sbjct: 411 ALLKEQHGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLSLYWVLLESVEMRQA 469

Query: 457 PFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQ 516
           P+  WI DL+  DP                     I PIIM  +MFIQ +++P P D  Q
Sbjct: 470 PWILWITDLSIKDPFF-------------------ILPIIMGATMFIQQRLNPTPPDPMQ 510

Query: 517 AMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           A ++  MP++F F    FPAGL++YW  +N +SI QQA I +   A
Sbjct: 511 AKVMKMMPIIFTFFFLWFPAGLVLYWVVNNTLSIAQQAYITRKIEA 556


>gi|71909810|ref|YP_287397.1| protein translocase subunit yidC [Dechloromonas aromatica RCB]
 gi|123746663|sp|Q477Q4|OXAA_DECAR RecName: Full=Inner membrane protein oxaA
 gi|71849431|gb|AAZ48927.1| protein translocase subunit yidC [Dechloromonas aromatica RCB]
          Length = 547

 Score =  348 bits (891), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 150/567 (26%), Positives = 241/567 (42%), Gaps = 36/567 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNF--YVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLID 59
                  + +  +      W+N+  Y  P+  +             P+    + AA    
Sbjct: 1   MDTRRLILVLIFTFSSFMLWENWQKYNQPKPADAVAAAPVSGAAPTPSAALQAKAAPGTP 60

Query: 60  DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNA 119
             A  +S +    +    L  +I+ +G     L L  Y            L      K+ 
Sbjct: 61  PVATPVSTAETFSITTDLLKATISAQGGDLVSLELLNYKEH-DDIQKNFDLFD---AKHQ 116

Query: 120 YFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD-EHY 178
           Y A+   +             V         T    ++L   + N I   + ++     Y
Sbjct: 117 YLAQAGLIGEGLPTHRTTFKHVGGATKLADGTDELKVRLESADQNGIKVAKILTFKRGSY 176

Query: 179 LFKIVDTVTNNSIDQIRFSPRGRIMRHK--PQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
           L  I   V N S   I      ++ R    P   T       G           +  +  
Sbjct: 177 LIDIAWEVANGSDKAIAPHAYYQLQRDDLAPAGETKMVSTFTGPAVFTDADKYQKVTFEH 236

Query: 237 IEKSSISNFHE-SNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
           I  +         N WL +   Y+ S ++P  +T      + + +G   +QA        
Sbjct: 237 IADNKAKFTKTADNGWLAMVQHYFVSAWVPKDKTQREFYMRKV-EGSNVFQAGVIVPVAE 295

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           I PG     +  L+AG +    +         P  ++++D+GW   +A P+F  +   + 
Sbjct: 296 IAPGAKGEASVSLYAGPQMQSALKQVA-----PGLDLVVDYGWLTVVAAPIFWALEAIHK 350

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
           LVGN+G AI++ T+ +K +FFPL+   Y S A MK + P++ +L+E+F     Q L + M
Sbjct: 351 LVGNWGWAIVVLTIMIKAVFFPLSAASYKSMAKMKMLTPRLAQLKERFGDDK-QRLNQEM 409

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           ++LY+T  +NPL GC PIL+QIPVF A+Y V+  ++EMR AP+  WIKDLA+ADP     
Sbjct: 410 MKLYQTEKVNPLGGCLPILVQIPVFIALYWVLLGAVEMRGAPWILWIKDLASADPYY--- 466

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFP 535
                           I P+IM +SMF+Q K++P P D  QA ++  MP++F F    FP
Sbjct: 467 ----------------ILPVIMMVSMFVQTKLNPTPPDPIQAKVMMMMPLIFGFMFFWFP 510

Query: 536 AGLIIYWSWSNVISIVQQAVIMKMHGA 562
           AGL++YW  +NV+SI QQ  I ++  A
Sbjct: 511 AGLVLYWVVNNVLSIAQQWQITRLIDA 537


>gi|258544268|ref|ZP_05704502.1| YidC/Oxa1 family membrane protein insertase [Cardiobacterium
           hominis ATCC 15826]
 gi|258520506|gb|EEV89365.1| YidC/Oxa1 family membrane protein insertase [Cardiobacterium
           hominis ATCC 15826]
          Length = 557

 Score =  347 bits (890), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 137/572 (23%), Positives = 244/572 (42%), Gaps = 38/572 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYV---YPRIEEMNNERKN-----IQTVKQPNQVDNS 52
           M+ N    + IA + I    WQ + +    P     +                P     +
Sbjct: 1   MKNNPKLLLYIAAAFIAFLLWQKWQIANLPPTPTTASVPAATDVPQGTPGSDVPAATSGT 60

Query: 53  YAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLS 112
            + +  D +A   +    + +K   L   I  KG       L  Y  + + + P+  L  
Sbjct: 61  RSDIPGDTQADTTANGAVIHVKTDVLELDIANKGGTIVHTTLPAYPENKNGDKPLALLHQ 120

Query: 113 PSNTKNAYFAELDYVSTANNIELPNSNTVW-NLISGKILTPTTPIKLVFKNANNILFERT 171
            +  +    + L            ++ +      +      +  + L ++     + +  
Sbjct: 121 DNPGRFLLQSGLTAADGGKAPSHHDTFSAAATTYTLADGQDSLVVPLSWQENGITVHKTY 180

Query: 172 ISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVE 231
                 Y F +   V N+S    R +   + +  +P  +     V     AV+      +
Sbjct: 181 TFKRGAYDFTLEQKVENHSDKAWRGNAYQQWVFGQPLPSKGLGQVATFTGAVMS---YDD 237

Query: 232 QKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSA 291
             Y  I+  S  N +    W+ +   Y+    IP++     + F   +       A    
Sbjct: 238 DPYEKIKLGSKFNTNTETGWVAMIQHYFLGAIIPAQGQP-QAFFTNTNASSGDNFAGVVG 296

Query: 292 NEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMS 351
               + PG S + T+ ++ G K    +         P  +  +D+G+ + I +PMF +++
Sbjct: 297 ASSEVAPGGSTSFTSQIYIGPKIQKDLKAVA-----PNLDKTVDYGFLFMIGQPMFYVIN 351

Query: 352 YFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVL 411
           + + ++ N+G AI++TT+ +KLLFF  +   Y S A M+ + P++  ++E++     Q  
Sbjct: 352 FIHGILHNWGWAIIVTTLLIKLLFFTPSAWAYKSMAKMRRLGPEMQRIKERYGD-DRQAA 410

Query: 412 QKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPT 471
             AM++LYK   +NP +GC P+LLQIP F A Y V+  S+E+RHAP+ GWI+DL+A DP 
Sbjct: 411 SMAMMKLYKDEKVNPASGCLPMLLQIPFFIAFYWVLVESVELRHAPWLGWIQDLSAMDPY 470

Query: 472 NIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFAL 531
                               I PII +  MF+Q K++PPP D  QA ++  +P+VF    
Sbjct: 471 Y-------------------ILPIINAALMFLQQKLNPPPPDPTQAKVMMMLPLVFGIMF 511

Query: 532 SSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
             FP+GL++YW+ SN   IVQQ ++ K +G  
Sbjct: 512 MWFPSGLVLYWTVSNAFGIVQQYIMNKRYGER 543


>gi|37528712|ref|NP_932057.1| putative inner membrane protein translocase component YidC
           [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|36788151|emb|CAE17278.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 546

 Score =  347 bits (890), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 139/571 (24%), Positives = 250/571 (43%), Gaps = 54/571 (9%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL  +    WQ +      E   N +       Q   + +S    +   
Sbjct: 1   MDSQRNLLL-IALLFVSFLVWQAW------EADKNPQPTTVQATQQTDMPSSENQAVPGS 53

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
                     + +K   L  +IN +G   ++ +L  Y   + SN P   L   +     Y
Sbjct: 54  -----GKGKLITVKTDVLSLTINTRGGDIEEADLLAYPDTLGSNQPFKLL--ETTPAFTY 106

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL-----TPTTPIKLVFKNANNILFERTISLD 175
            A+             NS       +              I + F   N I++ +T  L 
Sbjct: 107 QAQSGLTGKDGPDNPMNSERPLYTAAQDSYVLADGQDELRIPMNFVTKNGIVYVKTFVLK 166

Query: 176 -EHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-----KPQTATNTFGVQEGFIAVLGDKSL 229
              Y   +   + N +   ++ +  G++ +         T ++ F +     A       
Sbjct: 167 RGEYAISVDYRIHNTTEKPLQMTFFGQLKQSVELPKHRDTGSSNFALHTYRGAAYSSDDT 226

Query: 230 VEQKY-SDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAK 288
             +KY     +    +      W+ +  +Y+A+ ++P       S F  ++ G       
Sbjct: 227 KYKKYSFSDIEGESLSVTTKGGWIAMLQQYFATAWVPVANE--TSTFYTVALGKEMAAIG 284

Query: 289 FSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFM 348
           + +  I++      T ++ L+ G +    +         P  ++ +D+GW +FI++P+F 
Sbjct: 285 YKSAPISVAANSEKTVSSTLWIGPEIQDEMAAVA-----PHLDLSVDYGWLWFISQPLFK 339

Query: 349 LMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPP 408
           L+ + +  +GN+G +I++ T  V+ + +PL K QY S A M+ +QPK+  +RE+      
Sbjct: 340 LLKFLHGFIGNWGFSIIVITFIVRGIMYPLTKAQYTSMAKMRLLQPKLAAMRERIGDDK- 398

Query: 409 QVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAA 468
           Q + + M+ LYK   +NPL GC P+L+Q+P+F A+Y ++  S+E+RHAPF GWI DL+A 
Sbjct: 399 QRMSQEMMALYKAEKVNPLGGCLPLLIQMPIFLALYYMLMGSVELRHAPFAGWIHDLSAQ 458

Query: 469 DPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVF 527
           DP                     I P++M ++MFI  KMSP    D  Q  I+ +MPV+F
Sbjct: 459 DPYY-------------------ILPLLMGVTMFIIQKMSPTTITDPMQQKIMTYMPVIF 499

Query: 528 VFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
                 FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 500 TIFFLWFPSGLVLYYIVSNLVTIIQQQLIYR 530


>gi|90581131|ref|ZP_01236930.1| putative inner membrane protein translocase component YidC [Vibrio
           angustum S14]
 gi|90437652|gb|EAS62844.1| putative inner membrane protein translocase component YidC [Vibrio
           angustum S14]
          Length = 544

 Score =  346 bits (888), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 144/568 (25%), Positives = 239/568 (42%), Gaps = 38/568 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M    N  + IAL  +    +Q +      +  +       T        ++    L D 
Sbjct: 1   MGSQRN-ILLIALLFVSFLLFQQWNADKTPKPQSQGVAQQSTQSSDIPSHSAEGQPLTDQ 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
                S    + +K   L  +++  G    D  L  Y+  + S  P V L       + Y
Sbjct: 60  T----SSQNLITIKTDVLELTVDTLGGDVVDAKLLKYNNTLDSKDPFVLLNDTDG--HDY 113

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLV----FKNANNILFERTISLDE 176
            A+   +              +++ +   +      +L     F        +  +    
Sbjct: 114 IAQSGLIGPNGADSQQGGRAQYSVTAKDFVMSPEQNELRVPMTFTKDGINYTKTFVLKRN 173

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
            Y   +  TV NN+          ++      +  +         A   + +  ++   D
Sbjct: 174 DYAVNVDYTVANNTDKAASVQMYAQLRHKLSDSGGSLTMPTYLGGAYSANDTKYKKYSFD 233

Query: 237 IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITI 296
             K    +   +  W+ I   Y+ S +IP       SQ    +     Y         T+
Sbjct: 234 DMKDKNLDVAANEGWVAIMQHYFVSAWIPRDGADQTSQVYSTTSNGNGY-IGVRMPIETV 292

Query: 297 LPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNL 356
            PG+S      L+ G K    +    K+       + +D+GW +FIA P+  L+S+ ++L
Sbjct: 293 APGQSKEIKATLWVGPKLQNEMAATAKN-----LNLTVDYGWLWFIANPLHKLLSFIHSL 347

Query: 357 VGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMI 416
           VGN+GIAI++ T  V+   +PL K QY S A M+ +QPKI  +RE+      Q   + M+
Sbjct: 348 VGNWGIAIIILTFIVRGAMYPLTKAQYTSMAKMRMLQPKIQAMRERLGD-DRQRQSQEMM 406

Query: 417 QLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTL 476
           +LYK   +NPL GC PILLQ+P+F A+Y  +  S+E+RHAPF+GWI DL+A DP      
Sbjct: 407 ELYKKEKVNPLGGCLPILLQMPIFIALYWALMESVELRHAPFFGWIHDLSAQDPYY---- 462

Query: 477 FGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFP 535
                          + PI+M ++MF   KMSP    D  Q  I+ +MPV+F F    FP
Sbjct: 463 ---------------VLPILMGITMFFIQKMSPSTVTDPMQQKIMTFMPVMFTFFFLFFP 507

Query: 536 AGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           +GL++YW  SN+++++QQ +I +    +
Sbjct: 508 SGLVLYWLVSNIVTLIQQTIIFRALEKK 535


>gi|73666922|ref|YP_302938.1| putative inner membrane protein translocase component YidC
           [Ehrlichia canis str. Jake]
 gi|72394063|gb|AAZ68340.1| protein translocase subunit yidC [Ehrlichia canis str. Jake]
          Length = 579

 Score =  346 bits (888), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 215/587 (36%), Positives = 327/587 (55%), Gaps = 23/587 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M    N  +A+ LSV+I+  W+  Y      +   E            +     +     
Sbjct: 1   MVEVRNLILAVILSVLIMTGWRFIYDKFFTTQHIIE----DNTNSDTMIPEIDDSFTHKT 56

Query: 61  RAQALSMSPRV--ELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
           RA+ +  +  +   L N  + GSI+LKGAQFDDL  + YH+   SNS  + LLSP  T+ 
Sbjct: 57  RAEIIGSNTDIRLNLSNKKIHGSISLKGAQFDDLIFKNYHVTPDSNSDGIILLSPEETEG 116

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDEHY 178
            YF E  ++   + I LPN +++WN      L+P  P  L + N   I+F+  I+LD  Y
Sbjct: 117 VYFIEFGWIDPQHKITLPNHSSIWN-SDQPTLSPNNPATLTWDNKEGIIFKIRITLDNDY 175

Query: 179 LFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIE 238
           +FKI   VTNN+   +   P GRI R K  T  + +   EG +    + +L E  Y  I 
Sbjct: 176 MFKIEQMVTNNTNSIVNLIPYGRINRSKHTTEKSYWISHEGAVGSFSN-TLKEWTYKTIT 234

Query: 239 KSSISNFH------ESNSWLGISDKYWASVFIPSKETSFHSQFK---YLSDGHARYQAKF 289
           K             + N W+GI DKYW +  IP+        F       +   R+Q  F
Sbjct: 235 KEKNIRIQSQDRNDDQNQWIGIGDKYWFTALIPNVLQKSKVNFHVKHAKHNSEDRFQVDF 294

Query: 290 SANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFML 349
           S +     P K++T+T++LFAGAKE   +  Y+ +L I  F+  +D+G  YFI KP+F+L
Sbjct: 295 SHDNYIAHPNKTVTSTSYLFAGAKELKLLDKYKDNLNIALFDKAVDFGVLYFITKPVFLL 354

Query: 350 MSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQ 409
           + YFY+ +GNFG+AI+L TV +KL+ FPL+ K YVS   +K +QP I +++E  K    +
Sbjct: 355 LEYFYDAIGNFGLAILLLTVVIKLIMFPLSYKAYVSMLKLKYLQPDILKIKELHKNDNDK 414

Query: 410 VLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAAD 469
           +  K +  ++K +N+NP++G  PIL+QIPVFFA+YKV+ +++EMRHAPF+ WIKDL++ D
Sbjct: 415 M-SKEISAIFKKNNVNPMSGFVPILIQIPVFFALYKVLFVTIEMRHAPFYLWIKDLSSFD 473

Query: 470 PTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPP---PADKGQAMILNWMPVV 526
             N+ T+FG+L F +P  + +GI P+I+ ++M IQ K++       DK QA  + ++P +
Sbjct: 474 TANVLTMFGLLKFNVP--ICIGILPVILGITMVIQQKLNNSNSLNQDKVQANFMKFLPYI 531

Query: 527 FVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRST 573
           F+F  SSFPAGLIIYW  SN I+I+QQ +I +    +      ++  
Sbjct: 532 FIFIFSSFPAGLIIYWICSNSITIIQQLIIKQYASKKFNFQKVVKQE 578


>gi|317494663|ref|ZP_07953075.1| membrane protein [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917265|gb|EFV38612.1| membrane protein [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 544

 Score =  346 bits (888), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 139/572 (24%), Positives = 242/572 (42%), Gaps = 57/572 (9%)

Query: 1   MERNWNYFVAIAL--SVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           M+   N  +   L  S +I  AWQ         +   +  N  T    +Q          
Sbjct: 1   MDSQRNLLLIALLFVSFMIWQAWQTDNNPQPTAQTAGQTANTTTADASSQAVPES----- 55

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
                       + +K   L  +IN +G   +  NL  Y   + S+ P   L   +    
Sbjct: 56  -------GQGKLITVKTDVLSLTINTRGGDIEQANLLAYPATLGSDKPFELL--ETTPDF 106

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKIL-----TPTTPIKLVFKNANNILFERTIS 173
            Y A+             N +                     I L +   + +++ +T  
Sbjct: 107 IYQAQSGLTGKNGPDNPANGDRPLYTADQTNFELVNGQDELRIPLTYTAKDGVVYTKTFV 166

Query: 174 LD-EHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-----KPQTATNTFGVQEGFIAVLGDK 227
           L    Y   +   V N+S   +  +  G++ +         T ++ F +     A     
Sbjct: 167 LKRGDYAIGVDYKVKNSSAQPLDLTLFGQLKQSIDLPKHRDTGSSNFALHTFRGAAYSSS 226

Query: 228 SLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA 287
               QKY         N      W+ +  +Y+A+ +IP   ++    F   + G+     
Sbjct: 227 DDKYQKY--AFDKDPLNITTKGGWVAMLQQYFATAWIPQTNSTNQ--FYTANLGNGLSAI 282

Query: 288 KFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMF 347
            F    + + PG        L+ G +    +         P  ++ +D+GW +FI++P+F
Sbjct: 283 GFKGEPVVVAPGTEKNLNATLWVGPEIQSDMAAVA-----PHLDLTVDYGWLWFISQPLF 337

Query: 348 MLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSP 407
            L+ + ++ +GN+G +I++ T  V+ + +PL K QY S A M+ +QPK+  +RE+     
Sbjct: 338 KLLKFIHSFIGNWGFSIIVITFIVRGIMYPLTKAQYTSMAKMRMLQPKLAAMRERIGDDK 397

Query: 408 PQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAA 467
            Q + + M+ LYK+  +NPL GC P+++Q+P+F A+Y ++  S+E+R APF  WI DLAA
Sbjct: 398 -QRMSQEMMALYKSEKVNPLGGCLPLVIQMPIFLALYYMLMGSVELRQAPFALWIHDLAA 456

Query: 468 ADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVV 526
            DP                     I PI+M ++MF   KMSP    D  Q  I+ +MPV+
Sbjct: 457 QDPYY-------------------ILPILMGITMFFIQKMSPTTVTDPMQQKIMTFMPVI 497

Query: 527 FVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           F      FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 498 FTVFFLWFPSGLVLYYIVSNLVTILQQQLIYR 529


>gi|330890254|gb|EGH22915.1| membrane protein insertase [Pseudomonas syringae pv. mori str.
           301020]
          Length = 563

 Score =  346 bits (888), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 141/586 (24%), Positives = 233/586 (39%), Gaps = 54/586 (9%)

Query: 1   MERNWNYFVAIALSVIIVYA---WQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           M+      + +AL+++       W   Y    +   N                 + +A  
Sbjct: 1   MDI-KRTILIVALAIVTYVGVLKWNQDYGQAAMPTQNVAASTTAPGIPDTAAGTNGSASA 59

Query: 58  IDDRAQ-------------ALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
               A              A++    + +K   L  +I+  G     L L  Y       
Sbjct: 60  DVPSASATANTAAAPLETLAVASKDLIHVKTDVLDLAIDPVGGDVVQLRLPLYPRRQDRP 119

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIK----LVF 160
                L   +  +  + A+     T           V+                   L F
Sbjct: 120 DVPFQLF-DNGGERTFLAQSGLTGTNGPDARAAGRPVYTSTQKTYQLADGQDTMVVDLKF 178

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT----ATNTFGV 216
                   +R       Y   +   V N S      +   ++ R                
Sbjct: 179 SENGVNYIKRFTFKRGLYDLVMTYVVDNQSAQPWAGNLFAQLKRDASSDPSSTTATGTAT 238

Query: 217 QEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFK 276
             G       +   +    DI+K  +        W+     Y+ + +IP    +   Q +
Sbjct: 239 YLGAALWTAAEPYKKVSMKDIDKGQVKET-VQGGWVAWLQHYFVTAWIPDHNATNAVQTR 297

Query: 277 YLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDW 336
              D    Y   F++  +++ P     T+  L+AG K    +         P  E+ +D+
Sbjct: 298 --KDSQGNYIIGFTSPTLSVAPAAQGETSATLYAGPKSQAVLKELS-----PGLELTVDY 350

Query: 337 GWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKI 396
           G+ +FIA+P+F L+ + + ++GN+G +I++ T+ +K LFFPL+   Y S A M+ + PK+
Sbjct: 351 GFLWFIAQPIFWLLQHIHAILGNWGWSIIVLTMLIKGLFFPLSAASYKSMARMRAVAPKL 410

Query: 397 DELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHA 456
             L+E+      Q + +AM++LYK   INPL GC PIL+Q+PVF ++Y V+  S+EMR A
Sbjct: 411 ALLKEQHGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLSLYWVLLESVEMRQA 469

Query: 457 PFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQ 516
           P+  WI DL+  DP                     I PIIM  +MFIQ +++P P D  Q
Sbjct: 470 PWILWITDLSIKDPFF-------------------ILPIIMGATMFIQQRLNPTPPDPMQ 510

Query: 517 AMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           A ++  MP++F F    FPAGL++YW  +N +SI QQA I +   A
Sbjct: 511 AKVMKMMPIIFTFFFLWFPAGLVLYWVVNNTLSIAQQAYITRKIEA 556


>gi|291615646|ref|YP_003518388.1| YidC [Pantoea ananatis LMG 20103]
 gi|291150676|gb|ADD75260.1| YidC [Pantoea ananatis LMG 20103]
 gi|327395912|dbj|BAK13334.1| preprotein translocase subunit YidC [Pantoea ananatis AJ13355]
          Length = 548

 Score =  346 bits (887), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 141/574 (24%), Positives = 248/574 (43%), Gaps = 57/574 (9%)

Query: 1   MERNWNYFV--AIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           M+   N F+   + +S +I  AWQ  +    ++    +  N        Q          
Sbjct: 1   MDSQRNLFLIAFLFVSFMIWQAWQTDHAPKPLQTQTTQNTNSAAGDAAGQGVP------- 53

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
                A      + +K   L  +IN +G   D   L  Y   + S+ P   L   +    
Sbjct: 54  -----ASGQGKTITVKTDVLSLTINTRGGDVDQAQLLTYPDKLGSDKPFELL--ETTPSF 106

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKIL-----TPTTPIKLVFKNANNILFERTIS 173
            Y A+             N        +              + + F   N +++ +T  
Sbjct: 107 VYQAQSGLTGRNGPDNPNNGARPLYNTAQDHFELAEGQSELRVPMTFTAENGVVYTKTFV 166

Query: 174 LD-EHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-----KPQTATNTFGVQEGF--IAVLG 225
                Y   +   + N S   +  S  G++ +         T +N F +           
Sbjct: 167 FKRGDYAVNVDYNINNTSQQPLELSMFGQLKQTIDLPKHRDTGSNNFALHTFRGTAYSTS 226

Query: 226 DKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARY 285
           +    + K+  I  +   N   SN W+ +  +Y+A+ ++P   T   +     + G+   
Sbjct: 227 ESKYEKIKFDTIADNENLNTTTSNGWVAMLQQYFATAWVPR--TQGTNTLYTSNLGNGVA 284

Query: 286 QAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKP 345
              + +  +T+ PG   T    L+ G +    +         P  ++ +D+GW +FI++P
Sbjct: 285 AIGYKSAPVTVAPGAQQTLDATLWVGPEIQDKMAAIA-----PHLDLTVDYGWLWFISQP 339

Query: 346 MFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQ 405
           +F L+ + ++ +GN+G +I++ T  V+ + +PL K QY S A M+ +QPKI  +RE+   
Sbjct: 340 LFKLLKFIHSFIGNWGFSIIIITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGD 399

Query: 406 SPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDL 465
              Q   + M+ LYK   +NPL GC P+++Q+P+F A+Y ++S S+E+RHAPF  WI DL
Sbjct: 400 DK-QKQSQEMMALYKAEKVNPLGGCLPLVIQMPIFLALYYMLSGSVELRHAPFILWIHDL 458

Query: 466 AAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMP 524
           +A DP                     I PI+M ++MF   KMSP    D  Q  I+ +MP
Sbjct: 459 SAQDPYY-------------------ILPILMGITMFFIQKMSPTTVTDPMQQKIMTYMP 499

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           V+F      FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 500 VIFTVFFLWFPSGLVLYYIVSNLVTILQQQLIYR 533


>gi|320321684|gb|EFW77783.1| putative inner membrane protein translocase component YidC
           [Pseudomonas syringae pv. glycinea str. B076]
          Length = 563

 Score =  346 bits (887), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 142/586 (24%), Positives = 234/586 (39%), Gaps = 54/586 (9%)

Query: 1   MERNWNYFVAIALSVIIVYA---WQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           M+      + +AL+++       W   Y    +   N                 + +A  
Sbjct: 1   MDI-KRTILIVALAIVTYVGVLKWNQDYGQAAMPTQNVAASTTAPGIPDTAAGTNGSASA 59

Query: 58  IDD-------------RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
                              A++    + +K   L  +I+  G     L L  Y       
Sbjct: 60  DVPSASATANTAAAPLETPAVASKDLIHVKTDVLDLAIDPVGGDVVQLRLPLYPRRQDRP 119

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIK----LVF 160
                L   +  +  + A+     T           V+                   L F
Sbjct: 120 DVPFQLF-DNGGERTFLAQSGLTGTNGPDARAAGRPVYTSTQKTYQLADGQDTMVVDLKF 178

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT----ATNTFGV 216
                   +R     + Y   +   V N S      +   ++ R                
Sbjct: 179 SENGVNYIKRFTFKRDLYDLVMTYVVDNQSAQPWAGNLFAQLKRDASSDPSSTTATGTAT 238

Query: 217 QEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFK 276
             G       +   +    DI+K  I        W+     Y+ + +IP    +   Q +
Sbjct: 239 YLGAALWTAAEPYKKVSMKDIDKGQIKET-VQGGWVAWLQHYFVTAWIPDHNATNAVQTR 297

Query: 277 YLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDW 336
              D    Y   F++  +++ PG    T+  L+AG K    +         P  E+ +D+
Sbjct: 298 --KDSQGNYIIGFTSPTLSVAPGAQGETSATLYAGPKSQAVLKELS-----PGLELTVDY 350

Query: 337 GWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKI 396
           G+ +FIA+P+F L+ + + ++GN+G +I++ T+ +K LFFPL+   Y S A M+ + PK+
Sbjct: 351 GFLWFIAQPIFWLLQHIHAILGNWGWSIIVLTMLIKGLFFPLSAASYKSMARMRAVAPKL 410

Query: 397 DELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHA 456
             L+E+      Q + +AM++LYK   INPL GC PIL+Q+PVF ++Y V+  S+EMR A
Sbjct: 411 ALLKEQHGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLSLYWVLLESVEMRQA 469

Query: 457 PFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQ 516
           P+  WI DL+  DP                     I PIIM  +MFIQ +++P P D  Q
Sbjct: 470 PWILWITDLSIKDPFF-------------------ILPIIMGATMFIQQRLNPTPPDPMQ 510

Query: 517 AMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           A ++  MP++F F    FPAGL++YW  +N +SI QQA I +   A
Sbjct: 511 AKVMKMMPIIFTFFFLWFPAGLVLYWVLNNTLSIAQQAYITRKIEA 556


>gi|254237758|ref|ZP_04931081.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126169689|gb|EAZ55200.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
          Length = 565

