BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780483|ref|YP_003064896.1| putative inner membrane
protein translocase component YidC [Candidatus Liberibacter asiaticus
str. psy62]
         (581 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|118589754|ref|ZP_01547159.1| putative inner membrane protein translocase component YidC [Stappia
           aggregata IAM 12614]
 gi|118437840|gb|EAV44476.1| putative inner membrane protein translocase component YidC [Stappia
           aggregata IAM 12614]
          Length = 606

 Score =  486 bits (1249), Expect = e-135,   Method: Composition-based stats.
 Identities = 252/600 (42%), Positives = 369/600 (61%), Gaps = 24/600 (4%)

Query: 3   RNWNYFVAIALSVIIVYAWQNFYVYPRIE--------------------EMNNERKNIQT 42
            N N  +AI LS+I++  WQ F   P++E                       ++ +   +
Sbjct: 4   ENRNTILAIVLSLIVLLGWQYFVAAPQLERQQAELQAQQEAAQQTATDSANPSKPQPTGS 63

Query: 43  VKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVS 102
                    +   +   +R  AL+ S RV +  PSL GS+NLKG + DD+ L+ YH  V+
Sbjct: 64  QGANTAAPAAGQQMAFANREAALAASQRVTIDTPSLEGSVNLKGGRLDDIRLKDYHETVN 123

Query: 103 SNSPIVTLLSPSNTKNAYFAELDYVS-TANNIELPNSNTVWNLISGKILTPTTPIKLVFK 161
            +SP + L SPS +   Y+A+  +V     N+ LP  +TVW++     LTP+TP+ L + 
Sbjct: 124 KSSPTIVLFSPSGSPKPYYADYGWVGDPGTNLALPGPDTVWSVDGEATLTPSTPLTLSWD 183

Query: 162 NANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFI 221
           N   ++F+RT S+D++Y+F +  +V N   D +   P G I R         + + EG +
Sbjct: 184 NGAGLIFKRTFSVDDNYMFTVNQSVENTGSDAVTLYPYGLIARKGMPETNGIYILHEGLL 243

Query: 222 AVLGDKSLVEQKYSDIEKSS-ISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSD 280
            V G + L E  Y D+ + S I        WLGI+DKYWA+  IP+    F   F + S 
Sbjct: 244 GVFGAEGLKEVDYDDLVEESSIRPSKVDQGWLGITDKYWAATLIPTPGQEFQPGFSH-SA 302

Query: 281 GHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFY 340
               +QA +  N +T+  G +  T+++LFAGAKE   +  YE+ L+I RFE+LIDWGWFY
Sbjct: 303 TTDVFQADYLGNGVTVAGGSTGETSSYLFAGAKETKLLDGYEEALSIERFELLIDWGWFY 362

Query: 341 FIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELR 400
           F+ KPMF  + YF++L GNFG+AI++ TV VKL+FFPLA K YVS + MK +QP++ E+R
Sbjct: 363 FLTKPMFFAIDYFFHLFGNFGVAILVVTVIVKLIFFPLANKSYVSMSKMKLVQPQMTEIR 422

Query: 401 EKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWG 460
           EK+     Q  Q+A+++LYK   INPLAGC PI++QIPVFF++YKV+ +++EMRHAPF+G
Sbjct: 423 EKYSD-DRQKQQQALMELYKKEKINPLAGCLPIVVQIPVFFSLYKVLYVTIEMRHAPFFG 481

Query: 461 WIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMIL 520
           WI+DL+A DPT +F LFG++P+  P  + +G+WP+IM ++MFIQMKM+P P D  Q MI 
Sbjct: 482 WIQDLSAPDPTTLFNLFGLIPWDPPQMLMLGVWPLIMGITMFIQMKMNPAPPDPTQQMIF 541

Query: 521 NWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNS 580
            WMPV+F F L+SFPAGL+IYW+W+N +S+ QQ VIM+  GA++ L D L S F +   +
Sbjct: 542 TWMPVIFTFMLASFPAGLVIYWAWNNTLSVTQQYVIMRRQGAKVELWDNLGSLFKRKKAA 601


