HHsearch alignment for GI: 254780484 and conserved domain: KOG0393

>KOG0393 consensus.
Probab=97.54  E-value=3.9e-05  Score=48.67  Aligned_cols=156  Identities=15%  Similarity=0.148  Sum_probs=79.2

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCEEEECCEEEEEEEEEEEE---CCCEEEEEECCHHHHHHHHHHHHH
Q ss_conf             86899974899889899999738973798738884145212026655567850---896499997600101112244789
Q gi|254780484|r   29 PPEIAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKN---NLPAMALVDMPGYGYARAPKKNVD  105 (212)
Q Consensus        29 ~p~VaivG~~NvGKSSLiNaL~g~~~~a~~~~~p~tt~~~~~~~~~~~~~~~~---~~~~~~~~DtpG~~~~~~~~~~~~  105 (212)
T Consensus         4 ~~K~VvVGDga~GKT~ll~~~t~~~-------fp~~yvPTV--Fdnys~~v~V~dg~~v~L~LwDTAGqedYDr------   68 (198)
T KOG0393           4 RIKCVVVGDGAVGKTCLLISYTTNA-------FPEEYVPTV--FDNYSANVTVDDGKPVELGLWDTAGQEDYDR------   68 (198)
T ss_pred             EEEEEEECCCCCCCEEEEEEECCCC-------CCCCCCCEE--ECCCEEEEEECCCCEEEEEEEECCCCCCCCC------
T ss_conf             3699998988767458898843576-------866545638--7562389996489789986331479730113------


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCC----HHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHH---------
Q ss_conf             888899877776642000001122357887----5454554321025753221222211110246899999---------
Q gi|254780484|r  106 SWGGLIVRYLSERSTLRCVYLLIDCRHGVK----QIDQDVFSFLDKKAVSYQIVLTKIDKLSPTTAQETLE---------  172 (212)
Q Consensus       106 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~v~nK~D~~~~~~~~~~~~---------  172 (212)
T Consensus        69 -lRpl--sY~-~tdvfl~cfsv~~-p~S~~nv~~kW~pEi~~~--cp~vpiiLVGtk~DLr~d~~~~~~l~~~~~~~Vt~  141 (198)
T KOG0393          69 -LRPL--SYP-QTDVFLLCFSVVS-PESFENVKSKWIPEIKHH--CPNVPIILVGTKADLRDDPSTLEKLQRQGLEPVTY  141 (198)
T ss_pred             -CCCC--CCC-CCCEEEEEEECCC-HHHHHHHHHHHHHHHHHH--CCCCCEEEEEEHHHHHHCHHHHHHHHHCCCCCCCH
T ss_conf             -3636--778-8888999987698-266888775106889963--89998899821277653878899987465786567


Q ss_pred             -HHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             -999997531368986899988888998999999998
Q gi|254780484|r  173 -KTKYLIRNYPTAHPEVIPTSSVKRKGIEVLRKAILE  208 (212)
Q Consensus       173 -~~~~~~~~~~~~~~~i~~vSA~~g~Gi~eL~~~I~~  208 (212)
T Consensus       142 ~~g~~lA~--~iga~~y~EcSa~tq~~v~~vF~~a~~  176 (198)
T KOG0393         142 EQGLELAK--EIGAVKYLECSALTQKGVKEVFDEAIR  176 (198)
T ss_pred             HHHHHHHH--HHCCCEEEEEHHHHHCCCHHHHHHHHH
T ss_conf             89999999--859511232017563771888999999