 Score =  346 bits (887), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 136/586 (23%), Positives = 236/586 (40%), Gaps = 67/586 (11%)

Query: 15  VIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQALSMS------ 68
           ++++      Y  P +   +      Q +        + + V     + A S +      
Sbjct: 4   LLVLIDRNKDYGQPELPAASASMNTTQGLPDTPSASGTSSDVPTAQSSAAGSEAADKPVA 63

Query: 69  ---PRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELD 125
                +++K   L  +I+ +G     L L  Y   +        L   +  +  Y A+  
Sbjct: 64  VSDKLIQVKTDVLDLAIDPRGGDIVQLGLLQYPRRLDRPDVPFPLF-DNGRERTYLAQSG 122

Query: 126 YVSTANNIELPNSNTVWNLISGKILTPTTPIKL----VFKNANNILFERTIS-------- 173
                          +++             +L     F +      +R           
Sbjct: 123 LTGADGPDASSAGRPLFHSAQSSYQLADGQNELVVDLSFSHDGVNYIKRFTFHRGLKADC 182

Query: 174 -------------LDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNT----FGV 216
                         +  Y   +   + N S      +   ++ R      ++T       
Sbjct: 183 SDKEKAQKKIECINENAYQVGVSYLIDNQSGKTWSGNLFAQLKRDGSADPSSTTATGVST 242

Query: 217 QEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFK 276
             G      D    +    D++K           W+     Y+ + ++P+K        +
Sbjct: 243 YLGAAVWTPDSPYKKISTKDMDKEQFKE-SVQGGWVAWLQHYFVTAWVPTKGEQHQVMTR 301

Query: 277 YLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDW 336
              DG   Y   F+   +++  G  + T   L+AG K    +         P  E+ +D+
Sbjct: 302 --KDGQGNYIVGFTGPTLSVPAGSKVETDLTLYAGPKLQKHLKELS-----PGLELTVDY 354

Query: 337 GWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKI 396
           G+ +FIA+P+F L+ + ++L+GN+G +I+  TV +KL FFPL+   Y S A M+ + PK+
Sbjct: 355 GFLWFIAQPIFWLLQHIHSLIGNWGWSIIALTVLIKLAFFPLSAASYRSMARMRAVSPKM 414

Query: 397 DELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHA 456
             ++E+      Q + +AM++LYK   INPL GC PIL+Q+PVF ++Y V+  S+EMR A
Sbjct: 415 QAIKEQHGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLSLYWVLLESVEMRQA 473

Query: 457 PFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQ 516
           P+ GWI DL+  DP                     I PI+M  +M IQ  ++P P D  Q
Sbjct: 474 PWLGWITDLSVKDPFF-------------------ILPIVMGGTMLIQQMLNPTPPDPMQ 514

Query: 517 AMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           A ++  MP++F F    FPAGL++YW  +N +SI QQ  I +   A
Sbjct: 515 AKVMKLMPIIFTFFFLWFPAGLVLYWVVNNCLSIAQQWYITRKIEA 560


>gi|320331114|gb|EFW87085.1| putative inner membrane protein translocase component YidC
           [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330881912|gb|EGH16061.1| membrane protein insertase [Pseudomonas syringae pv. glycinea str.
           race 4]
          Length = 563

 Score =  346 bits (887), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 142/586 (24%), Positives = 233/586 (39%), Gaps = 54/586 (9%)

Query: 1   MERNWNYFVAIALSVIIVYA---WQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           M+      + +AL+++       W   Y    +   N                 + +A  
Sbjct: 1   MDI-KRTILIVALAIVTYVGVLKWNQDYGQAAMPTQNVAASTTAPGIPDTAAGTNGSASA 59

Query: 58  IDD-------------RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
                              A++    + +K   L  +I+  G     L L  Y       
Sbjct: 60  DVPSASATANTAAAPLETPAVASKDLIHVKTDVLDLAIDPVGGDVVQLRLPLYPRRQDRP 119

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIK----LVF 160
                L   +  +  + A+     T           V+                   L F
Sbjct: 120 DVPFQLF-DNGGERTFLAQSGLTGTNGPDARAAGRPVYTSTQKTYQLADGQDTMVVDLKF 178

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT----ATNTFGV 216
                   +R       Y   +   V N S      +   ++ R                
Sbjct: 179 SENGVNYIKRFTFKRGLYDLVMTYVVDNQSAQPWAGNLFAQLKRDASSDPSSTTATGTAT 238

Query: 217 QEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFK 276
             G       +   +    DI+K  I        W+     Y+ + +IP    +   Q +
Sbjct: 239 YLGAALWTAAEPYKKVSMKDIDKGQIKET-VQGGWVAWLQHYFVTAWIPDHNATNAVQTR 297

Query: 277 YLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDW 336
              D    Y   F++  +++ PG    T+  L+AG K    +         P  E+ +D+
Sbjct: 298 --KDSQGNYIIGFTSPTLSVAPGAQGETSATLYAGPKSQAVLKELS-----PGLELTVDY 350

Query: 337 GWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKI 396
           G+ +FIA+P+F L+ + + ++GN+G +I++ T+ +K LFFPL+   Y S A M+ + PK+
Sbjct: 351 GFLWFIAQPIFWLLQHIHAILGNWGWSIIVLTMLIKGLFFPLSAASYKSMARMRAVAPKL 410

Query: 397 DELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHA 456
             L+E+      Q + +AM++LYK   INPL GC PIL+Q+PVF ++Y V+  S+EMR A
Sbjct: 411 ALLKEQHGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLSLYWVLLESVEMRQA 469

Query: 457 PFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQ 516
           P+  WI DL+  DP                     I PIIM  +MFIQ +++P P D  Q
Sbjct: 470 PWILWITDLSIKDPFF-------------------ILPIIMGATMFIQQRLNPTPPDPMQ 510

Query: 517 AMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGA 562
           A ++  MP++F F    FPAGL++YW  +N +SI QQA I +   A
Sbjct: 511 AKVMKMMPIIFTFFFLWFPAGLVLYWVLNNTLSIAQQAYITRKIEA 556


>gi|227113120|ref|ZP_03826776.1| putative inner membrane protein translocase component YidC
           [Pectobacterium carotovorum subsp. brasiliensis PBR1692]
 gi|227328549|ref|ZP_03832573.1| putative inner membrane protein translocase component YidC
           [Pectobacterium carotovorum subsp. carotovorum WPP14]
          Length = 544

 Score =  346 bits (887), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 135/570 (23%), Positives = 246/570 (43%), Gaps = 51/570 (8%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL  +    WQ +             +        +  +          
Sbjct: 1   MDSQRNLLL-IALLFVTFMLWQAWETDKNPPATTQAIQQATNAVTGDATNQGVP------ 53

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
              A      + +K   L  +IN +G   +  +L  Y   + S+ P   L   + ++  Y
Sbjct: 54  ---ASGQGKLITVKTDVLSLTINTRGGDIEQAHLLAYPDTLGSDKPFHLL--ETTSEFVY 108

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL-----TPTTPIKLVFKNANNILFERTISLD 175
            A+             N        +              I + +  A+ + + +T  L 
Sbjct: 109 QAQSGLTGKNGPDNPANGPRPLFTTTQDSFELADGQSELRIPMTYTAADGVTYTKTFVLK 168

Query: 176 -EHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-----KPQTATNTFGVQEGFIAVLGDKSL 229
              Y   +  +V N S   +  +  G++ +         T ++ F +     A       
Sbjct: 169 RGDYALNVDYSVNNTSAQPLELTLFGQLKQSIELPKHRDTGSSNFALHTYRGAAFSSSED 228

Query: 230 VEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKF 289
             +KYS  +     N   +  W+ +  +Y+A+ +IP+   +    F     G+ +    F
Sbjct: 229 KYKKYSFSDMDENLNITTNGGWVAMLQQYFATAWIPTTAGANT--FYTSKLGNGQAAIGF 286

Query: 290 SANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFML 349
            +  + +  G        L+ G +    +         P  ++ +D+GW +FI++P+F L
Sbjct: 287 KSAPVVVAAGSQQDLKTTLWVGPEIQDKMAAVA-----PHLDLTVDYGWLWFISQPLFKL 341

Query: 350 MSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQ 409
           + + ++ +GN+G +I+  T  V+ + +PL K QY S A M+ +QPK+  +RE+      Q
Sbjct: 342 LKFLHSFIGNWGFSIIAITFIVRGIMYPLTKAQYTSMAKMRLLQPKLQAMRERIGDDK-Q 400

Query: 410 VLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAAD 469
            + + M+ LYK+  +NPL GC+P+L+Q+P+F A+Y ++  S+E+RHAPF  WI DL+A D
Sbjct: 401 RMSQEMMALYKSEKVNPLGGCFPLLIQMPIFLALYYMLMGSVELRHAPFALWIHDLSAQD 460

Query: 470 PTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFV 528
           P                     I PI+M ++MF   KMSP    D  Q  I+ +MPV+F 
Sbjct: 461 PYY-------------------ILPILMGVTMFFIQKMSPTTVTDPMQQKIMTYMPVIFT 501

Query: 529 FALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
                FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 502 VFFLWFPSGLVMYYIVSNLVTILQQQLIYR 531


>gi|89074709|ref|ZP_01161167.1| putative inner membrane protein translocase component YidC
           [Photobacterium sp. SKA34]
 gi|89049473|gb|EAR55034.1| putative inner membrane protein translocase component YidC
           [Photobacterium sp. SKA34]
          Length = 544

 Score =  346 bits (887), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 143/568 (25%), Positives = 238/568 (41%), Gaps = 38/568 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M    N  + IAL  +    +Q +      +  +       T        ++    L D 
Sbjct: 1   MGSQRN-ILLIALLFVSFLLFQQWNADKTPKPQSQGVAQQSTQSSDIPSHSAEGQPLTDQ 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
                S    + +K   L  +++  G    D  L  Y+  + S  P V L       + Y
Sbjct: 60  T----SSQNLITIKTDVLELTVDTLGGDVVDAKLLKYNNTLDSKDPFVLLNDTDG--HDY 113

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLV----FKNANNILFERTISLDE 176
            A+   +              +++ +   +      +L     F        +  +    
Sbjct: 114 IAQSGLIGPNGADSQQGGRAQYSVTAKDFVMGPEQNELRVPMTFTKDGINYTKTFVLKRN 173

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
            Y   +  TV NN+          ++      +  +         A   + +  ++   D
Sbjct: 174 DYAVNVDYTVANNTDKAASVQMYAQLRHKLSDSGGSLTMPTYLGGAYSANDTKYKKYSFD 233

Query: 237 IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITI 296
             K    +   +  W+ I   Y+ S +IP       SQ    +     +         T+
Sbjct: 234 DMKDKNLDVAANEGWVAIMQHYFVSAWIPRDGADQTSQVYSTTSNGNGF-IGVRMPIETV 292

Query: 297 LPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNL 356
            PG+S      L+ G K    +    K+       + +D+GW +FIA P+  L+S+ + L
Sbjct: 293 APGQSKAIKATLWVGPKLQNEMAATAKN-----LNLTVDYGWLWFIANPLHKLLSFIHGL 347

Query: 357 VGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMI 416
           VGN+GIAI++ T  V+   +PL K QY S A M+ +QPKI  +RE+      Q   + M+
Sbjct: 348 VGNWGIAIIILTFIVRGAMYPLTKAQYTSMAKMRMLQPKIQAMRERLGD-DRQRQSQEMM 406

Query: 417 QLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTL 476
           +LYK   +NPL GC PILLQ+P+F A+Y  +  S+E+RHAPF+GWI DL+A DP      
Sbjct: 407 ELYKKEKVNPLGGCLPILLQMPIFIALYWALMESVELRHAPFFGWIHDLSAQDPYY---- 462

Query: 477 FGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFP 535
                          + PI+M ++MF   KMSP    D  Q  I+ +MPV+F F    FP
Sbjct: 463 ---------------VLPILMGITMFFIQKMSPSTVTDPMQQKIMTFMPVMFTFFFLFFP 507

Query: 536 AGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           +GL++YW  SN+++++QQ +I +    +
Sbjct: 508 SGLVLYWLVSNIVTLIQQTIIFRALEKK 535


>gi|157368277|ref|YP_001476266.1| putative inner membrane protein translocase component YidC
           [Serratia proteamaculans 568]
 gi|166977412|sp|A8G7P8|OXAA_SERP5 RecName: Full=Inner membrane protein oxaA
 gi|157320041|gb|ABV39138.1| 60 kDa inner membrane insertion protein [Serratia proteamaculans
           568]
          Length = 545

 Score =  346 bits (886), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 138/570 (24%), Positives = 244/570 (42%), Gaps = 52/570 (9%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL  +    WQ +      + +    +         Q  N         
Sbjct: 1   MDSQRNLLL-IALLFVSFMIWQAWQTDNAPQPVAQTTQ---------QTSNPATGDAASS 50

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
              A      + +    L  +IN +G   +   L  Y   + S++P   L   +     Y
Sbjct: 51  AVPASGQGKLITVNTDVLSLTINTRGGDIEQAKLLAYPDTLGSSTPFQLL--ETTPAFVY 108

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILT-----PTTPIKLVFKNANNILFERTISLD 175
            A+             N        +    T         I L F   +  ++ +T  L 
Sbjct: 109 QAQSGLTGRNGPDNPANGERPLFQAAQDSYTLPEGQEELRIPLTFTGKDGAIYTKTFVLK 168

Query: 176 EHYL-FKIVDTVTNNSIDQIRFSPRGRIMRH-----KPQTATNTFGVQEGFIAVLGDKSL 229
            ++    +   V N S   +  +  G++ +         T +N F +     A       
Sbjct: 169 RNHYAVAVDYNVDNKSTTPLELTLFGQLKQTTELPKHRDTGSNNFALHTFRGAAYSSSDD 228

Query: 230 VEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKF 289
             QKY+  +K    +      W+ +  +Y+A+ ++P+  T   + F     G       F
Sbjct: 229 KYQKYA-FDKDENLSVTTQGGWVAMLQQYFATAWVPA--TQGSNTFYTAKPGDNLSTIGF 285

Query: 290 SANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFML 349
            +  + + PG        L+ G +    +         P  ++ +D+GW +FI++P+F L
Sbjct: 286 KSTPVVVQPGAQQQLNATLWVGPELQDQMAQLA-----PHLDLTVDYGWLWFISQPLFKL 340

Query: 350 MSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQ 409
           + + +  +GN+G +I++ T  V+ + +PL K QY S A M+ +QPK+  +RE+      Q
Sbjct: 341 LKFIHGFIGNWGFSIIIITFIVRGIMYPLTKAQYTSMAKMRMLQPKLQAMRERIGDDK-Q 399

Query: 410 VLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAAD 469
            + + M+ LYK+  +NPL GC P+++Q+P+F A+Y ++  S+E+RHAPF  WI DL+A D
Sbjct: 400 RMSQEMMALYKSEKVNPLGGCLPLVIQMPIFLALYYMLMGSVELRHAPFALWIHDLSAQD 459

Query: 470 PTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFV 528
           P                     I PI+M ++MF   KMSP    D  Q  I+ +MPV+F 
Sbjct: 460 PYY-------------------ILPILMGVTMFFIQKMSPTTVTDPMQQKIMTFMPVIFT 500

Query: 529 FALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
                FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 501 VFFLWFPSGLVLYYIVSNLVTILQQQLIYR 530


>gi|311281728|ref|YP_003943959.1| membrane protein insertase, YidC/Oxa1 family domain containing
           protein [Enterobacter cloacae SCF1]
 gi|308750923|gb|ADO50675.1| membrane protein insertase, YidC/Oxa1 family domain containing
           protein [Enterobacter cloacae SCF1]
          Length = 547

 Score =  346 bits (886), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 145/572 (25%), Positives = 255/572 (44%), Gaps = 54/572 (9%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL  +    WQ +           + KN Q  +Q  Q   + A    D 
Sbjct: 1   MDSQRNLLI-IALLFVSFMIWQAW----------EQDKNPQPQQQTTQTTTTAAGSAADQ 49

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
              A      + +K   L  +IN +G   +   L  Y  ++ SN P   L   +  +  Y
Sbjct: 50  GVPASGQGKLITVKTDVLDLTINTRGGDVEQAELLAYPKELGSNEPFQLL--ETTPQFIY 107

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL-----TPTTPIKLVFKNANNILFERTISLD 175
            A+             N       +               I L + +     F +T  L 
Sbjct: 108 QAQSGLTGRDGPDNPANGPRPLYSVDKDTFVLADGQNEISIPLTWTDKAGNTFTKTFVLK 167

Query: 176 -EHYLFKIVDTVTNNSIDQIRFSPRGRIMR-----HKPQTATNTFGVQEGFIAVLGDKS- 228
              Y   +  +V N+S   +  S  G++ +         T ++ F +     A       
Sbjct: 168 RGEYAVNVDYSVKNSSDKPLEISTFGQLKQSINLPTHRDTGSSNFALHTFRGAAYSTPDA 227

Query: 229 -LVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQA 287
              + K+  I  +   N    + W+ +  +Y+A+ ++P  + + +  F   + G+     
Sbjct: 228 KYEKYKFDTIADNENLNVSAKDGWVAMLQQYFATAWVPRNDGTNN--FYTANLGNGIAAI 285

Query: 288 KFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMF 347
            + +    I PG++ T  + L+ G +    +         P  ++ +D+GW +FI++P+F
Sbjct: 286 GYKSQPTLIQPGQTGTVGSTLWVGPEIQDKMAAVA-----PHLDLTVDYGWLWFISQPLF 340

Query: 348 MLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSP 407
            L+ + ++ +GN+G +I++ T  V+ + +PL K QY S A M+ +QPKI  +RE+     
Sbjct: 341 KLLKFIHSFLGNWGFSIIVITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGDDK 400

Query: 408 PQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAA 467
            Q   + M+ LYK   +NPL GC+P+++Q+P+F A+Y ++  S+E+RHAPF  WI DL+A
Sbjct: 401 -QRQSQEMMALYKAEKVNPLGGCFPLIIQMPIFLALYYMLMGSVELRHAPFALWIHDLSA 459

Query: 468 ADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVV 526
            DP                     I PI+M ++MF   KMSP    D  Q  I+ +MPV+
Sbjct: 460 QDPYY-------------------ILPILMGVTMFFIQKMSPTTVTDPMQQKIMTFMPVI 500

Query: 527 FVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           F      FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 501 FTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYR 532


>gi|292490140|ref|YP_003533035.1| inner membrane protein YidC [Erwinia amylovora CFBP1430]
 gi|292901144|ref|YP_003540513.1| inner membrane protein [Erwinia amylovora ATCC 49946]
 gi|291200992|emb|CBJ48131.1| inner membrane protein [Erwinia amylovora ATCC 49946]
 gi|291555582|emb|CBA24181.1| Inner membrane protein yidC [Erwinia amylovora CFBP1430]
 gi|312174333|emb|CBX82586.1| Inner membrane protein yidC [Erwinia amylovora ATCC BAA-2158]
          Length = 548

 Score =  346 bits (886), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 143/574 (24%), Positives = 243/574 (42%), Gaps = 57/574 (9%)

Query: 1   MERNWNYFV--AIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           M+   N F+   + +S +I  AWQ       ++    +          NQ          
Sbjct: 1   MDSQRNLFLIAFLFVSFMIWQAWQTDNAPQPLQTQTTQNTASAAGDAANQGVP------- 53

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
                A      + +K   L  +IN +G   D   L  Y   + S+ P   LL  S    
Sbjct: 54  -----ASGQGKTITVKTDVLSLNINTRGGDIDQAQLLTYPDKLDSDQPF--LLLESTPGF 106

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKIL-----TPTTPIKLVFKNANNILFERTIS 173
            Y A+             N        S              I L F   N   + +T  
Sbjct: 107 LYQAQSGLTGRNGPDNPANGTRPLYTSSQDHFELADGQSELRIPLTFTAENGASYTKTFV 166

Query: 174 LD-EHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-----KPQTATNTFGVQEGFIAVLGDK 227
           L    Y   +   + N +   +  S  G++ +         T ++ F +     A     
Sbjct: 167 LKRGEYAIGVDYQINNTTQQPLEVSMFGQLKQTIDLPKHRDTGSSNFALHTFRGAAYSSS 226

Query: 228 S--LVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARY 285
                + K+  I  +   +   +N W+ +  +Y+A+ ++P    S        + G+   
Sbjct: 227 ETNYEKYKFDTIRDNENLSTTTNNGWVAMLQQYFATAWVPQTAGSNT--LYTSNLGNGIA 284

Query: 286 QAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKP 345
              + +  +TI  G        L+ G +    +         P  ++ +D+GW +FI++P
Sbjct: 285 AIGYKSAPVTIAAGSRQQLAATLWVGPEIQDKMAAVA-----PHLDLTVDYGWLWFISQP 339

Query: 346 MFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQ 405
           +F L+ + +  +GN+G +I++ T  V+ + +PL K QY S A M+ +QPKI  +RE+   
Sbjct: 340 LFKLLKFLHGFIGNWGFSIIVITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGD 399

Query: 406 SPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDL 465
              Q + + M+ LYK   +NPL GC P+++Q+P+F A+Y ++  S+E+RHAPF  WI DL
Sbjct: 400 DK-QRMSQEMMALYKAEKVNPLGGCLPLVIQMPIFLALYYMLMGSVELRHAPFALWIHDL 458

Query: 466 AAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMP 524
           AA DP                     I PI+M ++MF   KMSP    D  Q  I+ +MP
Sbjct: 459 AAQDPYY-------------------ILPILMGVTMFFIQKMSPTTVTDPMQQKIMTFMP 499

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           V+F      FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 500 VIFTVFFLWFPSGLVLYYIVSNLVTILQQQLIYR 533


>gi|157964068|ref|YP_001504102.1| 60 kDa inner membrane insertion protein [Shewanella pealeana ATCC
           700345]
 gi|189036363|sp|A8HAI0|OXAA_SHEPA RecName: Full=Inner membrane protein oxaA
 gi|157849068|gb|ABV89567.1| 60 kDa inner membrane insertion protein [Shewanella pealeana ATCC
           700345]
          Length = 545

 Score =  346 bits (886), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 137/566 (24%), Positives = 237/566 (41%), Gaps = 39/566 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVY--PRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           ME   N  + I L  +    WQ +     P+       + +I      +   +       
Sbjct: 1   MESQRN-ILLIGLLFVSFLLWQQWQADKAPQPVAAAQTQSSIPASTVADAHSSDVPDADS 59

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
                  +    + +    L   I+  G       L  + L+   + P V L   ++   
Sbjct: 60  AVPEATPASKELITVITDQLEIKIDPVGGDIVYSALLSHKLEEKGDDPFVLLEQTNDIY- 118

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLV----FKNANNILFERTISL 174
            Y A+   +              ++  S +         L     + +   + + +    
Sbjct: 119 -YIAQSGLIGRDGIDSSVKGRAHFDSASREYKLADGQETLNVPLTYVSDKGVAYTKVFVF 177

Query: 175 -DEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQK 233
               Y   +   + N S  Q++    G+I     ++ ++         A     +  E+ 
Sbjct: 178 TRGKYNIAVDYKINNTSDAQLQVQMYGQIKHSIKKSESSMMMPTYRGGAFSTADTRYEKY 237

Query: 234 YSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANE 293
             D       +      W+ +   Y+ S ++P             + G A     F    
Sbjct: 238 SFDDMADKNLDKSTLGGWVAMLQHYFVSAWVPPANDKNIIFSSVSAGGLAN--IGFRGAL 295

Query: 294 ITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYF 353
             I PG   +     + G K+   +         P   +++D+G+ +++A P++ L+ +F
Sbjct: 296 YDIAPGTEQSIKAEFYVGPKDQEALSALS-----PSLNLVVDYGFLWWLAVPIYKLLMFF 350

Query: 354 YNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQK 413
            ++VGN+GIAI+L T+ V+ + +PL K QY S A M+N+QPK+ EL+E+F     Q + +
Sbjct: 351 QSIVGNWGIAIILITLTVRGMLYPLTKAQYTSMAKMRNLQPKLAELKERFGD-DRQKMGQ 409

Query: 414 AMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNI 473
           AM++LYK   +NP+ GC PILLQ+P+F A+Y V+  S+E+RHAPF  WI DL+  DP   
Sbjct: 410 AMMELYKKEKVNPMGGCLPILLQMPIFIALYWVLLESVELRHAPFMLWITDLSVQDPYY- 468

Query: 474 FTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSP--PPADKGQAMILNWMPVVFVFAL 531
                             + PI+M +SMF+  KM P  P  D  Q  ++ WMPV+F    
Sbjct: 469 ------------------VMPILMGISMFVMQKMQPMAPTMDPMQVKMMQWMPVIFTVFF 510

Query: 532 SSFPAGLIIYWSWSNVISIVQQAVIM 557
             FPAGL++YW   N+++I QQ +I 
Sbjct: 511 LWFPAGLVLYWLVGNLVAITQQKIIY 536


>gi|308051501|ref|YP_003915067.1| protein translocase subunit yidC [Ferrimonas balearica DSM 9799]
 gi|307633691|gb|ADN77993.1| protein translocase subunit yidC [Ferrimonas balearica DSM 9799]
          Length = 539

 Score =  346 bits (886), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 136/565 (24%), Positives = 244/565 (43%), Gaps = 39/565 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + I L  +    WQ + +    +      + + T  + N V  S A      
Sbjct: 1   MDSQRNLIL-IGLLFVSFLLWQQWTLDQAPQAETPAAQTVATADKANDVPQSAAKSAAPA 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
            A        ++++  +L  +I+  G       L  + ++   +  +  L + +     Y
Sbjct: 60  GATI--SDRLIQVQTDTLKLTIDATGGDVVYAALPEHKVEQGGDEALTILENENG--FTY 115

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPI---KLVFKNANNILFERTISL-DE 176
            A+   +                  +   L          L+F +AN + FE+  +    
Sbjct: 116 IAQSGLIGLNGPHASGQRPVYQAQAANYTLQDGQDTLVVPLIFTDANGVKFEKRYTFTRG 175

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
           HY  ++   V N S   I+     ++ +   ++  +         A     +  E+   D
Sbjct: 176 HYDVRVDYLVHNTSDAAIQVQMYSQLKQSIGKSEGSMMMPTYRGGAYSTADTRYEKYAFD 235

Query: 237 IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITI 296
             + +         W+ +   Y+ S ++PS +++      Y +              + I
Sbjct: 236 KMEKNNLAEATQGGWIAMLQHYFVSAWVPSADSTNDI---YSNVVSGDAIIGVKQPAVQI 292

Query: 297 LPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNL 356
            PG   T    L+ G K    +         P   +++D+GW +FIA+P+  L+ +  +L
Sbjct: 293 APGAEQTLGATLYVGPKNQEALSALS-----PTLNLVVDYGWLWFIAQPLHSLLMFLQSL 347

Query: 357 VGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMI 416
           V N+G+AI+L T+ ++   +PL K QY S A M+ +QPK+ +L+E+F     Q + +AM+
Sbjct: 348 VSNWGVAIILMTLIIRGFMYPLTKAQYTSMAKMRKLQPKLADLKERFGD-DRQRMSQAMM 406

Query: 417 QLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTL 476
           +LY+   +NP+ GC P+LLQ P+F A Y V+  S+E+RHAPF+GWI DL+  DP      
Sbjct: 407 ELYQKEKVNPMGGCLPLLLQFPIFIAFYWVLLESVELRHAPFFGWITDLSVKDPYY---- 462

Query: 477 FGILPFYLPGFMHVGIWPIIMSLSMFIQMKM--SPPPADKGQAMILNWMPVVFVFALSSF 534
                          + P++M +SMF   KM  +    D  Q  I+ +MPV+F      F
Sbjct: 463 ---------------VLPVLMGISMFAMQKMQPTMATMDPMQQKIMQYMPVMFTVFFLWF 507

Query: 535 PAGLIIYWSWSNVISIVQQAVIMKM 559
           P+GL++YW   N+++I QQ  I + 
Sbjct: 508 PSGLVLYWLVGNLVAIAQQLFIYRS 532


>gi|259910298|ref|YP_002650654.1| putative inner membrane protein translocase component YidC [Erwinia
           pyrifoliae Ep1/96]
 gi|224965920|emb|CAX57453.1| Inner membrane protein OxaA [Erwinia pyrifoliae Ep1/96]
 gi|283480422|emb|CAY76338.1| Inner membrane protein yidC [Erwinia pyrifoliae DSM 12163]
 gi|310765879|gb|ADP10829.1| putative inner membrane protein translocase component YidC [Erwinia
           sp. Ejp617]
          Length = 548