>gi|307943178|ref|ZP_07658523.1| inner membrane protein OxaA [Roseibium sp. TrichSKD4]
 gi|307773974|gb|EFO33190.1| inner membrane protein OxaA [Roseibium sp. TrichSKD4]
          Length = 603

 Score =  485 bits (1248), Expect = e-135,   Method: Composition-based stats.
 Identities = 246/597 (41%), Positives = 360/597 (60%), Gaps = 21/597 (3%)

Query: 3   RNWNYFVAIALSVIIVYAWQNFYVYPRIEE-----------------MNNERKNIQTVKQ 45
            N N  +AIALS+ ++ AWQ F   P++E+                              
Sbjct: 4   ENRNTLLAIALSLAVLLAWQYFVAQPQLEKQQAALQAQQAAEQAQSDPQRPSAQNAPGAA 63

Query: 46  PNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSNS 105
                ++        R QA++ S RV L  P L GS+NL G + DD+ L+ YH  V  +S
Sbjct: 64  TTGAPSASGQEQFQTREQAIAASERVTLDTPRLSGSVNLVGGRIDDIRLKDYHETVDKSS 123

Query: 106 PIVTLLSPSNTKNAYFAELDYVS-TANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           P V L SP  +   ++A+  +VS    ++ LP ++TVW+  +G  LTP TP+ L F N  
Sbjct: 124 PTVVLFSPKGSPEPFYADYGWVSDPGADVALPGADTVWSAPAGAQLTPNTPLTLTFDNGG 183

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVL 224
            + F+RT S+DE+Y+F +  +V N+  + +   P G + R      TN + + EG + V 
Sbjct: 184 GLTFKRTFSIDENYMFSVTQSVENSGSEAVTLYPYGLLARTGQPETTNFYILHEGLLGVF 243

Query: 225 GDKSLVEQKYSDIEKSSISNF-HESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHA 283
           G++ L E  Y D+ ++ +         WLGI+DKYWA+  +P    +F   F + +    
Sbjct: 244 GEEGLKEVDYDDLAETGVDRPGKVDRGWLGITDKYWAATLVPEPGQTFQPSFTHSNV-TD 302

Query: 284 RYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIA 343
            YQA F  + + I  G +    ++LFAGAKE   +  YE  L I +FE+LIDWGWFYF+ 
Sbjct: 303 NYQADFLGSAVVIAAGSTSEANSYLFAGAKETKLLDSYEATLNIEQFELLIDWGWFYFLT 362

Query: 344 KPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKF 403
           KPMF  + + + + GNFG+AI+L TV +KL+FFPLA K YVS + MK +QP++ E+R+++
Sbjct: 363 KPMFFAIDWLFMMFGNFGVAILLVTVAIKLVFFPLANKSYVSMSKMKLVQPQMQEIRDRY 422

Query: 404 KQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIK 463
                +  Q+A+++LYK   INPLAGC PIL+QIPVFFA+YKV+ +++EMRHAPF+GWI+
Sbjct: 423 GDDKAK-QQQALMELYKKEKINPLAGCLPILIQIPVFFALYKVLFVTIEMRHAPFFGWIQ 481

Query: 464 DLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWM 523
           DL+A DPT IF LFG++P+  P  + VGIWP++M ++MF+QMKM+P P D  Q MI  WM
Sbjct: 482 DLSAPDPTTIFNLFGMIPWDPPQLLTVGIWPLLMGITMFVQMKMNPAPPDPTQQMIFTWM 541

Query: 524 PVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNYNS 580
           P++F F L+SFPAGL+IYW+W+N +SI QQ VIM   G ++ L D L+STF +    
Sbjct: 542 PIIFTFMLASFPAGLVIYWAWNNFLSIAQQWVIMSRQGVKVELFDNLKSTFKRKPAK 598


