HHsearch alignment for GI: 254780484 and conserved domain: KOG0093

>KOG0093 consensus.
Probab=98.60  E-value=4.3e-07  Score=59.91  Aligned_cols=155  Identities=15%  Similarity=0.086  Sum_probs=85.6

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEE-ECCCEEEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             89997489988989999973897379873888414521202665556785-08964999976001011122447898888
Q gi|254780484|r   31 EIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLK-NNLPAMALVDMPGYGYARAPKKNVDSWGG  109 (212)
Q Consensus        31 ~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~-~~~~~~~~~DtpG~~~~~~~~~~~~~~~~  109 (212)
T Consensus        23 KlliiGnssvGKTSfl~ry~ddSFt~---af-vsTvGid---FKvKTvyr~~kRiklQiwDTagqEryrtiTTay-----   90 (193)
T KOG0093          23 KLLIIGNSSVGKTSFLFRYADDSFTS---AF-VSTVGID---FKVKTVYRSDKRIKLQIWDTAGQERYRTITTAY-----   90 (193)
T ss_pred             EEEEECCCCCCCHHHHHHHHCCCCCC---CE-EEEEEEE---EEEEEEEECCCEEEEEEEECCCCHHHHHHHHHH-----
T ss_conf             68997268766213557760655440---00-4663113---788676514647788987166510356777887-----


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCC--C--HHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9987777664200000112235788--7--54545543210257532212222111102468999999999975313689
Q gi|254780484|r  110 LIVRYLSERSTLRCVYLLIDCRHGV--K--QIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLEKTKYLIRNYPTAH  185 (212)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~--~--~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  185 (212)
T Consensus        91 -----y---RgamgfiLmyDitNeeSf~svqdw~tqIktysw~naqvilvgnKCDmd~--eRvis~e~g~~l~~~L---G  157 (193)
T KOG0093          91 -----Y---RGAMGFILMYDITNEESFNSVQDWITQIKTYSWDNAQVILVGNKCDMDS--ERVISHERGRQLADQL---G  157 (193)
T ss_pred             -----H---HCCCEEEEEEECCCHHHHHHHHHHHHHHEEEECCCCEEEEEECCCCCCC--CEEEEHHHHHHHHHHH---C
T ss_conf             -----6---1464599998547878889899898875034316861899804557743--2001278888999984---8


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8689998888899899999999872
Q gi|254780484|r  186 PEVIPTSSVKRKGIEVLRKAILETI  210 (212)
Q Consensus       186 ~~i~~vSA~~g~Gi~eL~~~I~~~l  210 (212)
T Consensus       158 fefFEtSaK~NinVk~~Fe~lv~~I  182 (193)
T KOG0093         158 FEFFETSAKENINVKQVFERLVDII  182 (193)
T ss_pred             HHHHHHCCCCCCCHHHHHHHHHHHH
T ss_conf             4775513302666999999999999