 Score =  345 bits (885), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 144/574 (25%), Positives = 243/574 (42%), Gaps = 57/574 (9%)

Query: 1   MERNWNYFV--AIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           M+   N F+   + +S +I  AWQ       ++    +          NQ          
Sbjct: 1   MDSQRNLFLIAFLFVSFMIWQAWQTDNAPQPLQTQTTQNTASAAGDAANQGVP------- 53

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
                A      + +K   L  +IN +G   D   L  Y   + S+ P   LL  S    
Sbjct: 54  -----ASGQGKTITVKTDVLSLNINTRGGDIDQAQLLTYPDKLGSDQPF--LLLESTPGF 106

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKIL-----TPTTPIKLVFKNANNILFERTIS 173
            Y A+             N        S              I L F   N   + +T  
Sbjct: 107 LYQAQSGLTGRNGPDNPANGARPLYTSSQDHFELADGQSELRIPLTFTAENGATYTKTFV 166

Query: 174 LD-EHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-----KPQTATNTFGVQEGFIAVLGDK 227
           L    Y   +   + N +   +  S  G++ +         T ++ F +     A     
Sbjct: 167 LKRGEYAIGVDYQINNTTQQPLEVSMFGQLKQTIDLPKHRDTGSSNFALHTFRGAAYSSS 226

Query: 228 S--LVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARY 285
                + K+  I  +   +   SN W+ +  +Y+A+ ++P    S        + G+   
Sbjct: 227 ETNYEKYKFDTISDNENLSTTTSNGWVAMLQQYFATAWVPQTAGSNT--LYTSNLGNGIA 284

Query: 286 QAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKP 345
              + +  +TI  G        L+ G +    +         P  ++ +D+GW +FI++P
Sbjct: 285 AIGYKSAPVTIAAGSQQQLAATLWVGPEIQDRMAAVA-----PHLDLTVDYGWLWFISQP 339

Query: 346 MFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQ 405
           +F L+ + +  +GN+G +I++ T  V+ + +PL K QY S A M+ +QPKI  +RE+   
Sbjct: 340 LFKLLKFLHGFIGNWGFSIIVITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGD 399

Query: 406 SPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDL 465
              Q + + M+ LYK   +NPL GC P+++Q+P+F A+Y ++  S+E+RHAPF  WI DL
Sbjct: 400 DK-QRMSQEMMALYKAEKVNPLGGCLPLVIQMPIFLALYYMLMGSVELRHAPFALWIHDL 458

Query: 466 AAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMP 524
           AA DP                     I PI+M ++MF   KMSP    D  Q  I+ +MP
Sbjct: 459 AAQDPYY-------------------ILPILMGVTMFFIQKMSPTTVTDPMQQKIMTFMP 499

Query: 525 VVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           V+F      FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 500 VIFTVFFLWFPSGLVLYYIVSNLVTILQQQLIYR 533


>gi|90023654|ref|YP_529481.1| protein translocase subunit yidC [Saccharophagus degradans 2-40]
 gi|122995696|sp|Q21DG0|OXAA_SACD2 RecName: Full=Inner membrane protein oxaA
 gi|89953254|gb|ABD83269.1| protein translocase subunit yidC [Saccharophagus degradans 2-40]
          Length = 557

 Score =  345 bits (885), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 142/579 (24%), Positives = 248/579 (42%), Gaps = 49/579 (8%)

Query: 1   MERNWNYFVAIAL--SVIIVYAWQNFYVYPRIEEMNNERKNIQT---------------V 43
           M    N  +A  L  + ++   W  F    ++  + N+   + T                
Sbjct: 1   MNWLRNSLIAAILVITYVLFIRWNEFSERQQVPTIANQPAAVTTPAYEAVPSDDAVASSA 60

Query: 44  KQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSS 103
            + + V     +       +A+     V +K   L   I+  G     + L  +  D + 
Sbjct: 61  TEESDVPEVSVSAEPVAAPKAVYQPKLVTVKTDVLEVQIDTNGGDVLQVVLLKHLADKAD 120

Query: 104 NSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIK---LVF 160
           ++    L++  N+ + Y A                   +++        +       L  
Sbjct: 121 DNQPFVLMT-QNSAHTYVARSGLAGGNGPDGAKKGRAKYSVAKTNYSLNSDDQVVVDLTL 179

Query: 161 KNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGF 220
              N  + +R       YL  +   +TN +         G+I+R   + +    G++   
Sbjct: 180 DQENAQITKRFTFTKSSYLIDVEYIITNRADTPWAAKLYGQIIRDGSEPSYGYMGMRPYL 239

Query: 221 IAVLGDKSLVEQKY-SDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLS 279
            A +    +  +K   D          +   W+ +   Y+ S +IP K+ +   +    S
Sbjct: 240 GAAITTPEVNYEKVSFDDMDDGPFKVEQKGGWVSLIQHYFISAWIPPKDATNSYELSKSS 299

Query: 280 DGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWF 339
            G   Y  +F +   T+ P    T     +AG K    +         P  ++ ID+ + 
Sbjct: 300 KG--NYVLRFISETTTVAPHSVGTVKAGFYAGPKNIRRLEEIS-----PHLDLTIDYSFL 352

Query: 340 YFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDEL 399
           +FIAKP+F  + + + LVGN+G+AI+L TV +K +FF  +   Y S A M+ +QP + EL
Sbjct: 353 WFIAKPLFFALDFIHGLVGNWGVAIILLTVLIKAVFFYPSAMSYRSMAKMRKLQPMMAEL 412

Query: 400 REKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFW 459
           +E++     Q +   +++LYK   +NP  GC PILLQ+PVF ++Y +I  S+E+RH PF+
Sbjct: 413 KERY-GEDKQKMSGELMKLYKKEKVNPFGGCLPILLQMPVFISLYWMIMESVELRHQPFF 471

Query: 460 GWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMI 519
            WI+DL+  DP                     I P++M ++M+IQ K++P P D  QA +
Sbjct: 472 LWIQDLSVKDPLF-------------------ILPLLMGVTMYIQQKLNPTPPDPMQAKV 512

Query: 520 LNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
           +  MP+ F F    FPAGL++YW  +N +SI QQ VI +
Sbjct: 513 MQMMPIGFTFLFMFFPAGLVLYWVVNNTLSISQQYVITR 551


>gi|237747151|ref|ZP_04577631.1| preprotein translocase YidC subunit [Oxalobacter formigenes HOxBLS]
 gi|229378502|gb|EEO28593.1| preprotein translocase YidC subunit [Oxalobacter formigenes HOxBLS]
          Length = 557

 Score =  345 bits (885), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 156/578 (26%), Positives = 248/578 (42%), Gaps = 46/578 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFY-------------VYPRIEEMNNERKNIQTVKQPN 47
           M+      + + L++ +   W N+                     +      + T   P 
Sbjct: 1   MDTKKRTTLLLILAISLFMLWDNWQVYRGGTSLIFQHEAKKTDSNVALPEVPVDTAVVPG 60

Query: 48  QVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPI 107
           +       V    +      +  V +    L   IN +G  F +L L  Y  +V     +
Sbjct: 61  EAGTPATPVAEVMKEAPKKQAELVTVTTDVLKVQINSEGGVFQNLELLKYPDNVDPEKDM 120

Query: 108 VTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNIL 167
           +  L  S     Y A+                      S         + +  +     L
Sbjct: 121 I--LFESVPPRIYLAQTGLTGGVYPNHATRFTVHPGERSLADGKDEVKLVMDAERDGVRL 178

Query: 168 FERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRH--KPQTATNTFGVQEGFIAVLG 225
            +        Y+  +   VTN + + I  S   +++R   +P+  +       G      
Sbjct: 179 TKTYTFKRGSYVVDVDQKVTNLTNEPIDASLYLQLLRDSSRPEGQSRFISTFTGPAVYTQ 238

Query: 226 DKSLVEQKYSDIEKSS--ISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
                + K+ DI ++          N W+ I   Y+ S FIP  +    +  K +  G  
Sbjct: 239 ADKFQKLKFDDITETKGADHATKADNGWIAIVQHYFVSAFIPKDKVERENYTKKV--GED 296

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
            Y         TI P  S +  + L+AG +E   +         P  E++ D+GW   IA
Sbjct: 297 LYAIGTVIPLGTIAPKASASNDSRLYAGPQESIILEQTA-----PGLELVKDYGWLTIIA 351

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           KP+F LM++ +  VGN+G  I+L T  +KL+F PL+   Y S A MK   P+I ELR+++
Sbjct: 352 KPIFWLMTHIHKEVGNWGWTIILLTCLIKLVFLPLSAASYKSMARMKQFTPRIQELRDRY 411

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
           K    Q + + ++ LYK   INPL GC P+++QIPVF ++Y V+  S+E+R+AP+ GWI+
Sbjct: 412 KDDK-QRMNQELMALYKAEKINPLGGCLPVVVQIPVFISLYWVLLASVEIRNAPWLGWIQ 470

Query: 464 DLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWM 523
           +LAA DP                     I PIIM+ SMFIQ KMSPPP D  QA ++ ++
Sbjct: 471 NLAAPDPFY-------------------ILPIIMAGSMFIQQKMSPPPPDPLQAKLMMFL 511

Query: 524 PVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHG 561
           P+VF      FP+GL++YW  +N++SI QQ  I K +G
Sbjct: 512 PIVFSITFFFFPSGLVLYWVVNNLLSIAQQYWINKRYG 549


>gi|90413740|ref|ZP_01221728.1| putative inner membrane protein translocase component YidC
           [Photobacterium profundum 3TCK]
 gi|90325209|gb|EAS41706.1| putative inner membrane protein translocase component YidC
           [Photobacterium profundum 3TCK]
          Length = 538

 Score =  345 bits (885), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 137/569 (24%), Positives = 241/569 (42%), Gaps = 42/569 (7%)

Query: 1   MERNWNYFVAIAL--SVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           M+   N  +   L  S ++   W      P+ +    E++   +   P+   +       
Sbjct: 1   MDSQRNILLIALLFVSFLLFQQWNMD-NSPQPQGQGTEQQVNNSGDVPSHSGDGQPI--- 56

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
               Q  +    + +    L  S++  G    +  L  Y  ++ S  P + L       +
Sbjct: 57  --PDQETTSKDVITINTDVLALSVDTLGGDVTEAKLLAYDNELDSADPFILL--KDEAGH 112

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPI---KLVFKNANNILFERTISLD 175
           +Y A+   +             +        L          + +        +  +   
Sbjct: 113 SYIAQSGLIGANGIDSANGRAQLAVTAKDFTLADGQDELRVPMTYVKDGITYTKTFVLKR 172

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
             Y   +  T+ N S          ++ ++     ++         A   D +  ++   
Sbjct: 173 NSYAVDVEYTIDNQSASAASVQMYAQLRQNLMDDGSSLTMPTYRGGAYSTDTTNYKKYSF 232

Query: 236 DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
           D  +    N   +N W  +   Y+ S +IP  E + +   +  +    +          T
Sbjct: 233 DDMQDKSLNMTTTNGWAAMLQHYFVSAWIPRSEEASNLFTRASNG---QGYIGVRLPTTT 289

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           I  G   T T+ L+ G K    +     +       + +D+GW +FIA P+  L+S+  +
Sbjct: 290 IAAGTEQTITSTLWVGPKLQKEMEATAAN-----LNLTVDYGWLWFIASPLHKLLSFIQS 344

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
           +VGN+GIAIM+ T  V+   +PL K QY S A M+ +QPK+  +RE+      Q + + M
Sbjct: 345 IVGNWGIAIMMLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLTAMRERLGD-DRQRMSQEM 403

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           ++LYK   +NPL GC PI+LQ+P+F A+Y  +  S+E+RH+PF+GWI DL+A DP     
Sbjct: 404 MELYKKEKVNPLGGCLPIVLQMPIFIALYWSLMESVELRHSPFFGWIHDLSAQDPYY--- 460

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSF 534
                           I P++M +SMF+  KMSP    D  Q  I+ +MPV+F F    F
Sbjct: 461 ----------------ILPLLMGVSMFMIQKMSPTTVTDPMQQKIMTFMPVMFTFFFLWF 504

Query: 535 PAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           P+GL++YW  SNV++++QQ +I +    +
Sbjct: 505 PSGLVLYWLVSNVVTLIQQTLIYRSLEKK 533


>gi|156936084|ref|YP_001440000.1| putative inner membrane protein translocase component YidC
           [Cronobacter sakazakii ATCC BAA-894]
 gi|166975864|sp|A7MN02|OXAA_ENTS8 RecName: Full=Inner membrane protein oxaA
 gi|156534338|gb|ABU79164.1| hypothetical protein ESA_03978 [Cronobacter sakazakii ATCC BAA-894]
          Length = 550

 Score =  345 bits (884), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 146/592 (24%), Positives = 254/592 (42%), Gaps = 55/592 (9%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  V IAL  +    WQ +           ++     V+Q  Q   + A      
Sbjct: 1   MDSQRNLLV-IALLFVSFMIWQTW---------EQDKAPKPQVQQTTQTTTTAAGSAASQ 50

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
              A      + +K   L  +IN +G   +   L  Y  ++ S+ P   L +  N     
Sbjct: 51  GVPASGQGKLITVKTDVLSLTINTRGGDIEQALLLAYPKELGSSEPFQLLETTPNFVYQA 110

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLD- 175
            + L   +  +N        ++N      +         I + F +     F +T +L  
Sbjct: 111 QSGLTGRNGPDNPNNNKGRPLYNTERDTYVLADGQDELVIPMTFTDEAGNAFTKTFALKR 170

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-----KPQTATNTFGVQEGFIAVLGDKS-- 228
             Y   +   V N     +  S  G++ +         T ++ F +     A        
Sbjct: 171 GQYAVYVGYDVKNAGTQPLEISSFGQLKQTIDLPSHRDTGSSNFALHTFRGAAYSTPDEK 230

Query: 229 LVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAK 288
             + K+  I      N +    W+ +  +Y+A+ ++P+      S F     GH      
Sbjct: 231 YEKYKFDTIADDENLNVNAKGGWVAMLQQYFATAWVPASN--VTSNFYTADLGHGVAAIG 288

Query: 289 FSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFM 348
           + +  + + PG++    + L+ G +    +         P  ++ +D+GW +FI++P+F 
Sbjct: 289 YKSEPVQVQPGQTAKLASTLWVGPEIQDKMAQVA-----PHLDLTVDYGWLWFISQPLFK 343

Query: 349 LMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPP 408
           L+ + ++ +GN+G +I+  T  V+ + +PL K QY S A M+ +QPKI  +RE+      
Sbjct: 344 LLKWIHSFLGNWGFSIIAITFIVRGVMYPLTKAQYTSMAKMRLLQPKIQAMRERLGDDK- 402

Query: 409 QVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAA 468
           Q + + M+ LYK   +NPL GC+P+L+Q+P+F A+Y ++  S+E+RHAPF  WI DL+A 
Sbjct: 403 QRMSQEMMALYKAEKVNPLGGCFPLLIQMPIFLALYYMLMGSVELRHAPFALWIHDLSAQ 462

Query: 469 DPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVF 527
           DP                     I PI+M  +MF   KMSP    D  Q  I+ +MPV+F
Sbjct: 463 DPYY-------------------ILPILMGATMFFIQKMSPTTVTDPMQQKIMTFMPVIF 503

Query: 528 VFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYN 579
                 FP+GL++Y+  SN+++I+QQ +I +           L S   K   
Sbjct: 504 TVFFLWFPSGLVLYYIVSNLVTILQQQLIYRGLEKR-----GLHSREKKKKA 550


>gi|237749310|ref|ZP_04579790.1| preprotein translocase YidC subunit [Oxalobacter formigenes OXCC13]
 gi|229380672|gb|EEO30763.1| preprotein translocase YidC subunit [Oxalobacter formigenes OXCC13]
          Length = 559

 Score =  345 bits (884), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 160/580 (27%), Positives = 255/580 (43%), Gaps = 48/580 (8%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNF----------YVYPRIEEMNNERKNIQTVKQPNQVD 50
           ME      + + L+V + + W N+          +   + ++   +    +   Q   V 
Sbjct: 1   MEAKKRTTLLLILAVSLFFLWDNWQVYRGGKSLIFTQEKAKKSETQTGLPEVPVQTASVT 60

Query: 51  NSYAAVLIDDRAQALSMSPR------VELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
                      A A    P+      V +        IN  G  F +L L  Y  +V S 
Sbjct: 61  AEENPAADASNAVAKKEEPKKQPVELVSITTDVFKVQINPDGGVFQNLELLKYPDNVDST 120

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
             +V  L  S     Y A+               +      +    +    + +  +   
Sbjct: 121 KDMV--LFESAPPRIYLAQTGLTGGLYPNHATRFHIRPGERTLGENSDEVKLVMDAEQDG 178

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRH--KPQTATNTFGVQEGFIA 222
             L +        Y+  +   VTN S + I  S   +++R   +P+  +       G   
Sbjct: 179 VRLTKTYTFKRGSYVIDVDQKVTNLSHEPINASLYLQLLRDSERPEGQSRFISTFTGPAV 238

Query: 223 VLGDKSLVEQKYSDIEKSSISN-FHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDG 281
              +    + K+ +I +  + +     N W+G+   Y+ S FIP  + +  +  K +  G
Sbjct: 239 YSEEDKFQKIKFDNIGEGKMDHAIKTDNGWVGMVQHYFVSAFIPQDKVARENYTKKV--G 296

Query: 282 HARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYF 341
              Y         TI P  S +    L+ G +E   +         P  E++ D+GW   
Sbjct: 297 ENLYAIGTVIPLGTIAPNASASNDTRLYVGPQESKLLEKTA-----PGLELVKDYGWLTI 351

Query: 342 IAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELRE 401
           IAKP+F LM++ +N VGN+G  I+L T  +KL+F PL+   Y S A MK   P+I ELRE
Sbjct: 352 IAKPIFWLMTHIHNEVGNWGWTIILLTCLIKLIFAPLSAASYRSMAKMKQFTPRITELRE 411

Query: 402 KFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGW 461
           ++K    Q + K ++ LYK   INPL GC P+++QIPVF ++Y V+  S+E+R+AP+ GW
Sbjct: 412 RYKDDK-QRMNKELMGLYKAEKINPLGGCLPVVIQIPVFISLYWVLLASVEIRNAPWLGW 470

Query: 462 IKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILN 521
           I++LAA DP                     I PIIM+ SMFIQ KMSPPP D  QA ++ 
Sbjct: 471 IQNLAAPDPYY-------------------ILPIIMAGSMFIQQKMSPPPPDPMQAKMMM 511

Query: 522 WMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHG 561
           ++P+ F      FP+GL++YW  +N++SI QQ  I K + 
Sbjct: 512 FLPIAFSITFFFFPSGLVLYWVVNNLLSIAQQYWITKKYD 551


>gi|242241427|ref|YP_002989608.1| inner membrane protein translocase component YidC [Dickeya dadantii
           Ech703]
 gi|242133484|gb|ACS87786.1| 60 kDa inner membrane insertion protein [Dickeya dadantii Ech703]
          Length = 543

 Score =  345 bits (884), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 149/570 (26%), Positives = 252/570 (44%), Gaps = 52/570 (9%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL  +    WQ +      E            +Q N      A+  +  
Sbjct: 1   MDSQRNLLI-IALLFVTFMIWQQW------ETDKTPPAATPITQQANNTVGDAASQGVP- 52

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
              A      + +K   L  +IN +G   ++ +L  Y  D+ S  P   L   +     Y
Sbjct: 53  ---ASGQGKLITVKTDVLSLTINTRGGDIEEADLLAYPADLGSKQPFKLL--ETTQAFTY 107

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL-----TPTTPIKLVFKNANNILFERTISLD 175
            A+             N +      +              I L + +AN I + +T +L 
Sbjct: 108 QAQSGLTGKNGPDNPANGSRPLFSATQDHFELADGQNDIRIPLTYTDANGISYTKTFALK 167

Query: 176 -EHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-----KPQTATNTFGVQEGFIAVLGDKSL 229
              Y   +   V N S   +  +  G++ +         T +N F +     A L     
Sbjct: 168 RGEYALNVEYGVNNTSAQPLELTLFGQLKQSIDLPSHRDTGSNNFALHTYRGAALSSSDD 227

Query: 230 VEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKF 289
             +KYS  +     N      W+ +  +Y+AS +IP+   +    F   + G+      F
Sbjct: 228 KYRKYSFSDMKENLNVATQGGWVAMLQQYFASAWIPAAGGANT--FYTSNLGNGLAAIGF 285

Query: 290 SANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFML 349
            A  + + PG   T    L+ G +    +         P  ++ +D+GW +FI++P+F L
Sbjct: 286 KATPVIVQPGSQQTLGATLWVGPEIQDKMAAVA-----PHLDLTVDYGWLWFISQPLFKL 340

Query: 350 MSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQ 409
           + + ++ +GN+G +I+  T  V+ + +PL K QY S A M+ +QPK+  +RE+      Q
Sbjct: 341 LKFLHSFIGNWGFSIIAITFIVRGIMYPLTKAQYTSMAKMRMLQPKLQAMRERIGDDK-Q 399

Query: 410 VLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAAD 469
            + + M+ LYK   +NPL GC+P+++Q+P+F A+Y ++  S+E+RHAPF  WI DL+A D
Sbjct: 400 RMSQEMMALYKAEKVNPLGGCFPLVIQMPIFLALYYMLMGSVELRHAPFALWIHDLSAQD 459

Query: 470 PTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFV 528
           P                     + PI+M L+MF   KMSP    D  Q  I+ +MPV+F 
Sbjct: 460 PYY-------------------VLPILMGLTMFFIQKMSPTTVTDPMQQKIMTYMPVMFT 500

Query: 529 FALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
                FP+GL++Y+  SN+++IVQQ +I +
Sbjct: 501 VFFLWFPSGLVLYYIVSNLVTIVQQQLIYR 530


>gi|127514791|ref|YP_001095988.1| 60 kDa inner membrane insertion protein [Shewanella loihica PV-4]
 gi|166977416|sp|A3QJT1|OXAA_SHELP RecName: Full=Inner membrane protein oxaA
 gi|126640086|gb|ABO25729.1| protein translocase subunit yidC [Shewanella loihica PV-4]
          Length = 542

 Score =  345 bits (883), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 137/564 (24%), Positives = 239/564 (42%), Gaps = 38/564 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           ME   N  + I L  +    WQ +      + +  E   + +        +   A     
Sbjct: 1   MESQRN-ILLIGLLFVSFLLWQQWQTDKNPQPVATESSVVASTVTDAHSADVPDADAALP 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
            A A S    + +    L   IN  G       L G+ L+     P V L    +    Y
Sbjct: 60  EAVAASK-ELISVTTDQLTLKINPVGGDIVYSALVGHKLEQDKEEPFVLLQQTKDIY--Y 116

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLD- 175
            ++   +              ++  S          T  I L +   N + + +  +L  
Sbjct: 117 ISQSGLIGRNGIDSSTKGRAHFSSQSQAYTLADGQDTLEIPLTYVADNGVTYTKVFTLHR 176

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
             +   +   + N S +Q++    G+I     ++ ++         A     +  E+   
Sbjct: 177 GKFDVGVEYRINNTSAEQLQVQMYGQIKHSIKKSESSMMMPTYRGAAFSTADTRYEKYSF 236

Query: 236 DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
           +       +      W  +   Y+ S ++P             + G A     F      
Sbjct: 237 EDMADKNLDKKTLGGWAAMLQHYFVSAWVPPANDQNTIFSSVSAGGLAN--IGFRGAVYD 294

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           + PG   T +   + G K+   +    +        +++D+G+ +++A P+  L+ ++ +
Sbjct: 295 VAPGTQQTISAQFYVGPKDQEALSAISES-----LNLVVDYGFLWWLAIPIHWLLMFYQS 349

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
            VGN+G+AI+L T+ V+ + +PL K QY S A M+N+QPK+ +++E+F     Q + +AM
Sbjct: 350 FVGNWGVAIILITLTVRGMLYPLTKAQYTSMAKMRNLQPKLQDMKERFGD-DRQKMGQAM 408

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           ++LYK   +NP+ GC PILLQ+P+F A+Y V+  S E+RHAPF  WI DL+  DP     
Sbjct: 409 MELYKKEKVNPMGGCLPILLQMPIFIALYWVLLESYELRHAPFMLWITDLSVQDPYY--- 465

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSP--PPADKGQAMILNWMPVVFVFALSS 533
                           + P++M +SMF+  KM P  P  D  Q  ++ WMPV+F      
Sbjct: 466 ----------------VLPLLMGVSMFLMQKMQPMAPTMDPMQQKMMQWMPVIFTVFFLW 509

Query: 534 FPAGLIIYWSWSNVISIVQQAVIM 557
           FPAGL++YW   N+++I QQ +I 
Sbjct: 510 FPAGLVLYWLVGNLVAITQQKIIY 533


>gi|160877622|ref|YP_001556938.1| 60 kDa inner membrane insertion protein [Shewanella baltica OS195]
 gi|189036361|sp|A9KX20|OXAA_SHEB9 RecName: Full=Inner membrane protein oxaA
 gi|160863144|gb|ABX51678.1| 60 kDa inner membrane insertion protein [Shewanella baltica OS195]
 gi|315269821|gb|ADT96674.1| membrane protein insertase, YidC/Oxa1 family domain containing
           [Shewanella baltica OS678]
          Length = 541

 Score =  345 bits (883), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 141/564 (25%), Positives = 239/564 (42%), Gaps = 39/564 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           ME   N  + I L  +    WQ +      + +  E   +      +  D   A   +  
Sbjct: 1   MESQRN-ILLIGLLFVSFLLWQQWQADKAPKPVATESSLVANAANSHSADVPEADTGVP- 58

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
            A   + S  + +K   L   IN  G       L  + ++   + P V L    +    Y
Sbjct: 59  -AAVTATSKLITVKTDQLDVQINPIGGDIVFAALVSHKMEQDKDQPFVLLEQTKD--FTY 115

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLD- 175
            A+   +              ++  + +        T  + L +   N + + +      
Sbjct: 116 IAQSGLIGRDGIDSSAKGRAAFSTAATEYTLAEGQDTLEVPLTYVADNGVTYTKVFVFHR 175

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
             +   +   + N S   ++    G+I +    + ++         A        E+   
Sbjct: 176 GKFNVDVDYKINNTSAAPLQVQMYGQIKQTIKPSESSMVMPTYRGGAFSTQDVRYEKYKF 235

Query: 236 DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
           D    S  N      W  +   Y+ S +IP    S        + G A     F      
Sbjct: 236 DDMAKSNLNQATLGGWAAMLQHYFVSAWIPPATDSNTIFSSVSAGGLAN--IGFRGAVYD 293

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           I PG +   ++  + G K+   +             +++D+G+ +++A P+  L+ ++ +
Sbjct: 294 IAPGATQEISSQFYVGPKDQKALSAISDT-----LNLVVDYGFLWWLAVPIHWLLMFYQS 348

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
            VGN+G+AI+L T+ V+ L FPL K QY S A M+N+QPK+ +L+E+F     Q + +AM
Sbjct: 349 FVGNWGLAIILITLTVRGLLFPLTKAQYTSMAKMRNLQPKLTDLKERFGD-DRQKMGQAM 407

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           ++LYK   +NP+ GC PI+LQ+P+F A+Y V+  S E+RHAPF  WI DL+  DP     
Sbjct: 408 MELYKKEKVNPMGGCLPIILQMPIFIALYWVLLESFELRHAPFMLWIHDLSVQDPYY--- 464

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSP--PPADKGQAMILNWMPVVFVFALSS 533
                           I P++M +SMF+  KM P  P  D  Q  ++ WMPV+F      
Sbjct: 465 ----------------ILPLLMGVSMFVMQKMQPIAPTMDPMQVKMMQWMPVIFTVFFLW 508

Query: 534 FPAGLIIYWSWSNVISIVQQAVIM 557
           FPAGL++YW   N+++I QQ +I 
Sbjct: 509 FPAGLVLYWLVGNIVAITQQKIIY 532


>gi|253690653|ref|YP_003019843.1| 60 kDa inner membrane insertion protein [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|259515701|sp|C6DK98|OXAA_PECCP RecName: Full=Inner membrane protein oxaA
 gi|251757231|gb|ACT15307.1| 60 kDa inner membrane insertion protein [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 544