>gi|254502069|ref|ZP_05114220.1| 60Kd inner membrane protein [Labrenzia alexandrii DFL-11]
 gi|222438140|gb|EEE44819.1| 60Kd inner membrane protein [Labrenzia alexandrii DFL-11]
          Length = 608

 Score =  485 bits (1247), Expect = e-134,   Method: Composition-based stats.
 Identities = 257/602 (42%), Positives = 368/602 (61%), Gaps = 26/602 (4%)

Query: 3   RNWNYFVAIALSVIIVYAWQNFYVYPRIEE----------------------MNNERKNI 40
            N N  +AI LS+I++ AWQ FY  P++E                         +     
Sbjct: 4   ENRNTILAIVLSLIVLLAWQYFYAGPQLERQQAALQAQQEAEAAQQSAPGGVNPDAPTPS 63

Query: 41  QTVKQPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLD 100
                     ++ +      R QALS + RV +  P L GSINL G + DDL L+ YH  
Sbjct: 64  VAGSGTTVAPSATSPQGFASREQALSATQRVVIDTPRLEGSINLTGGRLDDLRLKDYHET 123

Query: 101 VSSNSPIVTLLSPSNTKNAYFAELDYVSTAN-NIELPNSNTVWNLISGKILTPTTPIKLV 159
           V  +SP + L SP+ + N Y+++  +V+ A  +I LP  +T+W++     LTP+TP+ L 
Sbjct: 124 VDRSSPTIVLFSPTGSPNPYYSDYGWVADAGASITLPGPDTIWSVNGSSDLTPSTPLTLS 183

Query: 160 FKNANNILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEG 219
           + N   ++F RT S+DE+Y+F +  +VTNNS D +   P G I R      T  + + EG
Sbjct: 184 WDNGEGLVFNRTFSVDENYMFDVTQSVTNNSGDVVTLYPYGLIARKGIPETTGIWILHEG 243

Query: 220 FIAVLGDKSLVEQKYSDIEKS-SISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYL 278
            + V G++ LVE  YSD+E+   +        WLGI+DKYWA+  IP+    F   F Y 
Sbjct: 244 LLGVFGEEGLVEVDYSDLEEDGPVRPAAVDRGWLGITDKYWAATLIPTPGQEFQPGFSYA 303

Query: 279 SDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGW 338
           +     +QA +  N + +  G    T+++LFAGAKE   +  YE  L+I RFE+LIDWGW
Sbjct: 304 AQSGN-FQADYLGNAVVVPAGGVGETSSYLFAGAKETNLLDAYEASLSIERFELLIDWGW 362

Query: 339 FYFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDE 398
           FYF+ KPMF  + + ++  GNFG+AI+L TV +KL FFPLA K YVS + MK +QP++ E
Sbjct: 363 FYFLTKPMFYAIDFLFHYFGNFGVAILLVTVIIKLFFFPLANKSYVSMSKMKLVQPQMTE 422

Query: 399 LREKFKQSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPF 458
           +REK+     Q  Q+A+++LYK   INPLAGC PIL+QIPVFFA+YKV+ +++EMRHAPF
Sbjct: 423 IREKYAD-DRQKQQQALMELYKKEKINPLAGCLPILIQIPVFFALYKVLFVTIEMRHAPF 481

Query: 459 WGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAM 518
           +GWI+DL+A DPT++F LFG++P+  P  + +G+WP+IM ++MF+QMKM+P P D  Q M
Sbjct: 482 FGWIQDLSAPDPTSLFNLFGLIPWDPPQLLMLGVWPLIMGITMFVQMKMNPAPPDPTQQM 541

Query: 519 ILNWMPVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKMHGAEIGLIDRLRSTFSKNY 578
           I  WMPVVF F L+SFPAGL+IYW+W+N +SI QQ VIM   G ++ L D + S F +  
Sbjct: 542 IFTWMPVVFTFMLASFPAGLVIYWAWNNSLSIAQQWVIMSRQGVKVELWDNIGSMFKRKK 601

