RPSBLAST alignment for GI: 254780483 and conserved domain: PRK01622

>gnl|CDD|179310 PRK01622, PRK01622, OxaA-like protein precursor; Validated. Length = 256
 Score =  124 bits (313), Expect = 6e-29
 Identities = 70/234 (29%), Positives = 113/234 (48%), Gaps = 37/234 (15%)

Query: 340 YFIAKPMFMLMSYFYNLVGNFGIAIMLTTVFVKLLFFPLA----KKQYVSTANMKNIQPK 395
           YF+    F++    +++ G++GIAI++ T+ ++ L  PLA    K Q      M  ++P+
Sbjct: 40  YFVYPFSFLIQFVAHHIGGSYGIAIIIVTLIIRSLMIPLAVSQYKSQRGMQEKMAVMKPE 99

Query: 396 IDELREKFKQSPPQV----LQKAMIQLYKTHNINPLA-GCWPILLQIPVFFAIYKVISIS 450
           +D+++ K K +         QK M++LYK+ NINPLA GC P+L+Q+P+  A Y  I  +
Sbjct: 100 LDKIQAKLKVTKDLEKQKEYQKEMMELYKSGNINPLAMGCLPLLIQMPILSAFYYAIRRT 159

Query: 451 LEMRHAPFWGWIKDLAAADPTNIFTLFGILPFYLPGFMHVGIWPIIMSLSMFIQMKMSPP 510
            E+    F  W  +L  AD                      I PII  L+ FIQMK+S  
Sbjct: 160 EEIASHSFL-WF-NLGHADH---------------------ILPIIAGLTYFIQMKVSQS 196

Query: 511 ----PADKGQAMILNWM-PVVFVFALSSFPAGLIIYWSWSNVISIVQQAVIMKM 559
               P       I   M P + +F   + P+ L++YW    +  + Q  V+ K+
Sbjct: 197 NGTSPEQVQMLKIQGIMMPAMILFMSFAAPSALVLYWITGGLFLMGQTIVLRKV 250