 Score =  345 bits (883), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 136/570 (23%), Positives = 246/570 (43%), Gaps = 51/570 (8%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL  +    WQ +             +        +  +          
Sbjct: 1   MDSQRNLLL-IALLFVTFMLWQAWETDKNPPATTQAIQQATNAVTGDATNQGVP------ 53

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
              A      + +K   L  +IN +G   +  +L  Y   + S+ P   L   + ++  Y
Sbjct: 54  ---ASGQGKLITVKTDVLSLTINTRGGDVEQAHLLAYPDTLGSDKPFHLL--ETTSEFVY 108

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL-----TPTTPIKLVFKNANNILFERTISLD 175
            A+             N        +              I + +  A+ + + +T  L 
Sbjct: 109 QAQSGLTGKNGPDNPANGPRPLFTTTQDSFELADGQNELRIPMTYTAADGVTYTKTFVLK 168

Query: 176 -EHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-----KPQTATNTFGVQEGFIAVLGDKSL 229
              Y   +  +V N S   +  +  G++ +         T ++ F +     A       
Sbjct: 169 RGDYALNVDYSVNNTSAQPLELTLFGQLKQSIDLPKHRDTGSSNFALHTYRGAAFSSSED 228

Query: 230 VEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKF 289
             +KYS  +     N   ++ W+ +  +Y+A+ +IP+   +    F     G+ +    F
Sbjct: 229 KYKKYSFSDMDENLNITTNSGWVAMLQQYFATAWIPTTAGANT--FYTNKLGNGQAAIGF 286

Query: 290 SANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFML 349
            A  + +  G        L+ G +    +         P  ++ +D+GW +FI++P+F L
Sbjct: 287 KAAPVVVAAGSQQNLNATLWVGPEIQDKMAAVA-----PHLDLTVDYGWLWFISQPLFKL 341

Query: 350 MSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQ 409
           + + +  +GN+G +I+  T  V+ + +PL K QY S A M+ +QPK+  +RE+      Q
Sbjct: 342 LKFLHGFIGNWGFSIIAITFIVRGVMYPLTKAQYTSMAKMRLLQPKLQAMRERIGDDK-Q 400

Query: 410 VLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAAD 469
            + + M+ LYK+  +NPL GC+P+L+Q+P+F A+Y ++  S+E+RHAPF  WI DL+A D
Sbjct: 401 RMSQEMMALYKSEKVNPLGGCFPLLIQMPIFLALYYMLMGSVELRHAPFALWIHDLSAQD 460

Query: 470 PTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFV 528
           P                     I PI+M ++MF   KMSP    D  Q  I+ +MPV+F 
Sbjct: 461 PYY-------------------ILPILMGVTMFFIQKMSPTTVTDPMQQKIMTYMPVIFT 501

Query: 529 FALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
                FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 502 VFFLWFPSGLVMYYIVSNLVTILQQQLIYR 531


>gi|260595827|ref|YP_003208398.1| membrane protein insertase [Cronobacter turicensis z3032]
 gi|260215004|emb|CBA26663.1| Inner membrane protein oxaA [Cronobacter turicensis z3032]
          Length = 549

 Score =  345 bits (883), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 146/571 (25%), Positives = 254/571 (44%), Gaps = 50/571 (8%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N FV IAL  +    WQ +           ++     V+Q  Q   + A      
Sbjct: 1   MDSQRNLFV-IALLFVSFMIWQAW---------EQDKAPKPQVQQTTQTTTTAAGSAASQ 50

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
              A      + +K   L  +IN +G   +   L  Y  ++ S+ P   L +  N     
Sbjct: 51  GVPASGQGKLITVKTDVLSLTINTRGGDIEQALLLAYPKELGSSEPFQLLETTPNFIYQA 110

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKL----VFKNANNILFERTISLD- 175
            + L   +  +N        ++N+     +      +L     F +A    F +T +L  
Sbjct: 111 QSGLTGRNGPDNPNNNQGRPLYNVERDTYVLADGQDELLIPMTFTDAAGNAFTKTFALKR 170

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-----KPQTATNTFGVQEGFIAVLGDKS-- 228
             Y   +   V N     +  S  G++ +         T +N F +     A        
Sbjct: 171 GQYAVYVGYDVKNAGTQPLEVSSFGQLKQTIDLPSHRDTGSNNFALHTFRGAAYSTPDEK 230

Query: 229 LVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAK 288
             + K+  I      N +    W+ +  +Y+A+ ++P+      S F     GH      
Sbjct: 231 YEKYKFDTIADDENLNVNAKGGWVAMLQQYFATAWVPASN--VTSNFYTADLGHGVAAIG 288

Query: 289 FSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFM 348
           + +  + + PG++    + L+ G +    +         P  ++ +D+GW +FI++P+F 
Sbjct: 289 YKSEPVQVQPGQTAKLASTLWVGPEIQDKMAAVA-----PHLDLTVDYGWLWFISQPLFK 343

Query: 349 LMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPP 408
           L+ + ++ +GN+G +I+  T  V+ + +PL K QY S A M+ +QPKI  +RE+      
Sbjct: 344 LLKWIHSFLGNWGFSIIAITFIVRGVMYPLTKAQYTSMAKMRLLQPKIQAMRERLGDDK- 402

Query: 409 QVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAA 468
           Q + + M+ LYK   +NPL GC+P+L+Q+P+F A+Y ++  S+E+RHAPF  WI DL+A 
Sbjct: 403 QRMSQEMMALYKAEKVNPLGGCFPLLIQMPIFLALYYMLMGSVELRHAPFALWIHDLSAQ 462

Query: 469 DPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVF 527
           DP                     I PI+M  +MF   KMSP    D  Q  I+ +MPV+F
Sbjct: 463 DPYY-------------------ILPILMGATMFFIQKMSPTTVTDPMQQKIMTFMPVIF 503

Query: 528 VFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
                 FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 504 TVFFLWFPSGLVLYYIVSNLVTILQQQLIYR 534


>gi|330447273|ref|ZP_08310923.1| inner-membrane protein insertion factor [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328491464|dbj|GAA05420.1| inner-membrane protein insertion factor [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 544

 Score =  344 bits (882), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 143/568 (25%), Positives = 238/568 (41%), Gaps = 38/568 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M    N  + IAL  +    +Q +      +          +        +     L D 
Sbjct: 1   MGSQRN-ILLIALLFVSFLLFQQWNADKNPQPQGQGVAQQASQNSDIPSHSGEGQPLTDQ 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
                S    + +K   L  +++  G    D  L  Y+  + S  P V L       + Y
Sbjct: 60  T----SSQNLITIKTDVLELTVDTLGGDVVDAKLLKYNNTLGSKDPFVLL--SDTNGHDY 113

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLV----FKNANNILFERTISLDE 176
            A+   +         N    +++ +   +      +L     F        +  +    
Sbjct: 114 IAQSGLIGPNGADSQQNGRAQYSVTAKDFVMGPEQNELRVPMTFTKDGISYTKTFVLKRN 173

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSD 236
            Y   +  TV NN+          ++      +  +         A   + +  ++   D
Sbjct: 174 DYAVNVDYTVANNTDKAASVQMYAQLRHKLSDSGGSLTMPTYLGGAYSANDTKYKKYSFD 233

Query: 237 IEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITI 296
             K    +   +  W  I   Y+ S +IP       SQ    +     Y         T+
Sbjct: 234 DMKDKNLDVAANEGWAAIMQHYFVSAWIPRDGADQTSQVYSTTSNGNGY-IGVRMPIETV 292

Query: 297 LPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNL 356
            PG+S      L+ G K    +    K+       + +D+GW +FIA P+  L+S+ +++
Sbjct: 293 APGQSKEIKATLWVGPKLQNEMAATAKN-----LNLTVDYGWLWFIASPLHKLLSFIHSI 347

Query: 357 VGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMI 416
           VGN+GIAI++ T  V+   +PL K QY S A M+ +QPKI  +RE+      Q + + M+
Sbjct: 348 VGNWGIAIIVLTFIVRGAMYPLTKAQYTSMAKMRMLQPKIQAMRERLGD-DRQRMSQEMM 406

Query: 417 QLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTL 476
           +LYK   +NPL GC PILLQ+P+F A+Y  +  S+E+RHAPF+GWI DL+A DP      
Sbjct: 407 ELYKKEKVNPLGGCLPILLQMPIFIALYWALMESVELRHAPFFGWIHDLSAQDPYY---- 462

Query: 477 FGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFP 535
                          + PI+M ++MF   KMSP    D  Q  I+ +MPV+F F    FP
Sbjct: 463 ---------------VLPILMGITMFFIQKMSPSTVTDPMQQKIMTFMPVMFTFFFLFFP 507

Query: 536 AGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           +GL++YW  SN+++++QQ +I +    +
Sbjct: 508 SGLVLYWLVSNIVTLIQQTIIFRQLEKK 535


>gi|146309633|ref|YP_001190098.1| putative inner membrane protein translocase component YidC
           [Pseudomonas mendocina ymp]
 gi|166977399|sp|A4Y1A0|OXAA_PSEMY RecName: Full=Inner membrane protein oxaA
 gi|145577834|gb|ABP87366.1| protein translocase subunit yidC [Pseudomonas mendocina ymp]
          Length = 581

 Score =  344 bits (882), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 145/604 (24%), Positives = 243/604 (40%), Gaps = 72/604 (11%)

Query: 1   MERNWNYFV--AIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           M+   +  +     +S ++V  W   Y    +    +              D +      
Sbjct: 1   MDIQRSILIVALAVVSYLMVLQWNEDYGQAALPAEVSSSTAATPALPDTPADTASTGGDD 60

Query: 59  DDRAQA-----------LSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPI 107
              A A            +    + +K   L  +I+ +G     L L  Y          
Sbjct: 61  IPTAVAEPTAAAVAPTAAASDELIRVKTDVLDLAIDPRGGDIVQLRLPQYPRRQDRPDVP 120

Query: 108 VTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLV---FKNAN 164
             L   + ++  Y A+   +   N  +  +   +W+              LV     + N
Sbjct: 121 FQLF-DNGSERTYLAQSGLIGQ-NAPDKSSGRALWSSEKQSYEMADGQDSLVVDLTYSEN 178

Query: 165 NILFERTISLDE----------------------HYLFKIVDTVTNNSIDQIRFSPRGRI 202
            + + +  S                          Y   +   + N S      +   ++
Sbjct: 179 GVSYIKRYSFKRGLNPQCSAREQQLKKPGCVDPSAYQVDVRYLIDNQSDQAWSGNLFAQL 238

Query: 203 MRHKPQT----ATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKY 258
            R                  G      D+   +    DI+K S         W+     Y
Sbjct: 239 KRDNSGDPSSTTATGTATYLGAALWTSDEPYKKVSMKDIDKQSFKET-VQGGWVAWLQHY 297

Query: 259 WASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTI 318
           + + ++PSK+++   Q +   D    Y   F+   + +  G    T   L+AG K    +
Sbjct: 298 FVTAWVPSKDSTNLVQTR--KDSQGNYIVGFTGPAVQVAAGAQGETGAILYAGPKLQEHL 355

Query: 319 HHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPL 378
                    P  E+ +D+G+ +F+A+P+F L+   + L+GN+G +I++ T+ +KL+FFPL
Sbjct: 356 GKLS-----PGLELTVDYGFLWFLAQPIFWLLEVIHGLLGNWGWSIIVLTIIIKLIFFPL 410

Query: 379 AKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIP 438
           +   Y S A M+ + PK+  L+E+      Q + +AM++LYK   INPL GC PIL+Q+P
Sbjct: 411 SAASYRSMARMRAVSPKLQALKEQHGD-DRQKMSQAMMELYKKEKINPLGGCLPILVQMP 469

Query: 439 VFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMS 498
           VF A+Y V+  S+EMR AP+  WI DL+  DP                     I PIIM 
Sbjct: 470 VFLALYWVLLESVEMRQAPWMFWITDLSIKDPFF-------------------ILPIIMG 510

Query: 499 LSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
            +MFIQ +++P P D  QA +L  MP++F F    FPAGL++YW  +N++SI QQ  I +
Sbjct: 511 ATMFIQQQLNPTPPDPMQARVLKLMPIIFTFFFLWFPAGLVLYWVVNNILSIGQQWYITR 570

Query: 559 MHGA 562
              A
Sbjct: 571 KIEA 574


>gi|269962686|ref|ZP_06177031.1| inner membrane protein, 60 kDa [Vibrio harveyi 1DA3]
 gi|269832609|gb|EEZ86723.1| inner membrane protein, 60 kDa [Vibrio harveyi 1DA3]
          Length = 540

 Score =  344 bits (882), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 140/570 (24%), Positives = 244/570 (42%), Gaps = 42/570 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL+++    +Q + V         E+    +        +    V    
Sbjct: 1   MDSQRN-ILLIALALVSFLLFQQWQVAKNPAPQAVEQAQSSSTLPAPSFADDLDPVPGQQ 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           +A A      + +    L  SI+  G      +L  Y  ++ S+ P V L       + +
Sbjct: 60  QASA----KTITVTTDVLTLSIDTVGGDVVHADLNKYAAELDSSDPFVLLKDTKG--HQF 113

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDE 176
            A+   V          +   +N+ +             + + F        +  +    
Sbjct: 114 IAQSGLVGPQGIDLSSTNRPHYNVSADSFTLADGQDELRVPMTFTANGIEYIKTYVFKRG 173

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYS 235
            Y   +   V NNS +   F     + ++      + T     G      D    +  + 
Sbjct: 174 SYALNVEYDVVNNSGNNATFGMYAHLRQNLMDAGGSITMPTYRGGAYSTEDVRYKKYSFE 233

Query: 236 DIEKSSISNFHES-NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
           D++  ++S        W  +   Y+A+ +IP  E   +   + + +              
Sbjct: 234 DMQDRNLSINLADGQGWAAMIQHYFAAAWIPRNEPGTNLYTRVIGNLGD---IGVRMPNK 290

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
           TI  G        L+ G K    +         P  ++++D+GW +FIAKP+  L+++  
Sbjct: 291 TIATGDQAKFEATLWVGPKLQNEMAAVA-----PNLDLVVDYGWLWFIAKPLHSLLAFIQ 345

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
           + VGN+G+AI+  T  V+   +PL K QY S A M+ +QPK+  +RE+      Q + + 
Sbjct: 346 SFVGNWGVAIICLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLQAMRERIGD-DRQRMSQE 404

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           M++LYK   +NPL GC P++LQ+P+F A+Y  +  S+E+RH+PF+GWI DL+A DP    
Sbjct: 405 MMELYKKEKVNPLGGCLPLILQMPIFIALYWALMESVELRHSPFFGWIHDLSAQDPYY-- 462

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSS 533
                            I P++M  SMF+  KMSP    D  Q  I+ +MPV+F F    
Sbjct: 463 -----------------ILPLLMGASMFLIQKMSPTTVTDPMQQKIMTFMPVMFTFFFLF 505

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           FP+GL++YW  SN+++++QQ +I K    +
Sbjct: 506 FPSGLVLYWLVSNIVTLIQQTLIYKALEKK 535


>gi|183597176|ref|ZP_02958669.1| hypothetical protein PROSTU_00419 [Providencia stuartii ATCC 25827]
 gi|188023490|gb|EDU61530.1| hypothetical protein PROSTU_00419 [Providencia stuartii ATCC 25827]
          Length = 549

 Score =  344 bits (882), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 147/571 (25%), Positives = 267/571 (46%), Gaps = 51/571 (8%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL  +    WQ +      ++   + K +QT +Q +   +   AV    
Sbjct: 1   MDSQRNLLL-IALLFVSFLVWQAW----ESDKAAQDLKTVQTTQQTDMPSSDSQAVT--- 52

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLS-PSNTKNA 119
              +      + +K   L   IN +G   D+ +L  Y   + S SP   L + P     A
Sbjct: 53  ---SSGQGKLITVKTDVLDLRINTRGGDIDEADLLAYPATLHSESPFRLLETTPDFIYQA 109

Query: 120 YFAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLD 175
               +      N         V+++ S   +         + + F + N +++++T  L 
Sbjct: 110 QSGLIGQHGPDNPDNSNGQRPVYSVESSSFILADGQDELRVPMTFTDKNGVVYQKTYVLK 169

Query: 176 -EHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-----KPQTATNTFGVQEGFIAVLGDKSL 229
             HY   +   + N +   +  +  G++ +      +  T ++ F +     A       
Sbjct: 170 RGHYNVDVEYNIQNPTAQALNLAFFGQLKQTIQLPKERDTGSSNFALHTYRGAAYSSDES 229

Query: 230 VEQKY-SDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAK 288
             +KY     +    N      W+ +  +Y+A+ ++P+     +S F  +  G       
Sbjct: 230 NYKKYSFSDIEDKKLNVTTKGGWVAMLQQYFATAWVPASNE--NSTFYTIDLGQKEAIIG 287

Query: 289 FSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFM 348
           + +  +TI    + T ++ L+ G +    +         P  ++ +D+GW +FI++P+F 
Sbjct: 288 YKSQPLTIAANGAGTYSSTLWVGPEIQSEMAEVA-----PHLDLTVDYGWLWFISQPLFK 342

Query: 349 LMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPP 408
           L+ + +  VGN+GIAI++ T  V+ + +PL K QY S A M+ +QPK+  +RE+      
Sbjct: 343 LLKFIHGFVGNWGIAIIIITFIVRGIMYPLTKAQYTSMAKMRLLQPKLAAMRERIGDDK- 401

Query: 409 QVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAA 468
           Q + + M+ LYK   +NPL GC P+L+Q+P+F A+Y ++  S+E+RHAPF+GWI+DL+A 
Sbjct: 402 QRMSQEMMALYKAEKVNPLGGCLPLLIQMPIFLALYYMLMGSVELRHAPFFGWIQDLSAQ 461

Query: 469 DPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVF 527
           DP                     I P++M ++MF+  KMSP    D  Q  I+ +MPVVF
Sbjct: 462 DPYY-------------------ILPVLMGVTMFVIQKMSPTAVTDPMQQKIMTYMPVVF 502

Query: 528 VFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
                 FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 503 TIFFLWFPSGLVLYYIVSNLVTIIQQQIIYR 533


>gi|300115605|ref|YP_003762180.1| membrane protein insertase [Nitrosococcus watsonii C-113]
 gi|299541542|gb|ADJ29859.1| membrane protein insertase, YidC/Oxa1 family domain containing
           protein [Nitrosococcus watsonii C-113]
          Length = 545

 Score =  344 bits (882), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 142/568 (25%), Positives = 250/568 (44%), Gaps = 40/568 (7%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFY-------VYPRIEEMNNERKNIQTVKQPNQVDNSYA 54
             N+   +  AL +++   W  +        + P   +                 D    
Sbjct: 1   MENYRLILFSALVLVLFLMWDAWQTDYGPIPLIPPPPQPAASSGESSPAPPEAVPDAPLP 60

Query: 55  AVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPS 114
            V   D A  L     +E+K   L   I +      ++ L  Y + +   +  VTLL   
Sbjct: 61  EVADMDTAPILPDQKTIEVKTDLLAIKIGMASGDLYEVQLLNYPVSLKEPNKPVTLLHKR 120

Query: 115 NTKNAYFAELDYVSTAN---NIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERT 171
           +  + +  +    + +      E    +                + L +++ N I   +T
Sbjct: 121 D-PDLFVTQSGLRAASGPSITHEKVQFSAPKTHYELIEDEGILKVPLTWEDENGIKVTKT 179

Query: 172 ISLD-EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLV 230
                + Y   +   + N +          +  R  P++         G +    ++   
Sbjct: 180 YLFRRDSYQIDLNIKIENGTDQAWMGRAYAQFSRTPPESGGMFARSYVGAVFSTNEQEYQ 239

Query: 231 EQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFS 290
           +  + D+   S         W+ +   Y+ + ++P ++ + +   K++ +   RY     
Sbjct: 240 KVDFGDLASKSFDR-RSPGGWVAMIQHYFVAAWVPREQGTNYYYGKHVQNS--RYIVGVM 296

Query: 291 ANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLM 350
             + TI PG+S      LF G K    +         P+  + +D+G    +A+P+F LM
Sbjct: 297 PPQQTIAPGESGQFNLALFTGPKIQDRLAVVA-----PKLNLTVDYGKLTILAEPLFWLM 351

Query: 351 SYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQV 410
           S+F+NLVGN+G AI+L T  VKL+FF L++  Y S A M+ +QP++  L+E++     Q 
Sbjct: 352 SWFHNLVGNWGWAIVLLTFVVKLVFFKLSQTSYRSMARMRKLQPRLLALKERYGD-DRQK 410

Query: 411 LQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADP 470
           + +AM++LY+   +NP+ GC PI++QIPVF A+Y ++  S+E+R APF  WI+DL + DP
Sbjct: 411 VGQAMMELYRKEKVNPMGGCLPIVVQIPVFIALYWMLLESVELRQAPFIFWIQDLTSKDP 470

Query: 471 TNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFA 530
                                I P++M +SMF+Q K+SP P D  QA ++  MPV+F   
Sbjct: 471 YY-------------------ILPLLMGVSMFVQQKLSPAPTDPIQAKVMALMPVMFTVF 511

Query: 531 LSSFPAGLIIYWSWSNVISIVQQAVIMK 558
              FPAGL++YW  +N++SI QQ  I +
Sbjct: 512 FVMFPAGLVLYWVVNNILSIAQQWYITR 539


>gi|167626216|ref|YP_001676510.1| 60 kDa inner membrane insertion protein [Shewanella halifaxensis
           HAW-EB4]
 gi|189036362|sp|B0TQH1|OXAA_SHEHH RecName: Full=Inner membrane protein oxaA
 gi|167356238|gb|ABZ78851.1| 60 kDa inner membrane insertion protein [Shewanella halifaxensis
           HAW-EB4]
          Length = 544

 Score =  344 bits (882), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 136/566 (24%), Positives = 238/566 (42%), Gaps = 40/566 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVY--PRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           ME   N  + I L  +    WQ +     P+       + +I      +   +       
Sbjct: 1   MESQRN-ILLIGLLFVSFLLWQQWQADQAPQPVAAAQTQSSIPASTVADSHSSDVPDADS 59

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
                  +    + +    L   I+  G       L  + L+ + + P V L   ++   
Sbjct: 60  AVPEAITASKELITVFTDQLEIKIDPVGGDIVYSALLSHKLEENGDDPFVLLEQTNDIY- 118

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISL 174
            Y A+   +              ++  S +        T  + L + +   + + ++   
Sbjct: 119 -YIAQSGLIGRDGIDSSVKGRAHFDSASREYKLADGQDTLSVPLTYVSDKGVTYTKSFVF 177

Query: 175 -DEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQK 233
               Y   +   + N S   ++    G+I     ++ ++         A   D    E+ 
Sbjct: 178 TRGKYNIAVDYKINNTSDASLQVQMYGQIKHSIKKSESSMMMPTYLGGAFSTDDIRYEKY 237

Query: 234 YSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANE 293
             D       +      W+ +   Y+ S ++P             +         F    
Sbjct: 238 SFDDMADKNLDDSTLGGWVAMLQHYFVSAWVPPATEKNIIFSSMKNGLAN---IGFRGEL 294

Query: 294 ITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYF 353
             I PG      +  + G K+   +         P   +++D+G+ +++A P++ L+ +F
Sbjct: 295 HDIAPGSEQVIKSEFYVGPKDQKALSVLS-----PSLNLVVDYGFLWWLAVPIYKLLMFF 349

Query: 354 YNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQK 413
           +++VGN+G AI+L T+ V+ L +PL K QY S A M+N+QPK+ EL+E+F     Q + +
Sbjct: 350 HSIVGNWGFAIILITLTVRGLLYPLTKAQYTSMAKMRNLQPKLAELKERFGD-DRQKMGQ 408

Query: 414 AMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNI 473
           AM++LYK   +NP+ GC PILLQ+P+F A+Y V+  S+E+RHAPF  WI DL+  DP   
Sbjct: 409 AMMELYKKEKVNPMGGCLPILLQMPIFIALYWVLLESVELRHAPFMLWITDLSVQDPYY- 467

Query: 474 FTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSP--PPADKGQAMILNWMPVVFVFAL 531
                             + PI+M +SMF+  KM P  P  D  Q  ++ WMPV+F    
Sbjct: 468 ------------------VLPILMGISMFVMQKMQPMAPTMDPMQVKMMQWMPVIFTVFF 509

Query: 532 SSFPAGLIIYWSWSNVISIVQQAVIM 557
             FPAGL++YW   N+++I QQ +I 
Sbjct: 510 LWFPAGLVLYWLVGNLVAITQQKIIY 535


>gi|290477350|ref|YP_003470271.1| preprotein translocase cooperates with SecYEG and SecDFyajC
           translocon membrane protein [Xenorhabdus bovienii
           SS-2004]
 gi|289176704|emb|CBJ83513.1| preprotein translocase, cooperates with SecYEG and SecDFyajC
           translocon, membrane component [Xenorhabdus bovienii
           SS-2004]
          Length = 537

 Score =  344 bits (882), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 133/574 (23%), Positives = 242/574 (42%), Gaps = 56/574 (9%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL  +    WQ +      E+  N +   Q  +Q N             
Sbjct: 1   MDSQRNL-LFIALLFVSFLVWQAW------EKDQNPQPTAQITQQAN----------TPS 43

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
              +      + +K   L   IN +G   ++ +L  Y   + SN P   L   S  +  Y
Sbjct: 44  SEASSGQGKLITVKTDVLSLHINTRGGDIEEADLLAYPDTLGSNKPFKLL--ESTPEFIY 101

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTP----IKLVFKNANNILFERTISLDE 176
            A+     T       +           +L                   +  +  I    
Sbjct: 102 QAQSGLTGTNGPDNQADRPFYHTTQDSYVLADGQNELRIPMTYTAPDGVVYVKTFILKRG 161

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRH-----KPQTATNTFGVQEGFIAVLGDKSLVE 231
           +Y   +   + N +   ++ +  G++ +         T ++ F +     A         
Sbjct: 162 NYAVSVDYNIDNVTDKPLQMAFFGQLKQSVELPKSRDTGSSNFALHTYRGAAYSSAEAKY 221

Query: 232 QKY-SDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFS 290
           +KY     +        +  W+ +  +Y+A+ ++P   ++    +             + 
Sbjct: 222 EKYKFGDIEDKALAVTTNGGWVAMLQQYFATAWVPGANSTNTF-YTIDLKNQKMAIIGYK 280

Query: 291 ANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLM 350
              + I P      ++ L+ G +    +         P  ++ +D+GW +FI++P+F L+
Sbjct: 281 GETVNIAPNSKQNISSTLWVGPEIQDKMAEVA-----PHLDLTVDYGWLWFISQPLFKLL 335

Query: 351 SYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQV 410
            + +  +GN+G +I+  T  V+ + +PL K QY S A M+ +QPKI  +RE+      Q 
Sbjct: 336 KFLHEFIGNWGFSIIAITFIVRGIMYPLTKAQYTSMAKMRLLQPKITAMRERHGD-DRQR 394

Query: 411 LQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADP 470
           + + M+ LYKT  +NPL GC P+++Q+P+F A+Y ++  S+E+RHAPF GWI+DL+A DP
Sbjct: 395 MSQEMMALYKTEKVNPLGGCLPLVIQMPIFLALYYMLMGSVELRHAPFIGWIEDLSAQDP 454

Query: 471 TNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVF 529
                                I P++M  +MF+  K+SP    D  Q  I+ +MPV+F  
Sbjct: 455 YY-------------------ILPLLMGATMFVIQKLSPTTVTDPMQQKIMTYMPVMFTV 495

Query: 530 ALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
               FP+GL++Y+  SN+++I+QQ VI +     
Sbjct: 496 FFLWFPSGLVLYYIVSNLVTIIQQQVIFRSLEKR 529


>gi|24371604|ref|NP_715646.1| inner membrane protein, 60 kDa [Shewanella oneidensis MR-1]
 gi|38503016|sp|Q8EKT6|OXAA_SHEON RecName: Full=Inner membrane protein oxaA
 gi|24345354|gb|AAN53091.1|AE015452_4 inner membrane protein, 60 kDa [Shewanella oneidensis MR-1]
          Length = 541

 Score =  344 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 139/564 (24%), Positives = 238/564 (42%), Gaps = 39/564 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           ME   N  + I L  +    WQ +      + +  E   +      +  D   A   +  
Sbjct: 1   MESQRN-ILLIGLLFVSFLLWQQWQADKAPKPVATESSVVANATTNHSADVPEADTGVP- 58