Query: 579 NS 580
            +
Sbjct: 602 PA 603


>gi|241202849|ref|YP_002973945.1| inner membrane protein translocase component YidC [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240856739|gb|ACS54406.1| 60 kDa inner membrane insertion protein [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 597

 Score =  484 bits (1246), Expect = e-134,   Method: Composition-based stats.
 Identities = 287/593 (48%), Positives = 385/593 (64%), Gaps = 17/593 (2%)

Query: 1   MERNWNYFVAIALSVIIVYAWQNFYVYPRIEEMNNERKNI----------------QTVK 44
           ME N NYF+AIALSV+IV  WQ  Y+ PRIE     ++                  QT  
Sbjct: 1   MENNRNYFIAIALSVLIVLGWQFLYMNPRIEAQRKVQEAQKAQQQTEQVQQPAAGGQTPA 60

Query: 45  QPNQVDNSYAAVLIDDRAQALSMSPRVELKNPSLIGSINLKGAQFDDLNLRGYHLDVSSN 104
           QP+    +  A       QAL+ SPRV +   +L GSINL GA+ DDL L+GYH  V  +
Sbjct: 61  QPSGAAPTSQAAATATLEQALAKSPRVVIDTAALSGSINLAGARLDDLKLKGYHETVDDS 120

Query: 105 SPIVTLLSPSNTKNAYFAELDYVSTANNIELPNSNTVWNLISGKILTPTTPIKLVFKNAN 164
           SPI+TL SP+ TK+ YF EL Y+ +     +P  +T+W    G  LT  TP+ L + N  
Sbjct: 121 SPIITLFSPAETKDGYFTELGYIGSDATGSVPGPSTLWTAPEGAKLTEKTPVTLSYTNDK 180

Query: 165 NILFERTISLDEHYLFKIVDTVTNNSIDQIRFSPRGRIMRHKPQTATNTFGVQEGFIAVL 224
            + F RTIS+DE Y+F + D + N        +  GR+ R+   T  + + + EGFI V+
Sbjct: 181 GLTFTRTISVDERYMFTVADKIENAGQAPASLNSYGRVTRYNKPTTPSVYVLHEGFIGVI 240

Query: 225 GDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPSKETSFHSQFKYLSDGHAR 284
           GD  LVE KY+  EK ++     +  WLGI+DKYWA+  +P +   + + F + +DG  R
Sbjct: 241 GDDGLVETKYTAAEKEAVKPAKSTGGWLGITDKYWAATIVPPQSAPYEASFSHFADGQPR 300

Query: 285 YQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRFEMLIDWGWFYFIAK 344
           YQA +  +  T+ PG+SI   N +FAGAKE P I  YE   +IP+F+ LIDWGWFYFI K
Sbjct: 301 YQADYKEDAFTVAPGQSIELKNLVFAGAKEVPVIDGYEASYSIPKFDRLIDWGWFYFITK 360

Query: 345 PMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLAKKQYVSTANMKNIQPKIDELREKFK 404
           PMF LM +F+   GNFG+AI+ TT+ VKLLFFPLA KQY S ANMK +QPK++EL+ KF 
Sbjct: 361 PMFKLMDFFFRYFGNFGVAILCTTIVVKLLFFPLASKQYASMANMKRMQPKMEELKAKFA 420

Query: 405 QSPPQVLQKAMIQLYKTHNINPLAGCWPILLQIPVFFAIYKVISISLEMRHAPFWGWIKD 464
                 LQ+A +QLYK   INP+AGCWP+ LQIP+FF++YKVI I++EMRHAPF+GWIKD
Sbjct: 421 D-DRMGLQQATMQLYKEEKINPIAGCWPVALQIPIFFSLYKVIYITIEMRHAPFFGWIKD 479

Query: 465 LAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPPPADKGQAMILNWMP 524
           L+A DPT I  LFG+LPF  P  +H+G+WP+IM ++MF+QM+M+P P D  QAMI  WMP
Sbjct: 480 LSAPDPTTIVNLFGLLPFEAPTILHLGV