HHsearch alignment for GI: 254780484 and conserved domain: KOG0084

>KOG0084 consensus.
Probab=99.02  E-value=3.8e-09  Score=71.72  Aligned_cols=157  Identities=14%  Similarity=0.102  Sum_probs=90.0

Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             68999748998898999997389737987388841452120266555678508964999976001011122447898888
Q gi|254780484|r   30 PEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        30 p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
T Consensus        10 FKiiliGds~VGKtCL~~Rf~~~~f-~e---~~~sTIGV--Df~~rt~e~~gk~iKlQIWDTAGQERFrtit~s------   77 (205)
T KOG0084          10 FKIILIGDSGVGKTCLLLRFKDDTF-TE---SYISTIGV--DFKIRTVELDGKTIKLQIWDTAGQERFRTITSS------   77 (205)
T ss_pred             EEEEEECCCCCCHHHHHHHHCCCCC-CH---HHCCEEEE--EEEEEEEEECCEEEEEEEEECCCCHHHHHHHHH------
T ss_conf             9999987789676355566626985-33---32323126--788987555264888876663653777555476------


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCC--CCHH--HHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             998777766420000011223578--8754--545543210257532212222111102468999999999975313689
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHG--VKQI--DQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~--~~~~--~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
T Consensus        78 ----y---YR~ahGii~vyDiT~~~SF~~v~~Wi~Ei~~~~~~~v~~lLVGNK~Dl~~~~~v~~--~~a~~fa~~~---~  145 (205)
T KOG0084          78 ----Y---YRGAHGIIFVYDITKQESFNNVKRWIQEIDRYASENVPKLLVGNKCDLTEKRVVST--EEAQEFADEL---G  145 (205)
T ss_pred             ----H---CCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCHHHCCCCH--HHHHHHHHHC---C
T ss_conf             ----6---16787599999765577765488999986652467787688862455186400179--9999998642---9


Q ss_pred             CC-EEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             86-89998888899899999999872
Q gi|254780484|r  186 PE-VIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~-i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
T Consensus       146 ~~~f~ETSAK~~~NVe~~F~~la~~l  171 (205)
T KOG0084         146 IPIFLETSAKDSTNVEDAFLTLAKEL  171 (205)
T ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHH
T ss_conf             83035504687547999999999999