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
            A   +    + +K   L   IN  G       L  + L+   + P V L    +    Y
Sbjct: 59  -AAVAATQNLITVKTDQLDVQINPVGGDIVYAALVSHKLEQGKDQPFVLLEQTKD--FTY 115

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLD- 175
            A+   +             ++     +        +  + L +   N + + +      
Sbjct: 116 IAQSGLIGRDGIDSSAKGRAIFAASKTEFTLADGQDSLEVPLTYVAENGVTYTKVFVFHR 175

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
             +   I   + N S   ++    G+I +    + ++         A        E+   
Sbjct: 176 GKFNVNIDYKINNTSAAPLQVQMYGQIKQTIKPSESSMMMPTYRGAAFSTASVRYEKYNF 235

Query: 236 DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
           +    +  N      W  +   Y+ S +IP    S        + G A     F      
Sbjct: 236 EDMGKNNLNQPTIGGWAAMLQHYFVSAWIPPATDSNTIFSSVSAGGLAN--IGFRGAVYD 293

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           + PG +   ++  + G K+   +             +++D+G+ +++A P+  L+ ++ +
Sbjct: 294 VAPGATQEISSQFYVGPKDQKALSALSDT-----LNLVVDYGFLWWLAVPIHWLLMFYQS 348

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
            VGN+G+AI+L T+ V+ L FPL K QY S A M+N+QPK+ +L+E+F     Q + +AM
Sbjct: 349 FVGNWGVAIILITLTVRGLLFPLTKAQYTSMAKMRNLQPKLQDLKERFGD-DRQKMGQAM 407

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           ++LYK   +NP+ GC PILLQ+P+F A+Y V+  S E+RHAPF  WI DL+  DP     
Sbjct: 408 MELYKKEKVNPMGGCLPILLQMPIFIALYWVLLESFELRHAPFMLWIHDLSVQDPYY--- 464

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSP--PPADKGQAMILNWMPVVFVFALSS 533
                           I P++M +SMFI  KM P  P  D  Q  ++ WMPV+F      
Sbjct: 465 ----------------ILPLLMGVSMFIMQKMQPIAPTMDPMQVKMMQWMPVIFTVFFLW 508

Query: 534 FPAGLIIYWSWSNVISIVQQAVIM 557
           FP+GL++YW   N+++I+QQ +I 
Sbjct: 509 FPSGLVLYWLVGNIVAIIQQKIIY 532


>gi|156972771|ref|YP_001443678.1| putative inner membrane protein translocase component YidC [Vibrio
           harveyi ATCC BAA-1116]
 gi|166977424|sp|A7N0X9|OXAA_VIBHB RecName: Full=Inner membrane protein oxaA
 gi|156524365|gb|ABU69451.1| hypothetical protein VIBHAR_00436 [Vibrio harveyi ATCC BAA-1116]
          Length = 540

 Score =  344 bits (881), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 138/570 (24%), Positives = 244/570 (42%), Gaps = 42/570 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL+++    +Q + V         E+    +        +    V    
Sbjct: 1   MDSQRN-ILLIALALVSFLLFQQWQVAKNPAPQAVEQAQSSSTLPAPSFADELDPVPGQQ 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           +A A      + +    L  SI+  G      +L  Y  ++ S+ P V L       + +
Sbjct: 60  QASA----KTITVTTDVLTLSIDTVGGDVVHADLNKYSAELDSSDPFVLLKDTKG--HQF 113

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDE 176
            A+   V          +   + + +             + + F        +  +    
Sbjct: 114 IAQSGLVGPQGIDLSSTNRPHYKVSADSFTLADGQDELRVPMTFTANGIEYIKTYVFKRG 173

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYS 235
            Y   +   V NNS +   F     + ++      + T     G      D    +  + 
Sbjct: 174 SYALNVEYDVVNNSGNNATFGMYAHLRQNLMDAGGSITMPTYRGGAYSTEDVRYKKYSFE 233

Query: 236 DIEKSSISNFHES-NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
           D++  ++S        W  +   Y+A+ +IP  E   +   + + +              
Sbjct: 234 DMQDRNLSINLADGQGWAAMIQHYFAAAWIPRNEPGTNLYTRVIGNLGD---IGVRMPNK 290

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
           TI  G        L+ G K    +    ++      ++++D+GW +FIAKP+  L+++  
Sbjct: 291 TIATGDQAKFEATLWVGPKLQNEMAAVAEN-----LDLVVDYGWLWFIAKPLHSLLAFIQ 345

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
           + VGN+G+AI+  T  V+   +PL K QY S A M+ +QPK+  +RE+      Q + + 
Sbjct: 346 SFVGNWGVAIICLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLQAMRERIGD-DRQRMSQE 404

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           M++LYK   +NPL GC P++LQ+P+F A+Y  +  S+E+RH+PF+GWI DL+A DP    
Sbjct: 405 MMELYKKEKVNPLGGCLPLILQMPIFIALYWALMESVELRHSPFFGWIHDLSAQDPYY-- 462

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSS 533
                            I P++M  SMF+  KMSP    D  Q  I+ +MPV+F F    
Sbjct: 463 -----------------ILPLLMGASMFLIQKMSPTTVTDPMQQKIMTFMPVMFTFFFLF 505

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           FP+GL++YW  SN+++++QQ +I K    +
Sbjct: 506 FPSGLVLYWLVSNIVTLIQQTLIYKALEKK 535


>gi|292493917|ref|YP_003529356.1| hypothetical protein Nhal_3959 [Nitrosococcus halophilus Nc4]
 gi|291582512|gb|ADE16969.1| 60 kDa inner membrane insertion protein [Nitrosococcus halophilus
           Nc4]
          Length = 554

 Score =  343 bits (880), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 153/584 (26%), Positives = 268/584 (45%), Gaps = 53/584 (9%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFY----------------VYPRIEEMNNERKNIQTVKQ 45
             N+  F+  AL +++   W  +                      +      + +   + 
Sbjct: 1   MENYRLFLFSALILVLFLMWDAWQTDYGPIPLMPPPPQQPSASLKDSSPALPEEVPDAQL 60

Query: 46  PNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNS 105
           P  V  +    + D     +     +E+K   L   I +      ++ L  Y + +   +
Sbjct: 61  PEGVPGTTPPEMADMDTTPIQPGQTIEVKTDLLTVKIEMASGDLYEVQLLDYPVSLKKPN 120

Query: 106 PIVTLLSPSN-----TKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVF 160
             V+LL  ++     T++   A      T    +   S   + L+ G+    +  + L +
Sbjct: 121 EPVSLLHQADPDLFVTQSGLRAVSGPSVTHETAQFSASKAYYELVPGE---DSLVVPLTW 177

Query: 161 KNANNILFERTISLD-EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEG 219
           ++ N I   +T     + Y   +   + N +       P  + +R  P++ +       G
Sbjct: 178 EDENGIKVTKTYIFHRDSYEVDLKLKIENGTDQVWTGRPYAQFIRTPPKSDSFFVRSYIG 237

Query: 220 FIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLS 279
            +    +    +  + D+   S    H S  W  +   Y+ + +IP +E S +   K++ 
Sbjct: 238 AVFSTEENEYQKVDFGDLASQSFER-HSSGGWAAMLQHYFVAAWIPREEGSNYYYGKHVR 296

Query: 280 DGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWF 339
               RY A    ++ T+ PG++      LFAG K    +         P+  + +D+G  
Sbjct: 297 GS--RYIAGVMPSQQTVAPGENGEFNLSLFAGPKIQDRLAATA-----PKLNLTVDYGKL 349

Query: 340 YFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDEL 399
             +A+P+F LMS+F++LVGN+G AI+L TV VKL+FF L++  Y S A M+ +QP++  L
Sbjct: 350 TILAEPLFWLMSWFHSLVGNWGWAIVLLTVVVKLIFFKLSQTSYRSMARMRKLQPQLLAL 409

Query: 400 REKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFW 459
           +E+      ++  +AM++LY+   +NP+ GC PIL+QIPVF A+Y ++  S+E+RHAPF 
Sbjct: 410 KERHGDDRHKM-GQAMMELYRKEKVNPMGGCLPILVQIPVFIALYWMLIESVELRHAPFV 468

Query: 460 GWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMI 519
            WI+DL A DP                     I P++M +SMF+Q K+SP P D  QA +
Sbjct: 469 FWIQDLTAKDPYY-------------------ILPLLMGVSMFVQQKLSPAPTDPIQAKV 509

Query: 520 LNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           ++ MPV+F      FPAGL++YW  +N++SI QQ  I +    E
Sbjct: 510 ISLMPVMFTIFFVLFPAGLVLYWVVNNILSIAQQWYITRQIEKE 553


>gi|126176561|ref|YP_001052710.1| 60 kDa inner membrane insertion protein [Shewanella baltica OS155]
 gi|153002875|ref|YP_001368556.1| 60 kDa inner membrane insertion protein [Shewanella baltica OS185]
 gi|217975463|ref|YP_002360214.1| YidC translocase/secretase [Shewanella baltica OS223]
 gi|304412702|ref|ZP_07394305.1| membrane protein insertase, YidC/Oxa1 family domain containing
           protein [Shewanella baltica OS183]
 gi|307305833|ref|ZP_07585579.1| membrane protein insertase [Shewanella baltica BA175]
 gi|166977414|sp|A3DAS8|OXAA_SHEB5 RecName: Full=Inner membrane protein oxaA
 gi|166977415|sp|A6WUK4|OXAA_SHEB8 RecName: Full=Inner membrane protein oxaA
 gi|254778161|sp|B8EDW5|OXAA_SHEB2 RecName: Full=Inner membrane protein oxaA
 gi|125999766|gb|ABN63841.1| protein translocase subunit yidC [Shewanella baltica OS155]
 gi|151367493|gb|ABS10493.1| 60 kDa inner membrane insertion protein [Shewanella baltica OS185]
 gi|217500598|gb|ACK48791.1| YidC translocase/secretase [Shewanella baltica OS223]
 gi|304348912|gb|EFM13327.1| membrane protein insertase, YidC/Oxa1 family domain containing
           protein [Shewanella baltica OS183]
 gi|306911326|gb|EFN41752.1| membrane protein insertase [Shewanella baltica BA175]
          Length = 541

 Score =  343 bits (880), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 141/564 (25%), Positives = 239/564 (42%), Gaps = 39/564 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           ME   N  + I L  +    WQ +      + +  E   +      +  D   A   +  
Sbjct: 1   MESQRN-ILLIGLLFVSFLLWQQWQADKAPKPVATESSLVANAANSHSADVPEADTGVP- 58

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
            A   + S  + +K   L   IN  G       L  + ++   + P V L    +    Y
Sbjct: 59  -AAVTATSKLITVKTDQLDVQINPIGGDIVFAALVSHKMEQDKDQPFVLLEQTKD--FTY 115

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLD- 175
            A+   +              ++  + +        T  + L +   N + + +      
Sbjct: 116 IAQSGLIGRDGIDSSAKGRAAFSTAATEYTLAEGQDTLEVPLTYVADNGVTYTKVFVFHR 175

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
             +   +   + N S   ++    G+I +    + ++         A        E+   
Sbjct: 176 GKFNVDVDYKINNTSAAPLQVQMYGQIKQTIKPSESSMVMPTYRGGAFSTQDVRYEKYKF 235

Query: 236 DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
           D    S  N      W  +   Y+ S +IP    S        + G A     F      
Sbjct: 236 DDMAKSNLNQATLGGWAAMLQHYFVSAWIPPATDSNTIFSSVSAGGLAN--IGFRGAVYD 293

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           I PG +   ++  + G K+   +             +++D+G+ +++A P+  L+ ++ +
Sbjct: 294 IAPGATQEISSQFYVGPKDQKALSAISDT-----LNLVVDYGFLWWLAVPIHWLLMFYQS 348

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
            VGN+G+AI+L T+ V+ L FPL K QY S A M+N+QPK+ +L+E+F     Q + +AM
Sbjct: 349 FVGNWGMAIILITLTVRGLLFPLTKAQYTSMAKMRNLQPKLTDLKERFGD-DRQKMGQAM 407

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           ++LYK   +NP+ GC PI+LQ+P+F A+Y V+  S E+RHAPF  WI DL+  DP     
Sbjct: 408 MELYKKEKVNPMGGCLPIILQMPIFIALYWVLLESFELRHAPFMLWIHDLSVQDPYY--- 464

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSP--PPADKGQAMILNWMPVVFVFALSS 533
                           I P++M +SMF+  KM P  P  D  Q  ++ WMPV+F      
Sbjct: 465 ----------------ILPLLMGVSMFVMQKMQPIAPTMDPMQVKMMQWMPVIFTVFFLW 508

Query: 534 FPAGLIIYWSWSNVISIVQQAVIM 557
           FPAGL++YW   N+++I QQ +I 
Sbjct: 509 FPAGLVLYWLVGNIVAITQQKIIY 532


>gi|315634811|ref|ZP_07890093.1| YidC/Oxa1 family membrane protein insertase [Aggregatibacter segnis
           ATCC 33393]
 gi|315476363|gb|EFU67113.1| YidC/Oxa1 family membrane protein insertase [Aggregatibacter segnis
           ATCC 33393]
          Length = 542

 Score =  343 bits (879), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 146/569 (25%), Positives = 247/569 (43%), Gaps = 41/569 (7%)

Query: 1   MERNWNY--FVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           M+          + +S I+   WQ  Y  P+   +  E+    T   P    N+      
Sbjct: 1   MDSRRGLLVIALLFMSFIVYQQWQLDYHTPKP--VATEQTVTSTSDVPASSGNNTVIAT- 57

Query: 59  DDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKN 118
                       + L+N      IN  G       L  Y  ++ SN P V L   +  ++
Sbjct: 58  ----DTQVKGKVITLENDVFRLKINTLGGDVISSELLKYDAELDSNMPFVLL--QNTPEH 111

Query: 119 AYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPI---KLVFKNANNILFERTISLD 175
            Y A+   +                      L          LV++       +  +   
Sbjct: 112 VYIAQSGLIGKDGIDTKAGRADYQVEGENFKLADGQNELIVPLVYQKEGVTYRKIFVLKR 171

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
             Y   +   ++N S   I   P G++      ++ +         A    ++  ++   
Sbjct: 172 GEYDIAVNYEISNQSDKTIEVEPYGQLRHTLVDSSGSVAMPTYTGGAYSSSETNYKKYSF 231

Query: 236 DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
              +++  + +    W+ +   Y+ S +IP+++                    +    + 
Sbjct: 232 SDMENANLSVNTKAGWVAVLQHYFVSAWIPNQDADNQLYTLTDKAN-NIGSIGYRGPVVA 290

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           I P  +   T+ L+ G K    +            ++ +D+GW +FIAKP+F L+++   
Sbjct: 291 IQPNTTEKLTSKLWTGPKLQNEMAQVAD-----HLDLTVDYGWAWFIAKPLFWLLTFIQQ 345

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
           LV N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M
Sbjct: 346 LVHNWGVAIICVTLVVKAILYPLTKAQYTSMAKMRMLQPKLQEMRERF-GEDRQRMSQEM 404

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           ++LYK   +NPL GC P+LLQ+P+F A+Y     ++E+RHAPF+GWI+DL+A DP     
Sbjct: 405 MKLYKDEKVNPLGGCLPLLLQMPIFIALYWTFMEAVELRHAPFFGWIQDLSAQDPYY--- 461

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSF 534
                           I PI+M  SMF+  KMSP P AD  Q  I+N+MP++F+     F
Sbjct: 462 ----------------ILPILMGASMFLLQKMSPTPVADPMQQKIMNFMPLIFMVFFLWF 505

Query: 535 PAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           PAGL++YW  SN+I+I+QQ +I +    +
Sbjct: 506 PAGLVLYWLVSNLITIIQQQLIYRGLEKK 534


>gi|251791812|ref|YP_003006533.1| putative inner membrane protein translocase component YidC [Dickeya
           zeae Ech1591]
 gi|247540433|gb|ACT09054.1| 60 kDa inner membrane insertion protein [Dickeya zeae Ech1591]
          Length = 543

 Score =  343 bits (879), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 147/570 (25%), Positives = 252/570 (44%), Gaps = 52/570 (9%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL  +    WQ +      E   N     QT +  N      A   +  
Sbjct: 1   MDSQRNLLL-IALLFVTFMIWQQW------ETDKNPPAATQTTQLANSAVGDAANQGVP- 52

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
              A      + +K   L  +IN +G   ++ +L  Y  ++SS+ P   L   +     Y
Sbjct: 53  ---ASGQGKLITVKTDVLSLNINTRGGDIEEADLLAYPAELSSSQPFKLL--ETTPAFTY 107

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL-----TPTTPIKLVFKNANNILFERTISLD 175
            A+             N +      S              I L + +AN + F +T  L 
Sbjct: 108 QAQSGLTGKNGPDNPANGSRPLYTASADRFELPAGQNELRIPLTYTDANGVSFTKTFVLK 167

Query: 176 -EHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-----KPQTATNTFGVQEGFIAVLGDKSL 229
              Y   +  +V N S   +  +  G++ +         T +N F +     A       
Sbjct: 168 RGEYALNVEYSVNNASAQPLELALFGQLKQSIDLPSHRDTGSNNFALHTYRGAAFSSSED 227

Query: 230 VEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKF 289
             +KYS  +     N +    W+ +  +Y+A+ ++P+   +    F   + G+      F
Sbjct: 228 KYRKYSFSDMKENLNINTQGGWVAMLQQYFATAWVPTAAANNT--FYSANLGNGLAAIGF 285

Query: 290 SANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFML 349
            A  + + PG        L+ G +    +         P  ++ +D+GW +FI++P+F L
Sbjct: 286 KAAPVIVQPGSQQNLNATLWVGPEIQDKMAAVA-----PHLDLTVDYGWLWFISQPLFKL 340

Query: 350 MSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQ 409
           + + +  +GN+G +I+  T  V+ + +PL K QY S A M+ +QPK+  +RE+      Q
Sbjct: 341 LKFLHGFIGNWGFSIIAITFIVRGIMYPLTKAQYTSMAKMRMLQPKLQAMRERIGDDK-Q 399

Query: 410 VLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAAD 469
            + + M+ LYK   +NPL GC+P+++Q+P+F A+Y ++  S+E+RHAPF  WI DL+A D
Sbjct: 400 RMSQEMMALYKAEKVNPLGGCFPLIIQMPIFLALYYMLMGSVELRHAPFALWIHDLSAQD 459

Query: 470 PTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFV 528
           P                     + PI+M L+MF   KMSP    D  Q  I+ +MPV+F 
Sbjct: 460 PYY-------------------VLPILMGLTMFFIQKMSPTTVTDPMQQKIMTYMPVIFT 500

Query: 529 FALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
                FP+GL++Y+  SN+++I QQ +I +
Sbjct: 501 VFFLWFPSGLVLYYIVSNLVTIAQQQMIYR 530


>gi|110835614|ref|YP_694473.1| inner membrane protein [Alcanivorax borkumensis SK2]
 gi|123149157|sp|Q0VKU7|OXAA_ALCBS RecName: Full=Inner membrane protein oxaA
 gi|110648725|emb|CAL18201.1| inner membrane protein, 60 kDa, putative [Alcanivorax borkumensis
           SK2]
          Length = 582

 Score =  343 bits (879), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 156/604 (25%), Positives = 252/604 (41%), Gaps = 74/604 (12%)

Query: 1   MERNWNYFV--AIALSVIIVYAWQNFYV---YPRIEEMNNERKNIQTVKQPN-------- 47
           ME      +     +S +++ AWQ  Y     P   E   E+ N  +    +        
Sbjct: 1   MEIQRALVITGIAVVSYLMIQAWQRDYANTASPVPVEQVAEQGNSSSSDSADLPSVQSQT 60

Query: 48  -------QVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLD 100
                  Q DN   +V   D AQ    S R+E+    L   IN  G     L L  Y   
Sbjct: 61  DNSIPSAQSDNDLPSVSPADIAQPTPSSQRIEVNTDVLRVEINPVGGDIVRLALPDYPKH 120

Query: 101 VSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLV- 159
           V +      L+      N  +     +   N  +       WN             +L  
Sbjct: 121 VDTPDQPFVLMD--QNSNGTYVAQSGLVGKNGTDSSKGRPHWNSAQQSYRLAEGDNELNV 178

Query: 160 ----FKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTAT---- 211
                +++   + +R       YL ++   V NN       +  G+I R           
Sbjct: 179 DLTLTQDSGAEIIKRYTFEKGSYLIRVSHIVRNNGSTPWTGALYGQIKRDGRDDPGLSKA 238

Query: 212 --NTFGVQEGFIAVLGDKSLVEQKYSDIEKSSIS-NFHESNSWLGISDKYWASVFIPSKE 268
                    G      DK   +  + D+ +  +  +      WL +   Y+ S +IP  +
Sbjct: 239 GFAPMPTYLGAAYWSADKPYNKLTFDDMSEDDVKLDQTVEGGWLAMVQHYFVSAWIPDAK 298

Query: 269 TSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIP 328
              H    YL     +Y  +F +   TI PG+     +  +AG K+   +         P
Sbjct: 299 QKNHYSSVYL-KSRDQYLLRFVSPNTTIQPGEESVLYSEFYAGPKQQDNLEAIS-----P 352

Query: 329 RFEMLIDWGWFYFIAKPMFMLMSYFYNL--------------VGNFGIAIMLTTVFVKLL 374
              M +D+GW +FI++P+F L+ +  +               VGN+G+AI+L T+ +K +
Sbjct: 353 GLNMTVDYGWLWFISQPIFALLVFLQSGEVSVFGMDIDIGGGVGNWGVAIILLTLIIKAI 412

Query: 375 FFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPIL 434
           FF L+   Y S A M+ + P++  ++E+ K    Q  Q   + L+K   INPL GC P+L
Sbjct: 413 FFKLSATSYRSMAKMRKVAPEMQRIKEQNKNDK-QKQQMETMNLFKREKINPLGGCLPML 471

Query: 435 LQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWP 494
           +Q+PVF A+Y V+  S+E+R APF+ WI DL+  DP                     + P
Sbjct: 472 VQMPVFIALYYVLLESVELRQAPFFLWINDLSVMDPYF-------------------VLP 512

Query: 495 IIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQA 554
           I+M  SMF+Q +++P PAD  QA ++ WMP++F   +  FPAGL++YW  +N++SI QQ 
Sbjct: 513 ILMGASMFLQTRLNPTPADPTQAQVMKWMPMIFAVFMLWFPAGLVLYWLTNNILSIAQQW 572

Query: 555 VIMK 558
           +I +
Sbjct: 573 IITR 576


>gi|254230607|ref|ZP_04923966.1| inner membrane protein OxaA [Vibrio sp. Ex25]
 gi|262392790|ref|YP_003284644.1| OxaI/YidC membrane insertion protein [Vibrio sp. Ex25]
 gi|151936867|gb|EDN55766.1| inner membrane protein OxaA [Vibrio sp. Ex25]
 gi|262336384|gb|ACY50179.1| OxaI/YidC membrane insertion protein [Vibrio sp. Ex25]
          Length = 540

 Score =  343 bits (879), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 144/570 (25%), Positives = 244/570 (42%), Gaps = 42/570 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + I L+++    +Q + V    E    E+    +        +    V    
Sbjct: 1   MDSQRN-ILLIGLALVSFLLFQQWQVAKNPEPQAVEQAQSSSTLPAPSFADELDPVPGQQ 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           +A A      + +    L  SI+  G      NL  Y  ++ S+   V L       + +
Sbjct: 60  QASA----KTITVTTDVLTLSIDTVGGDVVHANLNEYSAELDSSDSFVLLKDDQG--HQF 113

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLV----FKNANNILFERTISLDE 176
            A+   V          +   +N+ +          +L     F        +  I    
Sbjct: 114 IAQSGLVGPQGIDLSSTNRPHYNVSADSFTMADGQDELRVPMTFTTNGIEYTKTYIFKRG 173

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYS 235
            Y   +   V NNS +   F     + ++      + T     G      D    +  + 
Sbjct: 174 SYALNVEYDVVNNSGNNATFGMYAHLRQNLMDDGGSITMPTYRGGAYSTEDTRYKKYSFD 233

Query: 236 DIEKSSISNFHES-NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
           D++  ++S        W  +   Y+A+ +IP  E   +   + + +              
Sbjct: 234 DMQDRNLSLNLADGQGWAAMIQHYFAAAWIPRNEPGTNLYTRVIGNLGD---IGVRMPNK 290

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
           TI  G        L+ G K    +         P  ++++D+GW +FIAKP+ ML+S+  
Sbjct: 291 TIATGDQAKFEATLWVGPKLQDEMAEVA-----PNLDLVVDYGWLWFIAKPLHMLLSFIQ 345

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
           + VGN+G+AI+  T  V+   +PL K QY S A M+ +QPK+  +RE+      Q + + 
Sbjct: 346 SFVGNWGVAIICLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLQAMRERIGD-DRQRMSQE 404

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           M++LYK   +NPL GC P++LQ+P+F A+Y  +  S+E+RH+PF+GWI DL+A DP    
Sbjct: 405 MMELYKKEKVNPLGGCLPLILQMPIFIALYWALMESVELRHSPFFGWIHDLSAQDPYY-- 462

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSS 533
                            I P++M  SMF+  KMSP    D  Q  I+ +MPV+F F    
Sbjct: 463 -----------------ILPLLMGASMFLIQKMSPTTVTDPMQQKIMTFMPVMFTFFFLF 505

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           FP+GL++YW  SN+++++QQ +I K    +
Sbjct: 506 FPSGLVLYWLVSNIVTLIQQTLIYKGLEKK 535


>gi|301154699|emb|CBW14162.1| cytoplasmic insertase into membrane protein, Sec system
           [Haemophilus parainfluenzae T3T1]
          Length = 542

 Score =  343 bits (879), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 139/567 (24%), Positives = 254/567 (44%), Gaps = 37/567 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
             +    + +AL  I    +Q + +              +     +    + ++   +  
Sbjct: 1   MDSRRSLLVLALLFISFLVYQQWQLDKNPPVQQQ---TTEQTTTASSDVPASSSSSAEVV 57

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
           A + +    + L+N      ++  G       L  Y  ++ S  P V L      ++ Y 
Sbjct: 58  ADSQTKGHIITLENDVFRLKVDTLGGDVISSELLKYDAELGSKEPFVLL--KDTNEHVYI 115

Query: 122 AELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDEH 177
           A+   +   N I+       + +               + L F+       +  +   + 
Sbjct: 116 AQSGLIG-KNGIDTKAGRAQYQVSGDNFKLAEGQNELSVPLTFEKDGVTYRKIFVLKRDS 174

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           Y   +   + N S   I   P G++     +++ N         A    ++  ++     
Sbjct: 175 YDVGVNFEIVNQSGSAIEVEPYGQLKHTLVESSGNVAMPTYTGGAYSSSETNYKKYSFSD 234

Query: 238 EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITIL 297
            K    +      W+ +   Y+ S +IP+++ +    +      +      +    +++ 
Sbjct: 235 MKDKNLSIDTKAGWVAVLQHYFVSAWIPNQDVNNQL-YSITDSKNNVASIGYRGPVVSVP 293

Query: 298 PGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLV 357
            G + T T+ L+ G K    +            ++ +D+GW +FIAKP+F L+++  ++V
Sbjct: 294 AGATETITSSLWTGPKLQNKMAEVAN-----HLDLTVDYGWAWFIAKPLFWLLTFIQSIV 348

Query: 358 GNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQ 417
            N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++
Sbjct: 349 SNWGVAIICVTLVVKAILYPLTKAQYTSMAKMRMLQPKMQEMRERFGD-DRQRMSQEMMK 407

Query: 418 LYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLF 477
           LYK   +NPL GC P++LQ+P+F A+Y     ++E+RHAPF+GWI+DL+A DP       
Sbjct: 408 LYKEEKVNPLGGCLPLILQMPIFIALYWTFMEAVELRHAPFFGWIQDLSAQDPYY----- 462

Query: 478 GILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPA 536
                         I PI+M  SMF+  KMSP P AD  Q  ++N+MP++F+F    FPA
Sbjct: 463 --------------ILPILMGGSMFLLQKMSPTPVADPMQQKVMNFMPLIFMFFFLWFPA 508

Query: 537 GLIIYWSWSNVISIVQQAVIMKMHGAE 563
           GL++YW  SN+I+IVQQ +I +    +
Sbjct: 509 GLVLYWLVSNLITIVQQQMIYRGLEKK 535


>gi|294638332|ref|ZP_06716585.1| membrane protein insertase, YidC/Oxa1 family [Edwardsiella tarda
           ATCC 23685]
 gi|291088585|gb|EFE21146.1| membrane protein insertase, YidC/Oxa1 family [Edwardsiella tarda
           ATCC 23685]
          Length = 555

