HHsearch alignment for GI: 254780484 and conserved domain: COG0481

>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane].
Probab=99.40  E-value=7.7e-13  Score=92.95  Aligned_cols=170  Identities=18%  Similarity=0.182  Sum_probs=112.0

Q ss_pred             HCCCCCCCEEEEECCCCCCHHHHHHHHHCCCC-------EEEEC------CCCCEEEECCEEEEEEEEEEEECCCEEEEE
Q ss_conf             58876686899974899889899999738973-------79873------888414521202665556785089649999
Q gi|254780484|r   23 LLPKAGPPEIAFSGRSNVGKSSLINILVNRKN-------LARTS------NAPGRTQHLNFFVPKDFSNLKNNLPAMALV   89 (212)
Q Consensus        23 ~~P~~~~p~VaivG~~NvGKSSLiNaL~g~~~-------~a~~~------~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~   89 (212)
T Consensus         3 ~~~~~~IRNFsIIAHIDHGKSTLaDRlle~t~~~~~Rem~~Q~LDsMdiERERGITIKaq~v~l~Yk-~~~g~~Y~lnlI   81 (603)
T COG0481           3 FTPQKNIRNFSIIAHIDHGKSTLADRLLELTGGLSEREMRAQVLDSMDIERERGITIKAQAVRLNYK-AKDGETYVLNLI   81 (603)
T ss_pred             CCCHHHCCCEEEEEEECCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEEEEEEE-ECCCCEEEEEEC
T ss_conf             6725442322799984278204889999984676767888875221346766284587327899999-479977999972


Q ss_pred             ECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             76001011122447898888998777766420000011223578875454554321025753221222211110246899
Q gi|254780484|r   90 DMPGYGYARAPKKNVDSWGGLIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQE  169 (212)
Q Consensus        90 DtpG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~  169 (212)
T Consensus        82 DTPGHVDFsYEVS-------------RSLAACEGalLvVDAsQGveAQTlAN~YlAle~~LeIiPViNKIDLP~-Adper  147 (603)
T COG0481          82 DTPGHVDFSYEVS-------------RSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNKIDLPA-ADPER  147 (603)
T ss_pred             CCCCCCCEEEEEH-------------HHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCC-CCHHH
T ss_conf             7998443677761-------------337637771899987655378899999999876967997532256887-89789


Q ss_pred             HHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             99999999753136898689998888899899999999872
Q gi|254780484|r  170 TLEKTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       170 ~~~~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
T Consensus       148 vk~eIe~~i---Gid~~dav~~SAKtG~gI~~iLe~Iv~~i  185 (603)
T COG0481         148 VKQEIEDII---GIDASDAVLVSAKTGIGIEDVLEAIVEKI  185 (603)
T ss_pred             HHHHHHHHH---CCCCCCCEEEECCCCCCHHHHHHHHHHHC
T ss_conf             999999870---98952004676346899799999999628