HHsearch alignment for GI: 254780484 and conserved domain: KOG0086

>KOG0086 consensus.
Probab=98.22  E-value=9.3e-06  Score=52.22  Aligned_cols=155  Identities=14%  Similarity=0.110  Sum_probs=81.7

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             86899974899889899999738973798738884145212026655567850896499997600101112244789888
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDMPGYGYARAPKKNVDSWG  108 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~~~~~~~~~DtpG~~~~~~~~~~~~~~~  108 (212)
T Consensus         9 LfKfl~iG~aGtGKSCLLh~Fie~kfkDdssHTiGve------FgSrIinVGgK~vKLQIWDTAGQErFRSVtRsYYR--   80 (214)
T KOG0086           9 LFKFLVIGSAGTGKSCLLHQFIENKFKDDSSHTIGVE------FGSRIVNVGGKTVKLQIWDTAGQERFRSVTRSYYR--   80 (214)
T ss_pred             HHEEEEECCCCCCHHHHHHHHHHHHCCCCCCCEEEEE------ECCCEEEECCCEEEEEEEECCCHHHHHHHHHHHHC--
T ss_conf             3026886468886327999999864136546442022------01102540571899998634257889999998753--


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCC--CCCHHHH--HHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             899877776642000001122357--8875454--554321025753221222211110246899999999997531368
Q gi|254780484|r  109 GLIVRYLSERSTLRCVYLLIDCRH--GVKQIDQ--DVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTA  184 (212)
Q Consensus       109 ~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~--~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~  184 (212)
T Consensus        81 -----------GAAGAlLVYD~TsrdsfnaLtnWL~DaR~lAs~nIvviL~GnKkDL~~~R~V--tflEAs~FaqE---n  144 (214)
T KOG0086          81 -----------GAAGALLVYDITSRDSFNALTNWLTDARTLASPNIVVILCGNKKDLDPEREV--TFLEASRFAQE---N  144 (214)
T ss_pred             -----------CCCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHCCHHHHH--HHHHHHHHHCC---C
T ss_conf             -----------6564279985245556999999888777647996799993771214412100--38998866330---3


Q ss_pred             CCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             98689998888899899999999
Q gi|254780484|r  185 HPEVIPTSSVKRKGIEVLRKAIL  207 (212)
Q Consensus       185 ~~~i~~vSA~~g~Gi~eL~~~I~  207 (212)
T Consensus       145 el~flETSa~TGeNVEEaFl~c~  167 (214)
T KOG0086         145 ELMFLETSALTGENVEEAFLKCA  167 (214)
T ss_pred             CEEEEEECCCCCCCHHHHHHHHH
T ss_conf             11112202323556899999999