 Score =  343 bits (878), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 139/571 (24%), Positives = 248/571 (43%), Gaps = 56/571 (9%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N F+ +AL  +    WQ +      + +        +      V  S        
Sbjct: 15  MDSQRNLFL-VALLFVSFLIWQAWQTDHNPQPVAQTAGQSVSDAASQAVPESG------- 66

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
                     + +K   L  +IN +G   +  +L  Y   + SN+P   L   +  +  Y
Sbjct: 67  ------QGKLITVKTDVLALTINTRGGDIEQADLLAYPATLGSNTPFQLL--ETTPQFIY 118

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL-----TPTTPIKLVFKNANNILFERTISLD 175
            A+      +      N        +              I L +   N +++ +T  L 
Sbjct: 119 QAQSGLTGKSGPDNPANGPRPLYNANQTSYEMLPGQDELRIPLTYTAPNGVVYTKTFVLK 178

Query: 176 EHYL-FKIVDTVTNNSIDQIRFSPRGRIMRH-----KPQTATNTFGVQEGFIAVLGDKSL 229
            +     +   V N+S + +  +  G++ +         T ++ F +     A       
Sbjct: 179 RNDYAIAVDYKVKNDSHEALDLTLFGQLKQSVDLPKHRDTGSSNFALHTFRGAAYSSSDD 238

Query: 230 VEQKY-SDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAK 288
             QKY     +    N      W+ +  +Y+A+ +IP       + F   + G+ +    
Sbjct: 239 KYQKYSFSDIEDKNLNVQTKGGWVAMLQQYFATAWIPHDSG--VNTFYTANLGNGQAAIG 296

Query: 289 FSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFM 348
           + A  +++ P      +  L+ G +    +         P  ++ +D+GW +FI++P+F 
Sbjct: 297 YKAPSVSVAPNTEQVLSTTLWVGPELQSDMAAVA-----PHLDLTVDYGWLWFISQPLFK 351

Query: 349 LMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPP 408
           L+   ++ VGN+G AI++ T  V+ + +PL K QY S A M+ +QPK+  +RE+      
Sbjct: 352 LLQLIHSFVGNWGFAIIIITFIVRGIMYPLTKAQYTSMAKMRMLQPKLQAMRERIGDDK- 410

Query: 409 QVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAA 468
           Q + + M+ LYK   +NPL GC+P+L+Q+P+F A+Y ++  S+E+R APF  WI DLAA 
Sbjct: 411 QRMSQEMMALYKAEKVNPLGGCFPLLIQMPIFLALYYMLMGSVELRQAPFALWIHDLAAP 470

Query: 469 DPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVF 527
           DP                     I PI+M ++MF   KMSP    D  Q  I+ +MPV+F
Sbjct: 471 DPYY-------------------ILPILMGVTMFFIQKMSPTTVTDPMQQKIMTFMPVIF 511

Query: 528 VFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
                 FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 512 TVFFLWFPSGLVLYYIVSNLVTIIQQQLIYR 542


>gi|224827183|ref|ZP_03700278.1| 60 kDa inner membrane insertion protein [Lutiella nitroferrum 2002]
 gi|224600576|gb|EEG06764.1| 60 kDa inner membrane insertion protein [Lutiella nitroferrum 2002]
          Length = 550

 Score =  343 bits (878), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 143/576 (24%), Positives = 241/576 (41%), Gaps = 41/576 (7%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
             +    + I LS+ I+  WQ ++          +    QT         + +A      
Sbjct: 1   MDSKRLIIFIVLSMSILLLWQEYFAPKP---TPQQLAKSQTTAGAPGAPAAPSAAAQPAD 57

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
           A  L+   R+ +        I+  G     L+L  ++    ++ P    L        Y 
Sbjct: 58  AAKLTSGQRITVSTDLYKAEIDTVGGDLRRLDLLKHNAAEDASKPFE--LFTDKGGRVYV 115

Query: 122 AELDYVSTANNI-ELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD-EHYL 179
           A+   V+ +N       +       S ++      +KL    AN +   +  +     Y 
Sbjct: 116 AQTGLVAASNPALPTHKTVFTAEKTSYQMNGDKLEVKLTAPEANGVKVSKVYTFKKGAYD 175

Query: 180 FKIVDTVTNNSIDQIRFSPRGRIMRHK--PQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
             +   ++N+    +  +   R++R    P+          G      D    +  + D+
Sbjct: 176 IDVRYDISNSGSAPVAPTAYFRLLRDGQKPEGEGRFASTFTGPAVYTTDGKFQKVSFDDL 235

Query: 238 EKSSISNFHE-SNSWLGISDKYWASVFIPSKETSFHSQFK------YLSDGHARYQAKFS 290
            K          N W+ +   Y+ S +I                   L   +  + A   
Sbjct: 236 TKGKGDYVKSADNGWVSMLQHYFMSAWIIKPLGGQSVCAAGQPCRFELKSSNGLFSAATL 295

Query: 291 ANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLM 350
            +   I PG S + T  L+AG +EF  I            E   D+GW +  A P+F L+
Sbjct: 296 VDLPAIAPGASRSITVPLYAGPEEFDIITKVAD-----GMEYAKDYGWVHIFASPLFWLL 350

Query: 351 SYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQV 410
           +  + LV N+G AI+L T+ VK LF+PL    Y S   MK + P+++ L+E++     ++
Sbjct: 351 TKLHALVNNWGWAIILLTLTVKALFYPLTAASYRSMGKMKALAPRLERLKEQYGDDRMKM 410

Query: 411 LQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADP 470
            Q+A++++YK+  +NPL GC P+++QIPVF  +Y  +  S+E+R AP+  WI DLA  DP
Sbjct: 411 -QQAVMEMYKSEKVNPLGGCLPMVIQIPVFIGLYWSLLASVELRQAPWTLWINDLARPDP 469

Query: 471 TNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFA 530
                                + P IM+++MF+Q  ++PPPAD  QA ++  MP+ F   
Sbjct: 470 FY-------------------VLPAIMAITMFLQTFLNPPPADPMQAKMMKIMPLAFSAM 510

Query: 531 LSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGL 566
              FPAGL++YW  +NV+SI QQ  I K       L
Sbjct: 511 FFFFPAGLVLYWVVNNVLSIAQQWYINKQIEKAKKL 546


>gi|254427853|ref|ZP_05041560.1| 60Kd inner membrane protein [Alcanivorax sp. DG881]
 gi|196194022|gb|EDX88981.1| 60Kd inner membrane protein [Alcanivorax sp. DG881]
          Length = 582

 Score =  343 bits (878), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 147/609 (24%), Positives = 244/609 (40%), Gaps = 74/609 (12%)

Query: 1   MERNWNYFV--AIALSVIIVYAWQ---NFYVYPRIEEMNNER---------------KNI 40
           ME      +     +S +++ AWQ        P   E   E+                  
Sbjct: 1   MEIQRALVITGIAVVSYLMIQAWQRDHADSATPVPVEQVAEQGSPSSADSADLPAPQPET 60

Query: 41  QTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLD 100
           +      Q D         D     + S R+E+    L   IN  G     L L  Y   
Sbjct: 61  ENSIPAAQADGDQPVAPQIDTPDTATSSRRIEVSTDVLRVEINPVGGDIVRLALPDYPKH 120

Query: 101 VSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLV- 159
           + +       +  SN+    +     +   N  +       W+             +L  
Sbjct: 121 IDTPDQPFVFMDQSNS--GTYVAQSGLVGKNGTDSSKGRPHWSSAQQSYQLAEGSNELNV 178

Query: 160 ----FKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTAT---- 211
                ++    + +R       YL ++   V NN       +  G+I R           
Sbjct: 179 DLTLTQDNGAEIIKRYTFEKGSYLVRVSHIVRNNGSSPWTGALYGQIKRDGSDDPGLSTT 238

Query: 212 --NTFGVQEGFIAVLGDKSLVEQKYSDIEKSSIS-NFHESNSWLGISDKYWASVFIPSKE 268
                    G      +K   +  + D+ +  +  +      WL +   Y+ S +IP  +
Sbjct: 239 GFAPMPTYLGAAYWNPEKPYNKLTFDDMSEDGVKLDQTVEGGWLAMVQHYFVSAWIPDAK 298

Query: 269 TSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIP 328
              H    YL     +Y  +F +   T+ PG+        +AG K+   +         P
Sbjct: 299 QKNHYSSVYLQ-SRDQYLLRFVSPNTTVQPGEESVLYAEFYAGPKQQDNLEAIS-----P 352

Query: 329 RFEMLIDWGWFYFIAKPMFMLMSYFYNL--------------VGNFGIAIMLTTVFVKLL 374
              M +D+GW +FI++P+F L+ +  +               VGN+G+AI+L T  +K +
Sbjct: 353 GLNMTVDYGWLWFISQPIFALLVFLQSGEVSVFGMDIDIGGGVGNWGVAIILLTFIIKAI 412

Query: 375 FFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPIL 434
           FF L+   Y S A M+ + P++  ++E+ K    Q  Q   + L+K   INPL GC P+L
Sbjct: 413 FFKLSATSYRSMAKMRKVAPEMQRIKEQNKNDK-QKQQMETMNLFKREKINPLGGCLPML 471

Query: 435 LQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWP 494
           +Q+PVF A+Y V+  S+E+R APF+ WI DL+  DP                     + P
Sbjct: 472 VQMPVFIALYYVLLESVELRQAPFFLWINDLSVMDPYF-------------------VLP 512

Query: 495 IIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQA 554
           I+M  SMF+Q +++P PAD  QA ++ WMP++F   +  FPAGL++YW  +N++SI QQ 
Sbjct: 513 ILMGASMFLQTRLNPTPADPTQAQVMKWMPMIFAVFMLWFPAGLVLYWLTNNILSIAQQW 572

Query: 555 VIMKMHGAE 563
           +I +    E
Sbjct: 573 IITRKIENE 581


>gi|300725384|ref|YP_003714723.1| preprotein translocase [Xenorhabdus nematophila ATCC 19061]
 gi|297631940|emb|CBJ92665.1| preprotein translocase, cooperates with SecYEG and SecDFyajC
           translocon, membrane component [Xenorhabdus nematophila
           ATCC 19061]
          Length = 544

 Score =  343 bits (878), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 132/574 (22%), Positives = 244/574 (42%), Gaps = 55/574 (9%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL  +    WQ +      E   N +   Q  +Q +             
Sbjct: 1   MDSQRNLLL-IALLFVSFLVWQAW------ESDKNPQPAAQITQQTS---------PTLT 44

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
              +      + +K   L   IN +G   ++ +L  Y   + S +P   L   +  +  Y
Sbjct: 45  SEASNEQGKLITVKTDVLSLHINTRGGDIEEADLLAYPDTLGSQTPFKLL--ETTPEFTY 102

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTP----IKLVFKNANNILFERTISLDE 176
            A+                      +  +L                   +  +  +    
Sbjct: 103 QAQSGLTGANGPDNQAERPLYHTTQNSFVLADGQDELRIPMTYTAPDGVVYVKTFVLKRG 162

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRH-----KPQTATNTFGVQEGFIAVLGDKSLVE 231
           +Y   +  ++ N +   ++ +  G++ +         T ++ F +     A         
Sbjct: 163 NYAVSVDYSINNVTDKPLQMAFFGQLKQSVDVPKHRDTGSSNFALHTYRGAAYSSDEAKY 222

Query: 232 QKY-SDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFS 290
           +KY  D  +S          W+ +  +Y+A+ ++P +  + +  +             + 
Sbjct: 223 EKYKFDEIESKALAVTTKGGWVAMLQQYFATAWVPGEGKTSNF-YTIDLKNQKMAIIGYK 281

Query: 291 ANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLM 350
              I I P      ++ L+ G +    +         P  ++ +D+GW +FI++P+F L+
Sbjct: 282 GENINIAPNSQQNISSTLWVGPEVQDKMAAVA-----PHLDLTVDYGWLWFISQPLFKLL 336

Query: 351 SYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQV 410
            + +  +GN+G +I+  T  V+ + +PL K QY S A M+ +QPKI  +RE+F     Q 
Sbjct: 337 KFLHEYIGNWGFSIIAITFIVRGIMYPLTKAQYTSMAKMRLLQPKITAMRERFGD-DRQR 395

Query: 411 LQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADP 470
           + + M+ LYKT  +NPL GC P+++Q+P+F A+Y ++  S+E+RHAPF GWI DL+A DP
Sbjct: 396 MSQEMMALYKTEKVNPLGGCLPLVIQMPIFLALYYMLMGSVELRHAPFIGWINDLSAQDP 455

Query: 471 TNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVF 529
                                I P++M ++MF+  K+SP    D  Q  I+ +MPV+F  
Sbjct: 456 YY-------------------ILPLLMGVTMFVIQKLSPTTVTDPMQQKIMTYMPVMFTV 496

Query: 530 ALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
               FP+GL++Y+  SN+++I+QQ VI +     
Sbjct: 497 FFLWFPSGLVLYYIVSNLVTIIQQQVIFRSLEKR 530


>gi|120600874|ref|YP_965448.1| 60 kDa inner membrane insertion protein [Shewanella sp. W3-18-1]
 gi|146295080|ref|YP_001185504.1| 60 kDa inner membrane insertion protein [Shewanella putrefaciens
           CN-32]
 gi|166977417|sp|A4YCM2|OXAA_SHEPC RecName: Full=Inner membrane protein oxaA
 gi|166977419|sp|A1RQE9|OXAA_SHESW RecName: Full=Inner membrane protein oxaA
 gi|120560967|gb|ABM26894.1| protein translocase subunit yidC [Shewanella sp. W3-18-1]
 gi|145566770|gb|ABP77705.1| protein translocase subunit yidC [Shewanella putrefaciens CN-32]
 gi|319428593|gb|ADV56667.1| inner membrane insertase, YidC [Shewanella putrefaciens 200]
          Length = 541

 Score =  343 bits (878), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 142/564 (25%), Positives = 240/564 (42%), Gaps = 39/564 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           ME   N  + I L  +    WQ +      + +  E   +  V   +  D   A   +  
Sbjct: 1   MESQRN-ILLIGLLFVSFLLWQQWQADKAPKPVATESSLVANVASTHSADVPEADTGVPA 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
              A      + +K   L   IN  G       L  + ++     P V L    +    Y
Sbjct: 60  AVAASKN--LITVKTDQLDVQINPVGGDIVFAALVSHKMEQGKEQPFVLLEQTKD--YTY 115

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLD- 175
            A+   +         N    +   + +        T  + L +   N + + +      
Sbjct: 116 IAQSGLIGRDGIDSSANGRAAFTTSATEFTLAEGQDTLEVPLTYVADNGVTYTKVFVFHR 175

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
             +   +   + N S   ++    G+I +    + ++         A   +    E+   
Sbjct: 176 GKFNVDVDYKINNTSAAPLQVQMYGQIKQTIKPSESSMMMPTYRGGAFSTNDVRYEKYNF 235

Query: 236 DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
           D    S  N      W  +   Y+ S ++P    S        + G A     F      
Sbjct: 236 DDMAKSNLNQATLGGWAAMLQHYFVSAWVPPATDSNTIFSSVSAGGLAN--IGFRGAVYD 293

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           I PG S   ++  + G K+   +    +        +++D+G+ +++A P+  L+ ++ +
Sbjct: 294 IAPGASQEISSQFYVGPKDQAALSAISET-----LNLVVDYGFLWWLAVPIHWLLMFYQS 348

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
            VGN+G+AI+L T+ V+ L FPL K QY S A M+N+QPK+ +L+E+F     Q + +AM
Sbjct: 349 FVGNWGVAIILITLTVRGLLFPLTKAQYTSMAKMRNLQPKLADLKERFGD-DRQKMGQAM 407

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           ++LYK   +NP+ GC PI+LQ+P+F A+Y V+  S E+RHAPF  WI DL+  DP     
Sbjct: 408 MELYKKEKVNPMGGCLPIILQMPIFIALYWVLLESFELRHAPFMLWIHDLSVQDPYY--- 464

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSP--PPADKGQAMILNWMPVVFVFALSS 533
                           I P++M +SMFI  KM P  P  D  Q  ++ WMPV+F      
Sbjct: 465 ----------------ILPLLMGVSMFIMQKMQPIAPTMDPMQVKMMQWMPVIFTVFFLW 508

Query: 534 FPAGLIIYWSWSNVISIVQQAVIM 557
           FP+GL++YW   N+++I+QQ +I 
Sbjct: 509 FPSGLVLYWLVGNIVAIIQQKIIY 532


>gi|51244707|ref|YP_064591.1| hypothetical protein DP0855 [Desulfotalea psychrophila LSv54]
 gi|50875744|emb|CAG35584.1| conserved hypothetical membrane protein [Desulfotalea psychrophila
           LSv54]
          Length = 553

 Score =  343 bits (878), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 148/570 (25%), Positives = 253/570 (44%), Gaps = 27/570 (4%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYV----YPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
                  +AI +S  I++ +Q F+       +         N  + KQ   +    A V+
Sbjct: 1   METKRALLAIVISFAILFGYQYFFPGLDQPVQTTSETQTTVNGTSAKQAGAIQEITAPVI 60

Query: 58  IDDRAQALSMSPR-VELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNT 116
               +      PR + +       +I+  G       L+      + +SP + L++ S T
Sbjct: 61  PVVASAKYDRVPRDIVVDTDLYTATISEAGGALKSFVLKEQKETNAEDSPGMQLVNNSKT 120

Query: 117 KNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLDE 176
            + Y     +   A +  L  S                 + +  K++  ++ ER  + D+
Sbjct: 121 -DGYPLTFSWGGAAPSNLLYTSQDSEVRFGSN---GKARLIMTAKSSTGLVIERVYTFDK 176

Query: 177 HYL-FKIVDTVTNNSIDQIRFS-PRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKY 234
               F +   V N S   ++ S    ++      T  N          V+     + +  
Sbjct: 177 KTYLFDLDVRVVNQSGQALQGSAQLHQVSVPYESTEDNPAARFLFMGPVVYADGELTEID 236

Query: 235 SDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
               +    +F     WLG   +Y+ S+ +P               G    ++  +    
Sbjct: 237 PKDLEDGPQSFMGDIQWLGYESRYFMSMIVPYGLDGQTFTTS---GGADLTKSFIAGGLD 293

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
           T+  G        +  G K+   +     D      +  +++GWF  IAKP   L+++F+
Sbjct: 294 TLAAGAEKEYKYHVLYGPKKVEMLKSAGYD-----LDKAVNFGWFDIIAKPTLWLLNFFH 348

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
           +   N+GIAI+L T+  K +F+P+ +K   S  NM+ +QPK+  L+EK K   P  + K 
Sbjct: 349 SFTHNYGIAIILVTIMFKGIFWPITQKGMKSMKNMQKLQPKMAALKEKHKD-DPTRMNKE 407

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           ++ LYK + +NPL GC P++LQIPVFFA+YKV+ +S+E+RHAPF  WI DL+A D   I 
Sbjct: 408 VMSLYKAYKVNPLGGCLPMVLQIPVFFALYKVLLLSIELRHAPFMFWITDLSAPDRLWIG 467

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSF 534
                  F LP    + +  ++M  SMF+Q K SP  AD  QA I+ ++PVVF F   +F
Sbjct: 468 -------FNLPYLGGLPVLTLLMGASMFLQQKFSPTTADPTQAKIMMFLPVVFTFMFLNF 520

Query: 535 PAGLIIYWSWSNVISIVQQAVIMKMHGAEI 564
            +GL++YW  +N++SI+QQ +I +    + 
Sbjct: 521 ASGLVLYWFVNNLLSILQQVLINRDVKHKT 550


>gi|50123363|ref|YP_052530.1| putative inner membrane protein translocase component YidC
           [Pectobacterium atrosepticum SCRI1043]
 gi|81693013|sp|Q6CYR0|OXAA_ERWCT RecName: Full=Inner membrane protein oxaA
 gi|49613889|emb|CAG77341.1| putative membrane protein [Pectobacterium atrosepticum SCRI1043]
          Length = 544

 Score =  342 bits (877), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 143/570 (25%), Positives = 253/570 (44%), Gaps = 51/570 (8%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL  +    WQ +      E   N     QT++Q     N+      + 
Sbjct: 1   MDSQRNLLL-IALLFVTFMLWQAW------ETDKNPPATTQTIQQAT---NAVTGDATNQ 50

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
              A      + +K   L  +IN +G   +  +L  Y   + S+ P   L   + +   Y
Sbjct: 51  GVPASGQGKLITVKTDVLSLTINTRGGDVEQAHLLAYPDILGSDKPFHLL--ETTSAFVY 108

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL-----TPTTPIKLVFKNANNILFERTISLD 175
            A+             N +    + +              I + +  A+ + + +T  L 
Sbjct: 109 QAQSGLTGKNGPDNPANGSRPLFVTTQDSFELADGQSELRIPMTYTAADGVTYTKTFVLK 168

Query: 176 -EHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-----KPQTATNTFGVQEGFIAVLGDKSL 229
              Y   +  +V N S   +  +  G++ +         T +N F +     A       
Sbjct: 169 RGDYALNVDYSVNNTSAQPLELTLFGQLKQSIDLPKHRDTGSNNFALHTYRGAAFSSSED 228

Query: 230 VEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKF 289
             +KYS  +     N   ++ W+ +  +Y+A+ +IP+   +    F     G+ +    F
Sbjct: 229 KYKKYSFSDMDEGLNITTNSGWVAMLQQYFATAWIPTTAGANT--FYTSKLGNGQAAIGF 286

Query: 290 SANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFML 349
            A  + I  G        L+ G +    +         P  ++ +D+GW +FI++P+F L
Sbjct: 287 KAAPVIIAAGSQQNLNATLWVGPEIQDKMAAVA-----PHLDLTVDYGWLWFISQPLFKL 341

Query: 350 MSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQ 409
           + + +  +GN+G +I+  T  V+ + +PL K QY S A M+ +QPK+  +RE+      Q
Sbjct: 342 LKFLHGFIGNWGFSIIAITFIVRGVMYPLTKAQYTSMAKMRLLQPKLQAMRERIGDDK-Q 400

Query: 410 VLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAAD 469
            + + M+ LYK+  +NPL GC P+++Q+P+F A+Y ++  S+E+RHAPF  WI DL+A D
Sbjct: 401 RMSQEMMALYKSEKVNPLGGCLPLVIQMPIFLALYYMLMGSVELRHAPFALWIHDLSAQD 460

Query: 470 PTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFV 528
           P                     I PI+M ++MF   KMSP    D  Q  I+ +MPV+F 
Sbjct: 461 PYY-------------------ILPILMGVTMFFIQKMSPTTVTDPMQQKIMTYMPVIFT 501

Query: 529 FALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
                FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 502 VFFLWFPSGLVMYYIVSNLVTILQQQLIYR 531


>gi|269965283|ref|ZP_06179404.1| inner membrane protein, 60 kDa [Vibrio alginolyticus 40B]
 gi|269830084|gb|EEZ84312.1| inner membrane protein, 60 kDa [Vibrio alginolyticus 40B]
          Length = 540

 Score =  342 bits (876), Expect = 9e-92,   Method: Composition-based stats.
 Identities = 144/570 (25%), Positives = 244/570 (42%), Gaps = 42/570 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + I L+++    +Q + V    E    E+    +        +    V    
Sbjct: 1   MDSQRN-ILLIGLALVSFLLFQQWQVAKNPEPQAVEQAQSSSTLPAPSFADELDPVPGQQ 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           +A A      + +    L  SI+  G      NL  Y  ++ S+   V L       + +
Sbjct: 60  QASA----KTITVTTDVLTLSIDTVGGDVVHANLNEYSAELDSSDSFVLL--KDAQGHQF 113

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLV----FKNANNILFERTISLDE 176
            A+   V          +   +N+ +          +L     F        +  I    
Sbjct: 114 IAQSGLVGPQGIDLSSTNRPHYNVSADSFTMADGQDELRVPMTFTANGIEYTKTYIFKRG 173

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYS 235
            Y   +   V NNS +   F     + ++      + T     G      D    +  + 
Sbjct: 174 SYALNVEYDVVNNSGNNATFGMYAHLRQNLMDDGGSITMPTYRGGAYSTEDTRYKKYSFD 233

Query: 236 DIEKSSISNFHES-NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
           D++  ++S        W  +   Y+A+ +IP  E   +   + + +              
Sbjct: 234 DMQDRNLSLNLADGQGWAAMIQHYFAAAWIPRNEPGTNLYTRVIGNLGD---IGVRMPNK 290

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
           TI  G        L+ G K    +         P  ++++D+GW +FIAKP+ ML+S+  
Sbjct: 291 TIATGDQAKFEATLWVGPKLQDEMAEVA-----PNLDLVVDYGWLWFIAKPLHMLLSFIQ 345

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
           + VGN+G+AI+  T  V+   +PL K QY S A M+ +QPK+  +RE+      Q + + 
Sbjct: 346 SFVGNWGVAIICLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLQAMRERIGD-DRQRMSQE 404

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           M++LYK   +NPL GC P++LQ+P+F A+Y  +  S+E+RH+PF+GWI DL+A DP    
Sbjct: 405 MMELYKKEKVNPLGGCLPLILQMPIFIALYWALMESVELRHSPFFGWIHDLSAQDPYY-- 462

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSS 533
                            I P++M  SMF+  KMSP    D  Q  I+ +MPV+F F    
Sbjct: 463 -----------------ILPLLMGASMFLIQKMSPTTVTDPMQQKIMTFMPVMFTFFFLF 505

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           FP+GL++YW  SN+++++QQ +I K    +
Sbjct: 506 FPSGLVLYWLVSNIVTLIQQTLIYKGLEKK 535


>gi|254496743|ref|ZP_05109602.1| inner membrane protein, 60 kDa [Legionella drancourtii LLAP12]
 gi|254354038|gb|EET12714.1| inner membrane protein, 60 kDa [Legionella drancourtii LLAP12]
          Length = 558

 Score =  342 bits (876), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 144/585 (24%), Positives = 263/585 (44%), Gaps = 44/585 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYV-YPRIEEMNNERKNIQTVKQP-----NQVDNSYA 54
           M+        +AL+++ +  W  + V YP  +       N Q   +P         NS  
Sbjct: 1   MDI-RRIISYMALALVSLSLWNAWQVDYPPQQTTVANSSNQQRTDEPLLPEMGTSGNSAG 59

Query: 55  AVLIDDRAQAL--SMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLS 112
           A L++  A+      +P V++K   L  +I+L+        L  Y L V   +    LL 
Sbjct: 60  ATLVNPVAEQTRTQSAPLVQVKTDVLNVAIDLQQGDIVSGQLLDYPLSVDEKNKPFPLLQ 119

Query: 113 PSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTP--IKLVFKNANNILFER 170
               +        +++    ++  +          ++        + L  K  +  + + 
Sbjct: 120 DDANERYVANSNLFIAAGQAVKALDFAFTTEQPQYELAANQNQLVVTLNGKEDDLAVSKE 179

Query: 171 TISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIA----VLGD 226
            I     YL  +   + N    + +     +++R  P+   ++      +        G 
Sbjct: 180 FIFTKGSYLIDVNYKIVNKGSSEWKGYMNTQLLRSSPKEDKSSVFHVGSYTGASYSEPGK 239

Query: 227 KSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQ 286
               +  +SD+ K+++     +  W+ +   Y+ S +IP  +       + ++     Y 
Sbjct: 240 HHYQKVSFSDMGKANLD-VDSNGGWIAMQQHYFLSAWIPDAQGRNKFYTRSINGD---YT 295

Query: 287 AKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPM 346
               +  I + P +  T    L+ G +    +         P  ++ +D+G  +F++  +
Sbjct: 296 IGAVSQPIVVQPQEQKTVGAKLYVGPEITSVLKGIA-----PSLDLTVDYGILWFVSSLL 350

Query: 347 FMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQS 406
           F LM + YN+VGN+G +I+L TV +KL F+ L+   Y S A M+ +QPK+  LRE++   
Sbjct: 351 FSLMKWIYNVVGNWGWSIVLVTVLIKLAFYRLSATSYKSMAGMRKLQPKLQALRERYGDD 410

Query: 407 PPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLA 466
             + + +A ++LYK   +NPL GC PI++QIPVF A+Y V+  S+E+R APF  WIKDLA
Sbjct: 411 KAK-ISQATMELYKQEKVNPLGGCLPIVIQIPVFIALYWVLLESVELRQAPFIFWIKDLA 469

