HHsearch alignment for GI: 254780484 and conserved domain: COG3276

>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis].
Probab=99.45  E-value=9.6e-13  Score=92.40  Aligned_cols=158  Identities=22%  Similarity=0.333  Sum_probs=118.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCC-CEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897-37987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRK-NLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~-~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
T Consensus         2 ii~t~GhidHgkT~L~~altg~~~d~l~EekKRG~TiDlg~~------y~~~~d~~~~fIDvpgh~~~------------   63 (447)
T COG3276           2 IIGTAGHIDHGKTTLLKALTGGVTDRLPEEKKRGITIDLGFY------YRKLEDGVMGFIDVPGHPDF------------   63 (447)
T ss_pred             EEEEEEEEECCCHHHHHHHCCCCCCCCHHHHHCCCEEEEEEE------ECCCCCCCEEEEECCCCHHH------------
T ss_conf             699740020143022333025533205456615846842057------32577773688618984788------------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCC-CCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCE
Q ss_conf             9987777664200000112235788754545543210257532-212222111102468999999999975313689868
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGVKQIDQDVFSFLDKKAVSY-QIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAHPEV  188 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~~~i  188 (212)
T Consensus        64 -i~~miag~~~~d~alLvV~~deGl~~qtgEhL~iLdllgi~~giivltk~D~~d~~r~e~~i~~Il~~l~---l~~~~i  139 (447)
T COG3276          64 -ISNLLAGLGGIDYALLVVAADEGLMAQTGEHLLILDLLGIKNGIIVLTKADRVDEARIEQKIKQILADLS---LANAKI  139 (447)
T ss_pred             -HHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCC---CCCCCC
T ss_conf             -9999854057745899984755766436889999986198732899962234467889999999986502---000323


Q ss_pred             EEEECCCCCCHHHHHHHHHHHH
Q ss_conf             9998888899899999999872
Q gi|254780484|r  189 IPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       189 ~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
T Consensus       140 ~~~s~~~g~Gi~~Lk~~l~~L~  161 (447)
T COG3276         140 FKTSAKTGRGIEELKNELIDLL  161 (447)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHH
T ss_conf             0110125787799999998752