Query: 467 AADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVV 526
           +ADP +                   + P+IM  +M IQ K++P P D  QA ++ ++PV+
Sbjct: 470 SADPFH-------------------VLPLIMGATMLIQQKLNPAPPDPMQAKVMMFLPVL 510

Query: 527 FVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLR 571
           F     +FPAGL++YW  +N +SI+QQ  I + +  E  +   + 
Sbjct: 511 FTGLFWNFPAGLVLYWIVNNTLSILQQWYITRKYADEKPVKKLVA 555


>gi|325577779|ref|ZP_08148054.1| YidC/Oxa1 family membrane protein insertase [Haemophilus
           parainfluenzae ATCC 33392]
 gi|325160524|gb|EGC72650.1| YidC/Oxa1 family membrane protein insertase [Haemophilus
           parainfluenzae ATCC 33392]
          Length = 542

 Score =  342 bits (876), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 139/567 (24%), Positives = 253/567 (44%), Gaps = 37/567 (6%)

Query: 2   ERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDR 61
             +    + +AL  I    +Q + +              +     +    + ++   +  
Sbjct: 1   MDSRRSLLVLALLFISFLVYQQWQLDKNPPVQQQ---TTEQTTTASSDVPASSSSSAEVV 57

Query: 62  AQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYF 121
           A + +    + L+N      ++  G       L  Y  ++ S  P V L      ++ Y 
Sbjct: 58  ADSQTKGHIITLENDVFRLKVDTLGGDVISSELLKYDAELGSKEPFVLL--KDTNEHVYI 115

Query: 122 AELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDEH 177
           A+   +   N I+       + +               + L  +       +  +   + 
Sbjct: 116 AQSGLIG-KNGIDTKAGRAQYQVTGDNFKLAEGQNELSVPLTLEKDGVTYRKIFVLKRDS 174

Query: 178 YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDI 237
           Y   +   + N S   I   P G++     +++ N         A    ++  ++     
Sbjct: 175 YDVGVNFEIVNQSGSAIEVEPYGQLKHTLVESSGNVAMPTYTGGAYSSSETNYKKYSFSD 234

Query: 238 EKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITIL 297
            K    +      W+ +   Y+ S +IP+++ +    +      +      +    ++I 
Sbjct: 235 MKDKNLSIDTKAGWVAVLQHYFVSAWIPNQDVNNQL-YSITDSKNNVASIGYRGPVVSIP 293

Query: 298 PGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLV 357
            G + T T+ L+ G K    +            ++ +D+GW +FIAKP+F L+++  ++V
Sbjct: 294 AGATETITSSLWTGPKLQNKMAEVAN-----HLDLTVDYGWAWFIAKPLFWLLTFIQSIV 348

Query: 358 GNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQ 417
            N+G+AI+  T+ VK + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++
Sbjct: 349 SNWGVAIICVTLVVKAILYPLTKAQYTSMAKMRMLQPKMQEMRERFGD-DRQRMSQEMMK 407

Query: 418 LYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLF 477
           LYK   +NPL GC P++LQ+P+F A+Y     ++E+RHAPF+GWI+DL+A DP       
Sbjct: 408 LYKEEKVNPLGGCLPLILQMPIFIALYWTFMEAVELRHAPFFGWIQDLSAQDPYY----- 462

Query: 478 GILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPA 536
                         I PI+M  SMF+  KMSP P AD  Q  ++N+MP++F+F    FPA
Sbjct: 463 --------------ILPILMGGSMFLLQKMSPTPVADPMQQKVMNFMPLIFMFFFLWFPA 508

Query: 537 GLIIYWSWSNVISIVQQAVIMKMHGAE 563
           GL++YW  SN+I+IVQQ +I +    +
Sbjct: 509 GLVLYWLVSNLITIVQQQMIYRGLEKK 535


>gi|261823805|ref|YP_003261911.1| inner membrane protein translocase component YidC [Pectobacterium
           wasabiae WPP163]
 gi|261607818|gb|ACX90304.1| membrane protein insertase, YidC/Oxa1 family domain containing
           [Pectobacterium wasabiae WPP163]
          Length = 543

 Score =  342 bits (876), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 134/570 (23%), Positives = 242/570 (42%), Gaps = 52/570 (9%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL  +    WQ +             +        +  +          
Sbjct: 1   MDSQRNLLL-IALLFVTFMLWQAWETDKNPPATTQAIQQATNAVTGDATNQGVP------ 53

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
              A      + +K   L  +IN +G   +  +L  Y   + S+ P   L   +  +  Y
Sbjct: 54  ---ASGQGKLITVKTDVLSLTINTRGGDVEQAHLLAYPDTLGSDKPFHLL--ETTPEFVY 108

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL-----TPTTPIKLVFKNANNILFERTISLD 175
            A+             N        +              I + +  A+ + + +T  L 
Sbjct: 109 QAQSGLTGKNGPDNPANGPRPLFTTTQDSFELADGQSELRIPMTYTAADGVTYTKTFVLK 168

Query: 176 -EHYLFKIVDTVTNNSIDQIRFSPRGRIMRH-----KPQTATNTFGVQEGFIAVLGDKSL 229
              Y   +  +V N S   +  +  G++ +         T ++ F +     A       
Sbjct: 169 RGDYALNVDYSVNNTSAQPLELTLFGQLKQSTELPKHRDTGSSNFALHTYRGAAFSSSED 228

Query: 230 VEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKF 289
             +KYS  +     N   ++ W+ +  +Y+A+ +IP+   +        +   A     F
Sbjct: 229 KYKKYSFGDMDEGLNITTNSGWVAMLQQYFATAWIPTTAGANTFFTSKDNGQAA---IGF 285

Query: 290 SANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFML 349
            A  + +  G        L+ G +    +         P  ++ +D+GW +FI++P+F L
Sbjct: 286 KATPVVVAAGSQQNLNATLWVGPEIQDKMAAVA-----PHLDLTVDYGWLWFISQPLFKL 340

Query: 350 MSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQ 409
           + + +  +GN+G +I+  T  V+ + +PL K QY S A M+ +QPK+  +RE+      Q
Sbjct: 341 LKFLHGFIGNWGFSIIAITFIVRGVMYPLTKAQYTSMAKMRLLQPKLQAMRERIGDDK-Q 399

Query: 410 VLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAAD 469
            + + M+ LYK+  +NPL GC P+++Q+P+F A+Y ++  S+E+RHAPF  WI DL+A D
Sbjct: 400 RMSQEMMALYKSEKVNPLGGCLPLVIQMPIFLALYYMLMGSVELRHAPFALWIHDLSAQD 459

Query: 470 PTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFV 528
           P                     I PI+M ++MF   KMSP    D  Q  I+ +MPV+F 
Sbjct: 460 PYY-------------------ILPILMGVTMFFIQKMSPTTVTDPMQQKIMTYMPVIFT 500

Query: 529 FALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
                FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 501 VFFLWFPSGLVMYYIVSNMVTILQQQLIYR 530


>gi|53802852|ref|YP_115424.1| inner membrane protein, 60 kDa [Methylococcus capsulatus str. Bath]
 gi|81680702|sp|Q602M6|OXAA_METCA RecName: Full=Inner membrane protein oxaA
 gi|53756613|gb|AAU90904.1| inner membrane protein, 60 kDa [Methylococcus capsulatus str. Bath]
          Length = 545

 Score =  342 bits (876), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 143/553 (25%), Positives = 249/553 (45%), Gaps = 40/553 (7%)

Query: 14  SVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVEL 73
           S ++   WQ  Y          +  +      P +  +  + V +   A     S R+ +
Sbjct: 16  SFLLWEQWQIDYGPKPQAVAQTDGASRPAGDLPQRPSDDESDVTVHTEAPTQEGSRRIRV 75

Query: 74  KNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNI 133
               L   I+ +G     L+L  Y +        V LL+     + + A+  ++  A   
Sbjct: 76  HTDVLSLEIDTRGGDLRQLDLLNYPVSKEQPDRPVRLLTDQG--DIFVAQSGFIGAAQ-- 131

Query: 134 ELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLD-EHYLFKIVDTVTN 188
           ++PN +++W   +G+           + L + +   +   +T  L    YL  +  T+ N
Sbjct: 132 QVPNHHSLWQAEAGEYRLQDGQDILRVPLTWSDGQGVTVTKTYILRRGSYLIDMEQTIDN 191

Query: 189 NSIDQIRFSPRGRIMRHKPQ---TATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNF 245
            S          ++ R +P      +       G +    DKS  +  + D+   ++   
Sbjct: 192 RSNTNWTGRQYMQLQRKEPTSAQEDSQFIRTYTGGVLHTEDKSYEKIAFKDMASGNLDA- 250

Query: 246 HESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTT 305
                W+ +   Y+ + ++P  E    S F   +     +     +    +  G S T  
Sbjct: 251 KSRQGWIAMIQHYFLAAWVPPAEDE--STFYTKALADRVFVIGAYSPPAEVPAGSSQTLK 308

Query: 306 NFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIM 365
             LFAG K    +         P  E+  D+G    IAKP++ L+  F+    N+G AI+
Sbjct: 309 ARLFAGPKLQHVLEGIA-----PGLELTADFGILTVIAKPIYWLLETFHGFFNNWGWAII 363

Query: 366 LTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNIN 425
             T+ +K LFF L++  Y S ANM+ +QPK+ EL+E++     Q   +AM++LY+   +N
Sbjct: 364 FVTLVIKALFFKLSEASYRSMANMRKLQPKLVELKERY-GEDRQRYNQAMMELYRKEKVN 422

Query: 426 PLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLP 485
           PL GC PIL+QIPVF ++Y V+  S+++R APF  W+ DL++ DP               
Sbjct: 423 PLGGCLPILVQIPVFISLYWVLVESVDLRQAPFLLWLDDLSSKDPYF------------- 469

Query: 486 GFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWS 545
                 + P+IM +SMFIQ +++PPP D  QA ++ + P+VF      FP+GL++YW  +
Sbjct: 470 ------VLPLIMGVSMFIQQRLNPPPTDPIQARVMQFFPLVFTVFFLFFPSGLVLYWVVN 523

Query: 546 NVISIVQQAVIMK 558
           N++SI+QQ  I +
Sbjct: 524 NILSIIQQWYITR 536


>gi|269140892|ref|YP_003297593.1| 60 kDa inner membrane insertion protein [Edwardsiella tarda EIB202]
 gi|267986553|gb|ACY86382.1| 60 kDa inner membrane insertion protein [Edwardsiella tarda EIB202]
 gi|304560650|gb|ADM43314.1| OxaI/YidC membrane insertion protein [Edwardsiella tarda FL6-60]
          Length = 541

 Score =  342 bits (876), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 142/571 (24%), Positives = 250/571 (43%), Gaps = 56/571 (9%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N F+ +AL  +    WQ +      + +        +      V  S        
Sbjct: 1   MDSQRNLFL-VALLFVSFLIWQAWQTDNNPQPVAQTAGQSVSDTASQAVPESG------- 52

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
                     + +K   L  +IN +G   +  +L  Y   + SN+P   L   +  +  Y
Sbjct: 53  ------QGKLITVKTDVLALTINTRGGDIEQADLLAYPATLGSNTPFQLL--ETTPQFVY 104

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL-----TPTTPIKLVFKNANNILFERTISLD 175
            A+      +      N        +              I L +  AN +++ +T  L 
Sbjct: 105 QAQSGLTGKSGPDNPANGARPLYSANQTSYEMLPGQDELRIPLTYTAANGVIYTKTFVLK 164

Query: 176 EHYL-FKIVDTVTNNSIDQIRFSPRGRIMRH-----KPQTATNTFGVQEGFIAVLGDKSL 229
            +     +   V N+S D +  +  G++ +         T +N F +     A       
Sbjct: 165 RNDYAIAVDYKVKNDSHDALDLTLFGQLKQSVDLPKHRDTGSNNFALHTFRGAAYSSSDD 224

Query: 230 VEQKY-SDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAK 288
             QKY     +    N      W+ +  +Y+A+ +IP       + F   + G+ +    
Sbjct: 225 KYQKYSFSDIEDKNLNVQTKGGWVAMLQQYFATAWIPHDSG--VNTFYTANLGNGQAAIG 282

Query: 289 FSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFM 348
           + A  +++ P      +  L+ G +    +         P  ++ +D+GW +FI++P+F 
Sbjct: 283 YKAPSVSVAPNTEKVLSTTLWVGPELQSDMAAVA-----PHLDLTVDYGWLWFISQPLFK 337

Query: 349 LMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPP 408
           L+   ++ VGN+G AI++ T  V+ + +PL K QY S A M+ +QPK+  +RE+      
Sbjct: 338 LLQLIHSFVGNWGFAIIIITFIVRGIMYPLTKAQYTSMAKMRMLQPKLQAMRERIGDDK- 396

Query: 409 QVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAA 468
           Q + + M+ LYK+  +NPL GC+P+L+Q+P+F A+Y ++  S+E+R APF  WI DLAA 
Sbjct: 397 QRMSQEMMALYKSEKVNPLGGCFPLLIQMPIFLALYYMLMGSVELRQAPFALWIHDLAAP 456

Query: 469 DPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVF 527
           DP                     I PI+M ++MF   KMSP    D  Q  I+ +MPV+F
Sbjct: 457 DPYY-------------------ILPILMGVTMFFIQKMSPTTVTDPMQQKIMTFMPVIF 497

Query: 528 VFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
                 FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 498 TVFFLWFPSGLVLYYIVSNLVTIIQQQLIYR 528


>gi|311109680|ref|YP_003982533.1| preprotein translocase subunit YidC [Achromobacter xylosoxidans A8]
 gi|310764369|gb|ADP19818.1| preprotein translocase subunit YidC [Achromobacter xylosoxidans A8]
          Length = 558

 Score =  342 bits (876), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 143/587 (24%), Positives = 246/587 (41%), Gaps = 48/587 (8%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVY--------PRIEEMNNERKNIQTVKQPNQVDNS 52
           M+      + +  S  ++  W N+ ++        P      +E +       P+     
Sbjct: 1   MDI-RRTVLWMIFSFSLLLLWNNWQIHNGKPSLFGPTPAATTSEPQAAANNATPSVPSAP 59

Query: 53  YAAVLIDDRAQALS-----MSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPI 107
             A          +      S  V +    L  + +  GAQ     L  Y      + P 
Sbjct: 60  VPATAAASAVPGAAAPVAARSEEVVITTDVLRLTFDTMGAQLVRAELLKYPATGQPDKPT 119

Query: 108 VTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKIL--TPTTPIKLVFKNANN 165
           V L         Y  +   V   N    P   T + ++S +         +    ++   
Sbjct: 120 VLL--DRAAGLNYVVQTGVVGAPNGQSFPTHQTPFRIVSSERQLTGDNLVVAFEGESGGV 177

Query: 166 ILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHK--PQTATNTFGVQEGFIAV 223
            + +        Y   +   + N     +  +   ++ R    P   ++ +    GF   
Sbjct: 178 KVTKTFTLHRGRYDVDVRHDLANVGAAPVSPALYLQLERDGNDPADTSSFYHTFTGFAVY 237

Query: 224 LGDKSLVEQKYSDIEKSSISNF-HESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGH 282
                  +  +SDIEK   S      N W+ +   Y+A+ ++P +     ++   +    
Sbjct: 238 SEQDKFQKITFSDIEKKKASYIKQSDNGWIAVVQHYFATAWVPPQGKQRTNELLEVQKN- 296

Query: 283 ARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFI 342
             Y A+       I PG +    + L+ G ++   +         P  E+++D+GW   I
Sbjct: 297 -LYAARSIEAVGEIAPGAATRVDSHLWVGPQDQKAMAALA-----PGLELVVDYGWLTII 350

Query: 343 AKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREK 402
           AKP+F LM++ ++L+GN+G  I+  TV +K +F+PLA   Y S A MK + P++  L+EK
Sbjct: 351 AKPLFKLMTWLHSLLGNWGWTIVALTVLIKAVFYPLAAASYRSMARMKQVAPRLQALKEK 410

Query: 403 FKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWI 462
           +     Q L  AM+++Y+T  INPL GC P+++QIPVF ++Y V+  S+EMR AP+  W+
Sbjct: 411 YGDDK-QKLNAAMMEMYRTEKINPLGGCLPMVVQIPVFISLYWVLLASVEMRGAPWILWV 469

Query: 463 KDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNW 522
            DL+  DP                     I P IM  +MF+Q+K++P P D  QA ++  
Sbjct: 470 HDLSIRDPYF-------------------ILPAIMMATMFLQIKLNPTPPDPIQAKVMMI 510

Query: 523 MPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDR 569
           MP+VF   +  FPAGL++YW  +N +SI QQ  I +    +      
Sbjct: 511 MPLVFGGMMFFFPAGLVLYWCVNNTLSIAQQWSITRAMQRKTEAAAN 557


>gi|152979764|ref|YP_001345393.1| putative inner membrane protein translocase component YidC
           [Actinobacillus succinogenes 130Z]
 gi|171704505|sp|A6VR61|OXAA_ACTSZ RecName: Full=Inner membrane protein oxaA
 gi|150841487|gb|ABR75458.1| 60 kDa inner membrane insertion protein [Actinobacillus
           succinogenes 130Z]
          Length = 537

 Score =  342 bits (876), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 137/553 (24%), Positives = 244/553 (44%), Gaps = 41/553 (7%)

Query: 15  VIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELK 74
            I    +Q + +    + +  E    Q+    +   ++ A         + +    + L+
Sbjct: 14  FISFLVYQQWEIDKAPKPVVRETAVSQSDTPNSSSASTSAV-------DSQAKGRVITLQ 66

Query: 75  NPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAYFAELDYVSTANNIE 134
           N      ++  G    +  L  Y  +++       L +   T   Y A+   V       
Sbjct: 67  NDVFRLKVDTLGGDVIESELLNYAQELNGEERFTLLENKDGT--TYVAQSGLVGKNGIDS 124

Query: 135 LPNSNTVWNLISG---KILTPTTPIKLVFKNANNILFERTISLDEHYLFKIVDTVTNNSI 191
                                   +   F+    I  +  +     Y   +   + N S 
Sbjct: 125 AAGRADYQVNGDNFVLAEGQDELSVPFTFEKDGVIYRKIFMLKRGSYDIAVNYEIRNQSD 184

Query: 192 DQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSW 251
           + I   P G++     +++ +         A    ++  ++   D  K +  + +    W
Sbjct: 185 ETIEVQPYGQLKHTLVESSGSMAMPTYTGGAYSSSETNYKKYSFDDMKGANLSVNTKAGW 244

Query: 252 LGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAG 311
           + +   Y+ S +IP+++        Y +  +      F    +T+  G + T    L+ G
Sbjct: 245 VAVLQHYFVSAWIPNQDADNQL---YTTTNNGMGFIGFRGPTVTVPAGATETVKTALWTG 301

Query: 312 AKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFV 371
            K    +    +       ++ +D+GW +FIAKP+F L++   +LV N+G+AI+  T+ V
Sbjct: 302 PKLQNQMGEVAE-----HLDLTVDYGWAWFIAKPLFALLTLIQSLVSNWGLAIIGVTLVV 356

Query: 372 KLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCW 431
           K + +PL K QY S A M+ +QPK+ E+RE+F     Q + + M++LYK   +NPL GC 
Sbjct: 357 KAILYPLTKAQYTSMAKMRMLQPKLQEMRERFGD-DRQRMSQEMMKLYKEEKVNPLGGCL 415

Query: 432 PILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVG 491
           P+L+Q+P+F A+Y     ++E+RHAPF+GWI+DL+A DP                     
Sbjct: 416 PLLIQMPIFIALYWTFMEAVELRHAPFFGWIQDLSAQDPYY------------------- 456

Query: 492 IWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISI 550
           I P++M  SMF+  K+SP P AD  Q  ++N+MPV+F      FPAGL++YW  SNVI+I
Sbjct: 457 ILPLLMGGSMFLLQKLSPTPVADPMQQKVMNFMPVIFTVFFLWFPAGLVLYWLVSNVITI 516

Query: 551 VQQAVIMKMHGAE 563
           +QQ +I +    +
Sbjct: 517 IQQQLIYRGLEKK 529


>gi|114049516|ref|YP_740066.1| protein translocase subunit yidC [Shewanella sp. MR-7]
 gi|123030126|sp|Q0HPE6|OXAA_SHESR RecName: Full=Inner membrane protein oxaA
 gi|113890958|gb|ABI45009.1| protein translocase subunit yidC [Shewanella sp. MR-7]
          Length = 541

 Score =  342 bits (876), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 141/564 (25%), Positives = 236/564 (41%), Gaps = 39/564 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           ME   N  + I L  +    WQ +      + +  E   +      +  D   A   +  
Sbjct: 1   MESQRN-ILLIGLLFVSFLLWQQWQADKAPKPVATESSVVANATTNHSADVPEADTGVPA 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
              A      + +K   L   IN  G       L  + L+   + P V L    +    Y
Sbjct: 60  AMTATQN--LITVKTDQLDVQINPVGGDIVFAALVSHKLEQGKDQPFVLLEQTKD--FTY 115

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLD- 175
            A+   +              +     +        T  + L +   N + + +      
Sbjct: 116 IAQSGLIGRDGIDSSAKGRAAFAASKTEFTLADGQDTLEVPLTYVADNGVTYTKVFVFHR 175

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
             +   I   + N S   ++    G+I +    + ++         A        E+   
Sbjct: 176 GKFNVDIDYKINNTSAAPLQVQMYGQIKQTIKPSESSMMMPTYRGAAFSTQDVRYEKYKF 235

Query: 236 DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
           +    S  N      W  +   Y+ S +IP    S        + G A     F      
Sbjct: 236 EDMSKSNLNQPTLGGWAAMLQHYFVSAWIPPATDSNTIFSSVSAGGLAN--IGFRGAVYD 293

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           I PG +   ++  + G K+   +             +++D+G+ +++A P+  L+ ++ +
Sbjct: 294 IAPGATQEISSQFYVGPKDQKALSALSDT-----LNLVVDYGFLWWLAVPIHWLLMFYQS 348

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
            VGN+G+AI+L T+ V+ L FPL K QY S A M+N+QPK+ +L+E+F     Q + +AM
Sbjct: 349 FVGNWGVAIILITLTVRGLLFPLTKAQYTSMAKMRNLQPKLQDLKERFGD-DRQKMGQAM 407

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           ++LYK   +NP+ GC PILLQ+P+F A+Y V+  S E+RHAPF  WI DL+  DP     
Sbjct: 408 MELYKKEKVNPMGGCLPILLQMPIFIALYWVLLESFELRHAPFMLWIHDLSVQDPYY--- 464

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSP--PPADKGQAMILNWMPVVFVFALSS 533
                           I P++M +SMF+  KM P  P  D  Q  ++ WMPV+F      
Sbjct: 465 ----------------ILPLLMGVSMFVMQKMQPIAPTMDPMQVKMMQWMPVIFTVFFLW 508

Query: 534 FPAGLIIYWSWSNVISIVQQAVIM 557
           FP+GL++YW   N+++I+QQ +I 
Sbjct: 509 FPSGLVLYWLVGNIVAIIQQKIIY 532


>gi|113972267|ref|YP_736060.1| protein translocase subunit yidC [Shewanella sp. MR-4]
 gi|123129963|sp|Q0HD64|OXAA_SHESM RecName: Full=Inner membrane protein oxaA
 gi|113886951|gb|ABI41003.1| protein translocase subunit yidC [Shewanella sp. MR-4]
          Length = 541

 Score =  342 bits (876), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 141/564 (25%), Positives = 235/564 (41%), Gaps = 39/564 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           ME   N  + I L  +    WQ +      + +  E   +      +  D   A   +  
Sbjct: 1   MESQRN-ILLIGLLFVSFLLWQQWQADKAPKPVATESSVVANATTNHSADVPEADTGVPA 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
              A      + +K   L   IN  G       L  + L+   + P V L    +    Y
Sbjct: 60  AMTATQN--LITVKTDQLDVQINPVGGDIVFAALVSHKLEQGKDQPFVLLEQTKD--FTY 115

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLD- 175
            A+   +              +     +        T  + L +   N + + +      
Sbjct: 116 IAQSGLIGRDGIDSSAKGRAAFAASKTEFTLADGQDTLEVPLTYVADNGVTYTKVFVFHR 175

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
             +   I   + N S   ++    G+I +    + ++         A        E+   
Sbjct: 176 GKFNVDIDYKINNTSAAPLQVQMYGQIKQTIKPSESSMMMPTYRGAAFSTQDVRYEKYKF 235

Query: 236 DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
           +    S  N      W  +   Y+ S +IP    S        + G A     F      
Sbjct: 236 EDMSKSNLNQPTLGGWAAMLQHYFVSAWIPPATDSNTIFSSVSAGGLAN--IGFRGAVYD 293

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           I PG +   ++  + G K+   +             +++D+G+ +++A P+  L+ ++ +
Sbjct: 294 IAPGATQEISSQFYVGPKDQKALSALSDT-----LNLVVDYGFLWWLAVPIHWLLMFYQS 348

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
            VGN+G+AI+L T+ V+ L FPL K QY S A M+N+QPK+ +L+E+F     Q + +AM
Sbjct: 349 FVGNWGVAIILITLTVRGLLFPLTKAQYTSMAKMRNLQPKLQDLKERFGD-DRQKMGQAM 407

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           ++LYK   +NP+ GC PILLQ+P+F A+Y V+  S E+RHAPF  WI DL+  DP     
Sbjct: 408 MELYKKEKVNPMGGCLPILLQMPIFIALYWVLLESFELRHAPFMLWIHDLSVQDPYY--- 464

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSP--PPADKGQAMILNWMPVVFVFALSS 533
                           I P++M  SMF+  KM P  P  D  Q  ++ WMPV+F      
Sbjct: 465 ----------------ILPLLMGASMFVMQKMQPIAPTMDPMQVKMMQWMPVIFTVFFLW 508

Query: 534 FPAGLIIYWSWSNVISIVQQAVIM 557
           FP+GL++YW   N+++I+QQ +I 
Sbjct: 509 FPSGLVLYWLVGNIVAIIQQKIIY 532


>gi|317401604|gb|EFV82230.1| inner membrane protein oxaA [Achromobacter xylosoxidans C54]
          Length = 561

 Score =  341 bits (875), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 142/590 (24%), Positives = 251/590 (42%), Gaps = 51/590 (8%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYV---YPRIEEMNNERKNIQTVKQPNQVDNSYAAVL 57
           M+      + +  S  ++  W N+ +    P +        +      P   +N+  +V 
Sbjct: 1   MDI-RRTVLWMIFSFSLLLLWNNWQIHNGKPSLFGAPTPTASTNANGTPAAANNATPSVP 59

Query: 58  ID-------------DRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
                            A   + S  V +    L  + +  GAQ     L  Y     ++
Sbjct: 60  NAPPATAAAPSAVPGAAAPVPTRSEEVVITTDVLRLTFDTLGAQLVRAELLKYPATGQAD 119

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWN--LISGKILTPTTPIKLVFKN 162
            P V L         Y A+   V  AN    P   T +       ++   +  +    ++
Sbjct: 120 KPTVLL--DRTAGLNYVAQTGVVGAANGQNFPTHQTPFRVVSTDRQMTGDSLAVAFEAES 177

Query: 163 ANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHK--PQTATNTFGVQEGF 220
               + +        Y   +   + N     +  +   ++ R    P   ++ +    G 
Sbjct: 178 GGVKVTKTFTLHRGRYDIDVRHDLANVGAAPVTPALYLQLERDGNDPADTSSFYHTFTGM 237

Query: 221 IAVLGDKSLVEQKYSDIEKSSISNFHE-SNSWLGISDKYWASVFIPSKETSFHSQFKYLS 279
                     +  ++DIEK   +   +  N W+ +   Y+A+ ++P +    +++   + 
Sbjct: 238 AVYSEQDKFQKMTFADIEKKKANYIKQADNGWIAVVQHYFATAWVPPQGKPRNNEVLEVQ 297

Query: 280 DGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWF 339
                Y A+       I PG +    + L+ G ++   +         P  E+++D+GW 
Sbjct: 298 KN--LYAARTIEAVGEIAPGAAARVDSHLWVGPQDQKAMAALA-----PGLELVVDYGWL 350

Query: 340 YFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDEL 399
             IAKP+F LM++ ++++GN+G  I+  TV +K LF+PLA   Y S A MK + P++  L
Sbjct: 351 TIIAKPLFTLMTWLHSILGNWGWTIVALTVLIKALFYPLAAASYRSMARMKQVAPRLQAL 410

Query: 400 REKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFW 459
           +EK+     Q L  AM+++Y+T  INPL GC P+++QIPVF ++Y V+  S+EMR AP+ 
Sbjct: 411 KEKYGDDK-QKLNAAMMEMYRTEKINPLGGCLPMVVQIPVFISLYWVLLASVEMRGAPWI 469

Query: 460 GWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMI 519
            W+ DL+  DP                     I P IM  +MF+Q+K++P P D  QA +
Sbjct: 470 LWVHDLSIRDPYF-------------------ILPAIMMATMFLQIKLNPTPPDPVQAKV 510

Query: 520 LNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDR 569
           +  MP+VF   +  FPAGL++YW  +N +SI QQ  I +    +      
Sbjct: 511 MMIMPLVFGGMMFFFPAGLVLYWCVNNTLSIAQQWSITRAMQRKTEAAAN 560


>gi|238921764|ref|YP_002935279.1| inner membrane protein translocase component YidC [Edwardsiella
           ictaluri 93-146]
 gi|259515692|sp|C5BF61|OXAA_EDWI9 RecName: Full=Inner membrane protein oxaA
 gi|238871333|gb|ACR71044.1| inner membrane protein OxaA [Edwardsiella ictaluri 93-146]
          Length = 541

 Score =  341 bits (875), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 142/571 (24%), Positives = 250/571 (43%), Gaps = 56/571 (9%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N F+ +AL  +    WQ +      + +        +      V  S        
Sbjct: 1   MDSQRNLFL-VALLFVSFLIWQAWQTDHNPQPVAQTAGQSISDTASQAVPESG------- 52

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
                     + +K   L  +IN +G   +  +L  Y   + S++P   L   +  +  Y
Sbjct: 53  ------QGKLITVKTDVLALTINTRGGDIEQADLLAYPATLGSDTPFQLL--ETTPQFVY 104

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL-----TPTTPIKLVFKNANNILFERTISLD 175
            A+      +      N        +              I L +  AN +++ +T  L 
Sbjct: 105 QAQSGLTGKSGPDNPANGARPLYSANQTSYEMLPGQDELRIPLTYTAANGVIYTKTFVLK 164

Query: 176 EHYL-FKIVDTVTNNSIDQIRFSPRGRIMRH-----KPQTATNTFGVQEGFIAVLGDKSL 229
            +     +   V N+S D +  +  G++ +         T +N F +     A       
Sbjct: 165 RNDYAIAVDYKVKNDSHDALDLTLFGQLKQSVDLPKHRDTGSNNFALHTFRGAAYSSSDD 224

Query: 230 VEQKY-SDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAK 288
             QKY     +    N      W+ +  +Y+A+ +IP       + F   + G+ +    
Sbjct: 225 KYQKYSFSDIEDKNLNVQTKGGWVAMLQQYFATAWIPHDSG--VNTFYSANLGNGQAAIG 282

Query: 289 FSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFM 348
           + A  +++ P      +  L+ G +    +         P  ++ +D+GW +FI++P+F 
Sbjct: 283 YKAPSVSVAPNTEKVLSTTLWVGPELQSDMAAVA-----PHLDLTVDYGWLWFISQPLFK 337

Query: 349 LMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPP 408
           L+   ++ VGN+G AI++ T  V+ + +PL K QY S A M+ +QPK+  +RE+      
Sbjct: 338 LLQLIHSFVGNWGFAIIIITFIVRGIMYPLTKAQYTSMAKMRMLQPKLQAMRERIGDDK- 396

Query: 409 QVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAA 468
           Q + + M+ LYKT  +NPL GC+P+L+Q+P+F A+Y ++  S+E+R APF  WI DLAA 
Sbjct: 397 QRMSQEMMALYKTEKVNPLGGCFPLLIQMPIFLALYYMLMGSVELRQAPFALWIHDLAAP 456

Query: 469 DPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVF 527
           DP                     I PI+M ++MF   KMSP    D  Q  I+ +MPV+F
Sbjct: 457 DPFY-------------------ILPILMGVTMFFIQKMSPTTVTDPMQQKIMTFMPVIF 497

Query: 528 VFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
                 FP+GL++Y+  SN+++I+QQ +I +
Sbjct: 498 TVFFLWFPSGLVLYYIVSNLVTIIQQQLIYR 528


>gi|224367782|ref|YP_002601945.1| OxaA [Desulfobacterium autotrophicum HRM2]
 gi|223690498|gb|ACN13781.1| OxaA [Desulfobacterium autotrophicum HRM2]
          Length = 557

 Score =  341 bits (875), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 155/574 (27%), Positives = 268/574 (46%), Gaps = 32/574 (5%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFY-------VYPRIEEMNNERKNIQTVKQPNQVDNSY 53
           M+     F AI LS++++  W  F+         P    ++NE+            D + 
Sbjct: 1   MDDQKRLFTAIILSIVVIVGWNFFFVDSKPVPEKPDQAIVSNEQPMAGKGDIAPITDPAP 60

Query: 54  AAVLIDDRAQALSMS------PRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPI 107
           +     D AQ  + +        +++ N     +I+  GA+ + L L  Y      +SP+
Sbjct: 61  SQQTEIDAAQPPATAIPTRNARTIQVSNQFYNIAISETGAKVNSLTLNAYRETSEKDSPL 120

Query: 108 VTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNIL 167
             ++SP+ T   +   LD  S    +E              +      +   + +A  ++
Sbjct: 121 KEMVSPNLTGGLFGVSLDGKSIPG-LETALFTAQTPSDQLNLDQGKKSLTFTWTSAQGVV 179

Query: 168 FERTISLD-EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGD 226
            E+  +   + YL      + N+S   ++ S    I         +    +  F      
Sbjct: 180 VEKIFTFSADSYLIGFDLVLKNSSGMPMKDSFMVEI-----PGIIDEKNARFSFEGPTTL 234

Query: 227 KSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQ 286
            +   ++    + +    +     W G +D+Y+ S  IP   T    +  + S       
Sbjct: 235 INDKLEEIKAKKIAEKDTYEGQIQWAGYTDRYFMSCLIPQAPTEAKVKLSFDS---PVVT 291

Query: 287 AKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPM 346
            ++  +   + PGK +T +  LF G K    +  Y  +      +  I++GWF  +AKP 
Sbjct: 292 TRYVQSMERLDPGKQVTYSFSLFMGPKSLKLLSSYGNN-----LKKAINFGWFDILAKPC 346

Query: 347 FMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQS 406
            M M+  + L+ N+GIAIML T+ +KL+F+PL  K Y S  +MK +QP + E+REK+K  
Sbjct: 347 LMGMNLIHGLIPNYGIAIMLLTLLIKLIFWPLGTKSYRSMNDMKKLQPLMMEMREKYKGD 406

Query: 407 PPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLA 466
             Q + + ++ LYKT+ +NP++GC P+++Q+P+FFA+Y+++  ++E+RHAPF  WI DL+
Sbjct: 407 K-QRMNQEVMGLYKTYKVNPMSGCLPMIVQMPIFFALYRMLYQAIELRHAPFMWWINDLS 465

Query: 467 AADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVV 526
           A D    F     +PF    +  + +  IIM  +MF+Q KMSP   D  QA ++  MP+ 
Sbjct: 466 APDRLFHFD--FAIPFMQAPY-GIPVLTIIMGATMFLQQKMSPSTGDPTQAKMMMLMPLF 522

Query: 527 FVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMH 560
             F   +FPAGL++YW  +NV+SI QQ  I K  
Sbjct: 523 MTFIFINFPAGLVLYWLVNNVLSIGQQYYIQKKF 556


>gi|294138798|ref|YP_003554776.1| inner membrane protein oxaA [Shewanella violacea DSS12]
 gi|293325267|dbj|BAI99997.1| inner membrane protein oxaA [Shewanella violacea DSS12]
          Length = 544

 Score =  341 bits (875), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 140/565 (24%), Positives = 237/565 (41%), Gaps = 38/565 (6%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           ME   N F+ I L  +    WQ +      + +  E  ++ T        +S        
Sbjct: 1   MESQRNIFL-IGLLFVSFLLWQQWQTDQAPQPVTTELTSVSTASNTTDAHSSDVPDADSA 59

Query: 61  -RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNA 119
             A  ++    + +    L+  IN  G       L  + L+  S+ P V L    +    
Sbjct: 60  LPAATVASKELITIHTDQLVIKINPVGGDIVYSALVEHKLEQESDEPFVLLEQTKDIN-- 117

Query: 120 YFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKL-----VFKNANNILFERTISL 174
           Y A+   +              ++  S           L               +  I  
Sbjct: 118 YIAQSGLIGRNGIDSSVKGRAHFDSASQDYTMAADQETLEVPLTYVAENGAKYTKMFIFH 177

Query: 175 DEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKY 234
              +   +   V N +   ++    G+I     +++++         A        E+  
Sbjct: 178 RGQFKIDVDYLVDNTTDKPLQVQMYGQIKHSIKKSSSSMIMPTYLGAAFSTSDIRYEKYK 237

Query: 235 SDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
            D       +      W  +   Y+ S +IP +           + G A     F     
Sbjct: 238 FDDMADKDLDKKTLGGWAAMLQHYFVSAWIPPENDQNTIFSSISAGGQAN--IGFRGAIY 295

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
            I PG + T ++  + G K+   +             +++D+G+ +++A P+  L+ +F 
Sbjct: 296 DIAPGATQTISSQFYVGPKDQEALSEISDS-----LNLVVDYGFLWWLAVPINKLLMFFQ 350

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
           ++V N+G+AI+L T+ V+ + FPL K QY S A M+N+QPK+ E++E+F     Q + +A
Sbjct: 351 SIVSNWGLAIILITLTVRGMLFPLTKAQYTSMAKMRNLQPKLAEMKERFGD-DRQKMGQA 409

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           M++LYK   +NP+ GC PILLQ+P+F ++Y V+  S+E+RHAPF  WI DL+  DP    
Sbjct: 410 MMELYKKEKVNPMGGCLPILLQMPIFISLYWVLMESVELRHAPFMLWITDLSVQDPYY-- 467

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSP--PPADKGQAMILNWMPVVFVFALS 532
                            + PI+M +SMF+  KM P  P  D  Q  ++ WMPVVF     
Sbjct: 468 -----------------VMPILMGISMFVMQKMQPMAPTMDPMQQKMMQWMPVVFTVFFL 510

Query: 533 SFPAGLIIYWSWSNVISIVQQAVIM 557
            FPAGL++YW   N+++I QQ +I 
Sbjct: 511 WFPAGLVLYWLVGNLVAITQQKIIY 535


>gi|149375641|ref|ZP_01893410.1| Preprotein translocase subunit YidC [Marinobacter algicola DG893]
 gi|149360043|gb|EDM48498.1| Preprotein translocase subunit YidC [Marinobacter algicola DG893]
          Length = 570

 Score =  341 bits (875), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 141/596 (23%), Positives = 250/596 (41%), Gaps = 63/596 (10%)

Query: 1   MERNWNYFVA--IALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQ---------- 48
           M+       A    +S ++V AW   Y  P+ +    +          +           
Sbjct: 1   MDIQRIVLFAGLAIVSYMMVLAWNEDYHQPQTQPATEQASTTTQPASTDDMTLPGESATG 60

Query: 49  ----------VDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYH 98
                      +     +   + +   +    + ++       I+  G    + +L  + 
Sbjct: 61  PDTSSEEFTTPEGDGQTLSASETSSVSASDQLITVRTDVYELKIDRVGGNLIESSLLQHD 120

Query: 99  LDVSSNSPIVTLLSPSNTKNAYFAELDYVSTAN-----NIELPNSNTVWNLISGKILTPT 153
             + S   +  L +   +K  Y  E   +         N   P  N   +    +    T
Sbjct: 121 RSLDSEESLRLLTN--TSKRTYIMESGLIGRDGIDSKRNGNAPVYNASASEYELQEGENT 178

Query: 154 TPIKLVFKNANNILFERTISL-DEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN 212
             + L F   NN+   +      + Y   +   + N S    + +  G+I+R +    T 
Sbjct: 179 LTVDLTFTTDNNVEVTKQYLFSRDSYEIDVRYQINNQSDSVWQANMTGKIVRDQAPDPTA 238

Query: 213 T----FGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKE 268
                     G +    +    +  + D+ ++ I+    +N WL     Y+ + ++P ++
Sbjct: 239 QNSLGIRAFLGMVVSSPEDPYEKFDFDDLSENPINQ-SVTNGWLAFLQHYFLAAWVPERD 297

Query: 269 TSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIP 328
                Q          Y   F      + PG++   +   + G K    + +       P
Sbjct: 298 QPAQFQSTRR---GPLYVMGFVYPATVVEPGQTSEVSAKAYVGPKIIERLENVA-----P 349

Query: 329 RFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTAN 388
             +  +D+G+ +FIA P+F+++ +F+ LVGN+G+AI+L TV VK +FF L+   Y S A 
Sbjct: 350 NLDRTVDFGFLFFIALPLFIILDWFHGLVGNWGVAIILLTVLVKAVFFKLSATSYRSMAR 409

Query: 389 MKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVIS 448
           M+ + P++  L+E +     Q + + M+ LYK   INPL GC PIL+Q+PVF ++Y V+ 
Sbjct: 410 MRAVAPQLTRLKELYGD-DRQRMSQEMMALYKREKINPLGGCLPILVQMPVFISLYWVLF 468

Query: 449 ISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMS 508
            S+++RHAPF  WI+DL+  DP                     I PI+M  SM +QM ++
Sbjct: 469 ESVQLRHAPFMLWIQDLSVMDPYF-------------------ILPILMGASMMLQMSLN 509

Query: 509 PPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEI 564
           P P D  QA I+  MP++F      FPAGL++YW  +N++SI QQ  I +   AE+
Sbjct: 510 PTPPDPMQAKIMKLMPLIFTVFFLWFPAGLVLYWLVNNILSISQQWYITRKIEAEV 565


>gi|330505869|ref|YP_004382738.1| putative inner membrane protein translocase component YidC
           [Pseudomonas mendocina NK-01]
 gi|328920155|gb|AEB60986.1| putative inner membrane protein translocase component YidC
           [Pseudomonas mendocina NK-01]
          Length = 592

 Score =  341 bits (874), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 139/614 (22%), Positives = 234/614 (38%), Gaps = 81/614 (13%)

Query: 1   MERNWNYFV--AIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLI 58
           M+   +  +     +S ++V  W   Y    +    +                +      
Sbjct: 1   MDIQRSILIVALAVVSYLMVLQWNEDYGQAALPAEVSTSTAATPALPDTPAATASTGSDD 60

Query: 59  DDRAQA-----------LSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPI 107
              A A            +    + +K   L  +I+ +G     L L  Y          
Sbjct: 61  IPTAVAEPTAAAVAPTAATSDELIRVKTDVLELAIDPRGGDIVQLRLPQYPRRQDRPDVP 120

Query: 108 VTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLV---FKNAN 164
             L   +  +  Y A+   +   N  +  +   +W+              LV     + N
Sbjct: 121 FQLF-DNGNERTYLAQSGLIGQ-NAPDKSSGRALWSSEKQSYEMAEGQDSLVVDLTYSEN 178

Query: 165 NILFERTISLDE----------------------HYLFKIVDTVTNNSIDQIRFSPRGRI 202
            + + +  S                          Y   +   + N S      +   ++
Sbjct: 179 GVSYIKRYSFKRGLNPECSAREQELKKPGCIDPSAYQVDVRYLIDNQSDQAWSGNLFAQL 238

Query: 203 MRHKPQT----ATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESN--------- 249
            R                  G      D+   +    DI+K                   
Sbjct: 239 KRDNSGDPSSTTATGTATYLGAAVWTADEPYKKISIKDIDKQDEKRRQGDANAWFKENVQ 298

Query: 250 -SWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFL 308
             W+     Y+ + ++P       +  +   D    Y   F+   + +  G    T   L
Sbjct: 299 GGWVAWLQHYFVTAWVP--NKDNTNLIQTRKDSQGNYIVGFTGPSVQVAAGGKGETGAIL 356

Query: 309 FAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTT 368
           +AG K    +         P  E+ +D+G+ +F+A+P+F L+   + ++GN+G +I++ T
Sbjct: 357 YAGPKLQEHLSTLS-----PGLELTVDYGFLWFLAQPIFWLLQVIHGVLGNWGWSIIVLT 411

Query: 369 VFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLA 428
           + +KL+FFPL+   Y S A M+ + PK+  L+E+      Q + +AM++LYK   INPL 
Sbjct: 412 IIIKLIFFPLSAASYRSMARMRAVSPKLQALKEQHGD-DRQKMSQAMMELYKKEKINPLG 470

Query: 429 GCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFM 488
           GC PIL+Q+PVF A+Y V+  S+EMR AP+  WI DL+  DP                  
Sbjct: 471 GCLPILVQMPVFLALYWVLLESVEMRQAPWLLWITDLSIKDPFF---------------- 514

Query: 489 HVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVI 548
              I PIIM  +MFIQ +++P P D  QA +L  MP++F F    FPAGL++YW  +N +
Sbjct: 515 ---ILPIIMGATMFIQQQLNPTPPDPMQARVLKLMPIIFTFFFLWFPAGLVLYWVVNNCL 571

Query: 549 SIVQQAVIMKMHGA 562
           SI QQ  I +   A
Sbjct: 572 SIAQQWYITRRIEA 585


>gi|308273509|emb|CBX30111.1| hypothetical protein N47_D29200 [uncultured Desulfobacterium sp.]
          Length = 551

 Score =  341 bits (874), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 147/565 (26%), Positives = 256/565 (45%), Gaps = 20/565 (3%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           ME+   + +A+ALS I+   W  FY   +  +   E +NI   + P    N         
Sbjct: 1   MEQAR-FIIAVALSFIVFLGWDYFYNDKKPAKQITEVQNIDKRQSPVDNKNINPPEKSSQ 59

Query: 61  RAQALSMSPR----VELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNT 116
               +    +     E+  P     IN K A      L+ Y+  +  +SP   L+     
Sbjct: 60  SDDTVFQENKPLRVFEINTPLYSVKINEKNAAITSFKLKKYNETIDVDSPKKELIPKDLN 119

Query: 117 KNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNANNILFERTISLD- 175
                   D  S         +       +  +   +  IK  +K+   ++ E+      
Sbjct: 120 TGTVIVGFDEKSVHGIENATYTADSNAAANLVLDQGSKEIKFYWKSPEGVIIEKKYKFSA 179

Query: 176 EHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVLGDKSLVEQKYS 235
           + YL  +   V N S   I+      I  +     +         +     + +      
Sbjct: 180 DTYLIGLKLNVLNQSSQSIKDRLFVSIESYNMSNKSTNSFEGPSALINGSLEQIK----- 234

Query: 236 DIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEIT 295
                  +++  +  W+ I D+Y+ S  IP      + +    +     ++ +++  E  
Sbjct: 235 LKNIEEKNSYPGNIKWVAIQDRYFMSAIIPVTPVEANMRLYMKAKDKGYFEEQYTLPEKE 294

Query: 296 ILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFYN 355
           I PG+       L+ G K    +     D         +++GWF F+AKP+   M++ Y+
Sbjct: 295 IRPGEQEEKEFKLYFGPKSLKLLGSLGYD-----LNKAVNFGWFDFLAKPVLYAMNFLYS 349

Query: 356 LVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKAM 415
            + N+G+ I+L T+F K++F+PL  K Y S   MK IQP + EL+EK+     + + + +
Sbjct: 350 FIPNYGVVIILLTIFFKIIFWPLGSKSYKSMNEMKKIQPLLAELKEKYGNDK-KRMNEEL 408

Query: 416 IQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIFT 475
           + LYKT+ INP+ GC P++ Q+PVFFA Y+++  ++E+RHAPF  WIKDL+A D    F 
Sbjct: 409 MGLYKTYKINPMGGCLPMVAQLPVFFAFYRMLYETIELRHAPFVFWIKDLSAPDRLFHFA 468

Query: 476 LFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMPVVFVFALSSFP 535
               +PF  P +  + +  I+M  +MFIQ KM+P   D  QA ++ ++P+VF     +F 
Sbjct: 469 --FTIPFMEPPY-GIPVLTIVMGATMFIQQKMAPAVGDPAQAKMMMFLPLVFTVIFINFS 525

Query: 536 AGLIIYWSWSNVISIVQQAVIMKMH 560
           AGL++YW  +NV+SI+QQ +I + +
Sbjct: 526 AGLVLYWLVNNVLSILQQNIISRKN 550


>gi|119503568|ref|ZP_01625651.1| putative inner membrane protein translocase component YidC [marine
           gamma proteobacterium HTCC2080]
 gi|119460630|gb|EAW41722.1| putative inner membrane protein translocase component YidC [marine
           gamma proteobacterium HTCC2080]
          Length = 571

 Score =  341 bits (874), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 141/594 (23%), Positives = 253/594 (42%), Gaps = 66/594 (11%)

Query: 1   MERNWNYFVAIA--LSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYA---- 54
           M+      +A A  LS +++  W  F         +   +   +   P            
Sbjct: 1   MDIQRYLLIAAAAVLSFMLLTEWNVFKDQRVAATQDTSPRIANSFSSPAASPQEQPTGIA 60

Query: 55  ----------------------AVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDL 92
                                 A   +    +      + +KN  L   ++L+G    + 
Sbjct: 61  NRSDIYDTAANSDDVPTILPALAPQTNTPLASSEPKNIIVIKNDVLEFVVDLRGGDIIET 120

Query: 93  NLRGYHLDV-SSNSPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILT 151
           +L  Y   +   ++P+V L    +++  Y  +   V          +            +
Sbjct: 121 SLTKYPERIEDPDTPLVLL--ERSSERTYIMQSGLVGPDGIDTNGRAIYDAAKNRYDATS 178

Query: 152 PTTPIKLVFKNANNIL-FERTISLDEH-YLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQT 209
            +  I L  ++    +  E+  ++  + Y  ++   + NN  +  +  P  ++ R     
Sbjct: 179 GSKTIVLSARDTPPGVAVEKHFTVAPNTYTIEVSYHIVNNGTEIWQSIPFAQLKRDSSPA 238

Query: 210 ATNT-----FGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFI 264
            +            G      +    +  ++DI         ++  W+ +   Y+ +  +
Sbjct: 239 PSADTSGFGMQPFLGAATTTPENRYEKFTFADIADDPWK-TQQTGGWIAMLQHYFTAALV 297

Query: 265 PSKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKD 324
           P  E +     +   DG     A F++  + I PG++ +     +AG K+  T+      
Sbjct: 298 PDAEATHTYSTRRTRDGFN--IAGFTSEPLRIAPGQTGSWNTQFYAGPKDQYTLAELA-- 353

Query: 325 LAIPRFEMLIDWGWFYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYV 384
              P  E+++D+GW ++I KP+F L++   ++V N+G+AI+L T+ +K  FF L+   Y 
Sbjct: 354 ---PHLELVVDYGWLWWIGKPLFWLLTQIQSVVINWGVAIILLTLLIKTAFFKLSAASYR 410

Query: 385 STANMKNIQPKIDELREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIY 444
           S A M+  QPK+  ++E+      Q   +AM++LYK   INP+ GC PIL+Q+PVF A+Y
Sbjct: 411 SMAKMRKAQPKMVAIKEQHANDK-QKQSQAMMELYKKEKINPMGGCLPILVQMPVFIALY 469

Query: 445 KVISISLEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQ 504
            V+  S+E+R APF  WIKDLA  DP                     + P++M  SMF  
Sbjct: 470 WVLMESVELRQAPFALWIKDLAVMDPYF-------------------VLPLMMGASMFFM 510

Query: 505 MKMSPPPADKGQAMILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMK 558
            K++PPP D  QA ++ W+PVVF F    FPAGL++YW  +N++S+ QQ  I +
Sbjct: 511 QKLNPPPPDPMQAKLMQWLPVVFTFFFLWFPAGLVLYWVVNNLLSMAQQYYITR 564


>gi|328471231|gb|EGF42133.1| membrane protein insertase [Vibrio parahaemolyticus 10329]
          Length = 540

 Score =  341 bits (874), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 140/570 (24%), Positives = 245/570 (42%), Gaps = 42/570 (7%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNIQTVKQPNQVDNSYAAVLIDD 60
           M+   N  + IAL+++    +Q + V         E+    +        +    V    
Sbjct: 1   MDSQRN-ILLIALALVSFLLFQQWQVAKNPAPQAVEQAQSSSTLPAPSFADELDPVPGQQ 59

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
           +A A      + +    L  SI+  G      +L  Y  ++ S+ P V L       + +
Sbjct: 60  QASA----KTITVTTDVLTLSIDTVGGDVVHADLNQYSAELDSSDPFVLL--KDTQGHQF 113

Query: 121 FAELDYVSTANNIELPNSNTVWNLISGKIL----TPTTPIKLVFKNANNILFERTISLDE 176
            A+   V         ++   +N+ +             + + F        +  +    
Sbjct: 114 IAQSGLVGPQGIDLSSSNRPHYNVSADSFTLADGQDELRVPMTFTANGIEYTKTYVLKRG 173

Query: 177 HYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATN-TFGVQEGFIAVLGDKSLVEQKYS 235
            Y   +   V NNS +   F     + ++      + T     G      D    +  + 
Sbjct: 174 SYALNVEYDVANNSGNNATFGMYAHLRQNLMDAGGSITMPTYRGGAYSTEDTRYKKYSFE 233

Query: 236 DIEKSSISNFHES-NSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHARYQAKFSANEI 294
           D++  ++S        W  +   Y+A+ +IP  E   +   + + +              
Sbjct: 234 DMQDRNLSINLADGQGWAAMIQHYFAAAWIPRNEPGTNLYTRVIGNLGD---IGVRMPNK 290

Query: 295 TILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAKPMFMLMSYFY 354
           TI  G        L+ G K    +         P  ++++D+GW +FIAKP+  L+++  
Sbjct: 291 TIATGDQAKFEATLWVGPKLQQEMAAVA-----PNLDLVVDYGWLWFIAKPLHSLLAFIQ 345

Query: 355 NLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFKQSPPQVLQKA 414
           + VGN+G+AI+  T  V+   +PL K QY S A M+ +QPK+  +RE+      Q + + 
Sbjct: 346 SFVGNWGVAIICLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLQAMRERIGD-DRQRMSQE 404

Query: 415 MIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKDLAAADPTNIF 474
           M++LYK   +NPL GC P++LQ+P+F A+Y  +  S+E+RH+PF+GWI DL+A DP    
Sbjct: 405 MMELYKKEKVNPLGGCLPLVLQMPIFIALYWALMESVELRHSPFFGWIHDLSAQDPYY-- 462

Query: 475 TLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPP-ADKGQAMILNWMPVVFVFALSS 533
                            I P++M  SMF+  KMSP    D  Q  I+ +MPV+F F    
Sbjct: 463 -----------------ILPLLMGASMFLIQKMSPTTVTDPMQQKIMTFMPVMFTFFFLF 505

Query: 534 FPAGLIIYWSWSNVISIVQQAVIMKMHGAE 563
           FP+GL++YW  SN+++++QQ +I K    +
Sbjct: 506 FPSGLVLYWLVSNIVTLIQQTLIYKALEKK 535


>gi|262377655|ref|ZP_06070875.1| YidC/Oxa1 family membrane protein insertase [Acinetobacter lwoffii
           SH145]
 gi|262307414|gb|EEY88557.1| YidC/Oxa1 family membrane protein insertase [Acinetobacter lwoffii
           SH145]
          Length = 587

 Score =  341 bits (874), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 141/586 (24%), Positives = 242/586 (41%), Gaps = 64/586 (10%)

Query: 11  IALSVIIVYAWQNFYVYPRIEEMNNER----------KNIQTVKQPNQVDNSYAAVLIDD 60
             ++ +++ AWQ  Y     +                 N QT    + +  +        
Sbjct: 14  FVVAYLLILAWQKDYGNAETKPQQETAVVSHDVSADLPNGQTATVASDLPQANVPAQQAT 73

Query: 61  RAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNSPIVTLLSPSNTKNAY 120
            A A      + ++       IN KG     + L  +  +  S+ P V L   S+ K  Y
Sbjct: 74  DATAPVSQQLISVQTDLYHLWINPKGGDIVRIELLNHDKNKDSDEPFVML--ESDAKRTY 131

Query: 121 FAELDYVSTANNIELPNSNTVWN--------------LISGKILTPTTPIKLVFKNANNI 166
            A+   +         N